diff options
Diffstat (limited to 'src/gui')
363 files changed, 13019 insertions, 4758 deletions
diff --git a/src/gui/CMakeLists.txt b/src/gui/CMakeLists.txt index 2630905323..fb60ac2781 100644 --- a/src/gui/CMakeLists.txt +++ b/src/gui/CMakeLists.txt @@ -39,7 +39,6 @@ add_qt_module(Gui FEATURE_DEPENDENCIES # special case: Qt::Network SOURCES - animation/qguivariantanimation.cpp image/qbitmap.cpp image/qbitmap.h image/qbmphandler.cpp image/qbmphandler_p.h image/qicon.cpp image/qicon.h image/qicon_p.h @@ -133,7 +132,13 @@ add_qt_module(Gui painting/qblittable.cpp painting/qblittable_p.h painting/qbrush.cpp painting/qbrush.h painting/qcolor.cpp painting/qcolor.h painting/qcolor_p.h - painting/qcolorprofile.cpp painting/qcolorprofile_p.h + painting/qcolormatrix_p.h + painting/qcolorspace.cpp painting/qcolorspace.h painting/qcolorspace_p.h + painting/qcolortransferfunction_p.h + painting/qcolortransfertable_p.h + painting/qcolortransform.cpp painting/qcolortransform.h painting/qcolortransform_p.h + painting/qcolortrc_p.h + painting/qcolortrclut.cpp painting/qcolortrclut_p.h painting/qcompositionfunctions.cpp painting/qcosmeticstroker.cpp painting/qcosmeticstroker_p.h painting/qdatabuffer_p.h @@ -143,6 +148,7 @@ add_qt_module(Gui painting/qemulationpaintengine.cpp painting/qemulationpaintengine_p.h painting/qfixed_p.h painting/qgrayraster.c painting/qgrayraster_p.h + painting/qicc.cpp painting/qicc_p.h painting/qimagescale.cpp painting/qmatrix.cpp painting/qmatrix.h painting/qmemrotate.cpp painting/qmemrotate_p.h @@ -209,6 +215,7 @@ add_qt_module(Gui text/qtextoption.cpp text/qtextoption.h text/qtexttable.cpp text/qtexttable.h text/qtexttable_p.h util/qabstractlayoutstyleinfo.cpp util/qabstractlayoutstyleinfo_p.h + util/qastchandler.cpp util/qastchandler_p.h util/qdesktopservices.cpp util/qdesktopservices.h util/qgridlayoutengine.cpp util/qgridlayoutengine_p.h util/qhexstring_p.h @@ -239,6 +246,7 @@ add_qt_module(Gui ) # Resources: + # special case: # This name is fixed in the code:-/ add_qt_resource(Gui qmake_webgradients PREFIX "/qgradient" BASE "painting" FILES @@ -270,10 +278,8 @@ add_qt_simd_part(Gui SIMD sse4_1 add_qt_simd_part(Gui SIMD neon SOURCES - ../3rdparty/pixman/pixman-arm-neon-asm.S image/qimage_neon.cpp painting/qdrawhelper_neon.cpp painting/qdrawhelper_neon_p.h - painting/qdrawhelper_neon_asm.S painting/qimagescale_neon.cpp ) @@ -304,6 +310,7 @@ extend_target(Gui CONDITION QT_FEATURE_standarditemmodel itemmodels/qstandarditemmodel.cpp itemmodels/qstandarditemmodel.h itemmodels/qstandarditemmodel_p.h ) + #### Keys ignored in scope 1:.:.:gui.pro:<TRUE>: # CONFIG = "simd" "optimize_full" "qt_tracepoints" # MODULE_PLUGIN_TYPES = "platforms" "platforms/darwin" "xcbglintegrations" "platformthemes" "platforminputcontexts" "generic" "iconengines" "imageformats" "egldeviceintegrations" @@ -336,50 +343,55 @@ extend_target(Gui CONDITION APPLE ${FWCoreGraphics} ) +extend_target(Gui CONDITION QT_FEATURE_animation + SOURCES + animation/qguivariantanimation.cpp +) + extend_target(Gui CONDITION WIN32 SOURCES kernel/qwindowdefs_win.h ) -#### Keys ignored in scope 7:.:.:gui.pro:WIN32: +#### Keys ignored in scope 8:.:.:gui.pro:WIN32: # CMAKE_WINDOWS_BUILD = "True" -#### Keys ignored in scope 10:.:.:gui.pro:QT_FEATURE_egl: +#### Keys ignored in scope 11:.:.:gui.pro:QT_FEATURE_egl: # CMAKE_EGL_LIBS = "$$cmakeProcessLibs$$QMAKE_LIBS_EGL" -#### Keys ignored in scope 11:.:.:gui.pro:NOT QMAKE_LIBDIR_EGL_ISEMPTY: +#### Keys ignored in scope 12:.:.:gui.pro:NOT QMAKE_LIBDIR_EGL_ISEMPTY: # CMAKE_EGL_LIBDIR = "$$cmakeTargetPath$$QMAKE_LIBDIR_EGL" -#### Keys ignored in scope 12:.:.:gui.pro:QT_FEATURE_opengles2: +#### Keys ignored in scope 13:.:.:gui.pro:QT_FEATURE_opengles2: # CMAKE_GL_HEADER_NAME = "GLES2/gl2.h" # CMAKE_OPENGL_INCDIRS = "$$cmakePortablePaths$$QMAKE_INCDIR_OPENGL_ES2" # CMAKE_OPENGL_LIBS = "$$cmakeProcessLibs$$QMAKE_LIBS_OPENGL_ES2" # CMAKE_QT_OPENGL_IMPLEMENTATION = "GLESv2" -#### Keys ignored in scope 13:.:.:gui.pro:NOT QMAKE_INCDIR_OPENGL_ES2_ISEMPTY: +#### Keys ignored in scope 14:.:.:gui.pro:NOT QMAKE_INCDIR_OPENGL_ES2_ISEMPTY: # CMAKE_GL_INCDIRS = "$$cmakeTargetPaths$$QMAKE_INCDIR_OPENGL_ES2" -#### Keys ignored in scope 14:.:.:gui.pro:NOT QMAKE_LIBDIR_OPENGL_ES2_ISEMPTY: +#### Keys ignored in scope 15:.:.:gui.pro:NOT QMAKE_LIBDIR_OPENGL_ES2_ISEMPTY: # CMAKE_OPENGL_LIBDIR = "$$cmakePortablePaths$$QMAKE_LIBDIR_OPENGL_ES2" -#### Keys ignored in scope 16:.:.:gui.pro:QT_FEATURE_opengl: +#### Keys ignored in scope 17:.:.:gui.pro:QT_FEATURE_opengl: # CMAKE_GL_HEADER_NAME = "GL/gl.h" # CMAKE_OPENGL_INCDIRS = "$$cmakePortablePaths$$QMAKE_INCDIR_OPENGL" # CMAKE_QT_OPENGL_IMPLEMENTATION = "GL" -#### Keys ignored in scope 17:.:.:gui.pro:NOT QMAKE_INCDIR_OPENGL_ISEMPTY: +#### Keys ignored in scope 18:.:.:gui.pro:NOT QMAKE_INCDIR_OPENGL_ISEMPTY: # CMAKE_GL_INCDIRS = "$$cmakeTargetPaths$$QMAKE_INCDIR_OPENGL" -#### Keys ignored in scope 18:.:.:gui.pro:NOT QT_FEATURE_dynamicgl: +#### Keys ignored in scope 19:.:.:gui.pro:NOT QT_FEATURE_dynamicgl: # CMAKE_OPENGL_LIBS = "$$cmakeProcessLibs$$QMAKE_LIBS_OPENGL" -#### Keys ignored in scope 19:.:.:gui.pro:NOT QMAKE_LIBDIR_OPENGL_ISEMPTY: +#### Keys ignored in scope 20:.:.:gui.pro:NOT QMAKE_LIBDIR_OPENGL_ISEMPTY: # CMAKE_OPENGL_LIBDIR = "$$cmakePortablePaths$$QMAKE_LIBDIR_OPENGL" -#### Keys ignored in scope 20:.:.:gui.pro:APPLE_OSX: +#### Keys ignored in scope 21:.:.:gui.pro:APPLE_OSX: # CMAKE_GL_HEADER_NAME = "gl.h" -#### Keys ignored in scope 21:.:.:gui.pro:QT_FEATURE_egl: +#### Keys ignored in scope 22:.:.:gui.pro:QT_FEATURE_egl: # CMAKE_EGL_INCDIRS = "$$cmakePortablePaths$$QMAKE_INCDIR_EGL" extend_target(Gui CONDITION QT_FEATURE_accessibility @@ -494,15 +506,26 @@ extend_target(Gui CONDITION QT_FEATURE_cssparser # special case: # extend_target(Gui CONDITION GCC AND QT_GCC_MAJOR_VERSION___equals___5 ... -#### Keys ignored in scope 43:.:painting:painting/painting.pri:NOT APPLE_UIKIT AND NOT WIN32 AND QT_ARCH___contains___arm: +#### Keys ignored in scope 45:.:painting:painting/painting.pri:NOT APPLE_UIKIT AND NOT WIN32 AND QT_ARCH___contains___arm: # CONFIG = "no_clang_integrated_as" -extend_target(Gui CONDITION UNIX AND NOT APPLE_UIKIT AND NOT (TEST_architecture_arch STREQUAL "arm64") +extend_target(Gui CONDITION UNIX AND NOT APPLE_UIKIT AND NOT INTEGRITY AND NOT (TEST_architecture_arch STREQUAL "arm64") DEFINES ENABLE_PIXMAN_DRAWHELPERS ) -#### Keys ignored in scope 53:.:opengl:opengl/opengl.pri:QT_FEATURE_opengles2: +# special case: +extend_target(Gui CONDITION UNIX AND NOT APPLE_UIKIT AND NOT INTEGRITY AND NOT (TEST_architecture_arch STREQUAL "arm64" AND QT_FEATURE_neon) + SOURCES + ../3rdparty/pixman/pixman-arm-neon-asm.S + painting/qdrawhelper_neon_asm.S +) + + +#### Keys ignored in scope 46:.:painting:painting/painting.pri:NOT APPLE_UIKIT AND NOT WIN32 AND NOT INTEGRITY AND NOT QT_ARCH___contains___arm64: +# NEON_ASM = "../3rdparty/pixman/pixman-arm-neon-asm.S" "painting/qdrawhelper_neon_asm.S" + +#### Keys ignored in scope 55:.:opengl:opengl/opengl.pri:QT_FEATURE_opengles2: # CONFIG = "opengles2" extend_target(Gui CONDITION QT_FEATURE_opengl AND NOT QT_FEATURE_opengles2 @@ -542,6 +565,13 @@ extend_target(Gui CONDITION QT_FEATURE_opengl AND QT_FEATURE_opengles2 opengl/qopenglfunctions_es2.cpp opengl/qopenglfunctions_es2.h ) +# special case +# Make Vulkan a global imported target, so that generator expressions involving Vulkan +# can be correctly evaluated in any sub project directory. +if(TARGET Vulkan::Vulkan) + set_property(TARGET Vulkan::Vulkan PROPERTY IMPORTED_GLOBAL TRUE) +endif() + extend_target(Gui CONDITION QT_FEATURE_vulkan SOURCES vulkan/qplatformvulkaninstance.cpp vulkan/qplatformvulkaninstance.h @@ -549,15 +579,9 @@ extend_target(Gui CONDITION QT_FEATURE_vulkan vulkan/qvulkaninstance.cpp vulkan/qvulkaninstance.h vulkan/qvulkanwindow.cpp vulkan/qvulkanwindow.h vulkan/qvulkanwindow_p.h PUBLIC_LIBRARIES - vulkan_nolink + Vulkan::Vulkan_nolink # special case ) -#### Keys ignored in scope 61:.:vulkan:vulkan/vulkan.pri:QT_FEATURE_vulkan: -# CONFIG = "generated_privates" - -#### Keys ignored in scope 63:.:vulkan:vulkan/vulkan.pri:else: -# qvkgen_h.CONFIG = "target_predeps" "no_link" - # special case: if (QT_FEATURE_vulkan) set(qvkgen_command "${HOST_QVKGEN}") @@ -597,6 +621,17 @@ if (QT_FEATURE_vulkan) ) endif() +#### Keys ignored in scope 62:.:vulkan:vulkan/vulkan.pri:QT_FEATURE_vulkan: +# CONFIG = "generated_privates" + +#### Keys ignored in scope 64:.:vulkan:vulkan/vulkan.pri:else: +# qvkgen_h.CONFIG = "target_predeps" "no_link" + +extend_target(Gui CONDITION WASM + SOURCES + platform/wasm/qwasmlocalfileaccess.cpp platform/wasm/qwasmlocalfileaccess_p.h +) + # special case: # qpa headers are expected to be located right next to QtGui's private # headers. So a private QtGui header is #include <private/qfoo_p.h> and @@ -606,7 +641,7 @@ qt_read_headers_pri("Gui" "module_headers") # special case install(FILES ${module_headers_qpa} DESTINATION ${INSTALL_INCLUDEDIR}/QtGui/${PROJECT_VERSION}/QtGui/qpa) # special case -qt_create_tracepoints(Gui ./qtgui.tracepoints) +qt_create_tracepoints(Gui qtgui.tracepoints) add_qt_docs( - ./doc/qtgui.qdocconf + doc/qtgui.qdocconf ) diff --git a/src/gui/Qt5GuiConfigExtras.cmake.in b/src/gui/Qt5GuiConfigExtras.cmake.in new file mode 100644 index 0000000000..84dbbfebd4 --- /dev/null +++ b/src/gui/Qt5GuiConfigExtras.cmake.in @@ -0,0 +1,193 @@ + +!!IF !isEmpty(CMAKE_ANGLE_EGL_DLL_RELEASE) + +!!IF isEmpty(CMAKE_INCLUDE_DIR_IS_ABSOLUTE) +set(Qt5Gui_EGL_INCLUDE_DIRS \"${_qt5$${CMAKE_MODULE_NAME}_install_prefix}/$$CMAKE_INCLUDE_DIR/QtANGLE\") +!!ELSE +set(Qt5Gui_EGL_INCLUDE_DIRS \"$$CMAKE_INCLUDE_DIR/QtANGLE\") +!!ENDIF + +_qt5_Gui_check_file_exists(${Qt5Gui_EGL_INCLUDE_DIRS}) + +list(APPEND Qt5Gui_INCLUDE_DIRS ${Qt5Gui_EGL_INCLUDE_DIRS}) +set_property(TARGET Qt5::Gui APPEND PROPERTY INTERFACE_INCLUDE_DIRECTORIES ${Qt5Gui_EGL_INCLUDE_DIRS}) +set(Qt5Gui_OPENGL_INCLUDE_DIRS ${Qt5Gui_EGL_INCLUDE_DIRS}) + +macro(_populate_qt5gui_gl_target_properties TargetName Configuration LIB_LOCATION IMPLIB_LOCATION) + set_property(TARGET Qt5::${TargetName} APPEND PROPERTY IMPORTED_CONFIGURATIONS ${Configuration}) + +!!IF isEmpty(CMAKE_DLL_DIR_IS_ABSOLUTE) + set(imported_location \"${_qt5Gui_install_prefix}/$${CMAKE_DLL_DIR}${LIB_LOCATION}\") +!!ELSE + set(imported_location \"$${CMAKE_DLL_DIR}${LIB_LOCATION}\") +!!ENDIF + +!!IF isEmpty(CMAKE_LIB_DIR_IS_ABSOLUTE) + set(imported_implib \"${_qt5Gui_install_prefix}/$${CMAKE_LIB_DIR}${IMPLIB_LOCATION}\") +!!ELSE + set(imported_implib \"$${CMAKE_LIB_DIR}${IMPLIB_LOCATION}\") +!!ENDIF + + set_target_properties(Qt5::${TargetName} PROPERTIES + \"IMPORTED_LOCATION_${Configuration}\" ${imported_location} + \"IMPORTED_IMPLIB_${Configuration}\" ${imported_implib} + ) +endmacro() + +add_library(Qt5::Gui_EGL SHARED IMPORTED) +_populate_qt5gui_gl_target_properties(Gui_EGL RELEASE $${CMAKE_ANGLE_EGL_DLL_RELEASE} $${CMAKE_ANGLE_EGL_IMPLIB_RELEASE}) +add_library(Qt5::Gui_GLESv2 SHARED IMPORTED) +_populate_qt5gui_gl_target_properties(Gui_GLESv2 RELEASE $${CMAKE_ANGLE_GLES2_DLL_RELEASE} $${CMAKE_ANGLE_GLES2_IMPLIB_RELEASE}) + +set_property(TARGET Qt5::Gui_EGL APPEND PROPERTY INTERFACE_INCLUDE_DIRECTORIES ${Qt5Gui_EGL_INCLUDE_DIRS}) +set_property(TARGET Qt5::Gui_GLESv2 APPEND PROPERTY INTERFACE_INCLUDE_DIRECTORIES ${Qt5Gui_OPENGL_INCLUDE_DIRS}) + +!!IF !isEmpty(CMAKE_DEBUG_TYPE) +_populate_qt5gui_gl_target_properties(Gui_EGL DEBUG $${CMAKE_ANGLE_EGL_DLL_DEBUG} $${CMAKE_ANGLE_EGL_IMPLIB_DEBUG}) +_populate_qt5gui_gl_target_properties(Gui_GLESv2 DEBUG $${CMAKE_ANGLE_GLES2_DLL_DEBUG} $${CMAKE_ANGLE_GLES2_IMPLIB_DEBUG}) +!!ENDIF + +set(Qt5Gui_EGL_LIBRARIES Qt5::Gui_EGL) +set(Qt5Gui_OPENGL_LIBRARIES Qt5::Gui_GLESv2) + +!!ELSE + +!!IF !isEmpty(CMAKE_GL_INCDIRS) + +set(_GL_INCDIRS $$CMAKE_GL_INCDIRS) +find_path(_qt5gui_OPENGL_INCLUDE_DIR $$CMAKE_GL_HEADER_NAME + PATHS ${_GL_INCDIRS} +) +if (NOT _qt5gui_OPENGL_INCLUDE_DIR) + message(FATAL_ERROR \"Failed to find \\\"$$CMAKE_GL_HEADER_NAME\\\" in \\\"${_GL_INCDIRS}\\\".\") +endif() +unset(_GL_INCDIRS) + +# Don\'t check for existence of the "_qt5gui_OPENGL_INCLUDE_DIR" because it is +# optional. + +list(APPEND Qt5Gui_INCLUDE_DIRS ${_qt5gui_OPENGL_INCLUDE_DIR}) +set_property(TARGET Qt5::Gui APPEND PROPERTY INTERFACE_INCLUDE_DIRECTORIES ${_qt5gui_OPENGL_INCLUDE_DIR}) + +unset(_qt5gui_OPENGL_INCLUDE_DIR CACHE) + +!!ENDIF + +macro(_qt5gui_find_extra_libs Name Libs LibDir IncDirs) + set(Qt5Gui_${Name}_LIBRARIES) +!!IF !mac + set(Qt5Gui_${Name}_INCLUDE_DIRS ${IncDirs}) +!!ELSE + foreach(_dir ${IncDirs}) + if (EXISTS ${_dir}) + list(APPEND Qt5Gui_${Name}_INCLUDE_DIRS ${_dir}) + else() + find_path(_actual_dir ${_dir}) # Look in sdk directories + if (_actual_dir) + list(APPEND Qt5Gui_${Name}_INCLUDE_DIRS ${_actual_dir}) + endif() + unset(_actual_dir CACHE) + endif() + endforeach() +!!ENDIF + foreach(_lib ${Libs}) + if (IS_ABSOLUTE ${_lib}) + get_filename_component(_libFile ${_lib} NAME_WE) + if (_libFile MATCHES \"^${CMAKE_SHARED_LIBRARY_PREFIX}(.*)\") + set(_libFile ${CMAKE_MATCH_1}) + endif() + else() + set(_libFile ${_lib}) + endif() + + string(REGEX REPLACE "[^_A-Za-z0-9]" "_" _cmake_lib_name ${_libFile}) + if (NOT TARGET Qt5::Gui_${_cmake_lib_name} AND NOT _Qt5Gui_${_cmake_lib_name}_LIBRARY_DONE) + if (IS_ABSOLUTE ${_lib}) + set(Qt5Gui_${_cmake_lib_name}_LIBRARY ${_lib}) + else() + find_library(Qt5Gui_${_cmake_lib_name}_LIBRARY ${_lib} +!!IF !isEmpty(CROSS_COMPILE) + PATHS \"${LibDir}\" +!!IF !mac + NO_DEFAULT_PATH +!!ENDIF +!!ENDIF + ) + endif() +!!IF mac + set(Qt5Gui_${_cmake_lib_name}_LIBRARY "${Qt5Gui_${_cmake_lib_name}_LIBRARY}/${_lib}") + if (NOT EXISTS "${Qt5Gui_${_cmake_lib_name}_LIBRARY}") + set(Qt5Gui_${_cmake_lib_name}_LIBRARY) + endif() +!!ENDIF + if (NOT Qt5Gui_${_cmake_lib_name}_LIBRARY) + # The above find_library call doesn\'t work for finding + # libraries in Windows SDK paths outside of the proper + # environment, even if the libraries are present. In other + # cases it is OK for the libraries to not be found + # because they are optional dependencies of Qt5Gui, needed + # only if the qopengl.h header is used. + # We try to find the libraries in the first place because Qt may be + # compiled with another set of GL libraries (such as coming + # from ANGLE). The point of these find calls is to try to + # find the same binaries as Qt is compiled with (as they are + # in the interface of QtGui), so an effort is made to do so + # above with paths known to qmake. + set(_Qt5Gui_${_cmake_lib_name}_LIBRARY_DONE TRUE) + unset(Qt5Gui_${_cmake_lib_name}_LIBRARY CACHE) + else() + add_library(Qt5::Gui_${_cmake_lib_name} SHARED IMPORTED) + set_property(TARGET Qt5::Gui_${_cmake_lib_name} APPEND PROPERTY INTERFACE_INCLUDE_DIRECTORIES ${Qt5Gui_${Name}_INCLUDE_DIRS}) + + set_property(TARGET Qt5::Gui_${_cmake_lib_name} APPEND PROPERTY IMPORTED_CONFIGURATIONS RELEASE) + _qt5_Gui_check_file_exists(\"${Qt5Gui_${_cmake_lib_name}_LIBRARY}\") + set_property(TARGET Qt5::Gui_${_cmake_lib_name} PROPERTY IMPORTED_LOCATION_RELEASE \"${Qt5Gui_${_cmake_lib_name}_LIBRARY}\") + +!!IF !isEmpty(CMAKE_WINDOWS_BUILD) + set_property(TARGET Qt5::Gui_${_cmake_lib_name} PROPERTY IMPORTED_IMPLIB_RELEASE \"${Qt5Gui_${_cmake_lib_name}_LIBRARY}\") +!!ENDIF + unset(Qt5Gui_${_cmake_lib_name}_LIBRARY CACHE) + + find_library(Qt5Gui_${_cmake_lib_name}_LIBRARY_DEBUG ${_lib}d + PATHS \"${LibDir}\" +!!IF !mac + NO_DEFAULT_PATH +!!ENDIF + ) + if (Qt5Gui_${_cmake_lib_name}_LIBRARY_DEBUG) + set_property(TARGET Qt5::Gui_${_cmake_lib_name} APPEND PROPERTY IMPORTED_CONFIGURATIONS DEBUG) + _qt5_Gui_check_file_exists(\"${Qt5Gui_${_cmake_lib_name}_LIBRARY_DEBUG}\") + set_property(TARGET Qt5::Gui_${_cmake_lib_name} PROPERTY IMPORTED_LOCATION_DEBUG \"${Qt5Gui_${_cmake_lib_name}_LIBRARY_DEBUG}\") +!!IF !isEmpty(CMAKE_WINDOWS_BUILD) + set_property(TARGET Qt5::Gui_${_cmake_lib_name} PROPERTY IMPORTED_IMPLIB_DEBUG \"${Qt5Gui_${_cmake_lib_name}_LIBRARY_DEBUG}\") +!!ENDIF + endif() + unset(Qt5Gui_${_cmake_lib_name}_LIBRARY_DEBUG CACHE) + list(APPEND Qt5Gui_${Name}_LIBRARIES Qt5::Gui_${_cmake_lib_name}) + endif() + endif() + endforeach() +endmacro() + + +!!IF !isEmpty(CMAKE_EGL_LIBS) +_qt5gui_find_extra_libs(EGL \"$$CMAKE_EGL_LIBS\" \"$$CMAKE_EGL_LIBDIR\" \"$$CMAKE_EGL_INCDIRS\") +!!ENDIF + +!!IF !isEmpty(CMAKE_OPENGL_LIBS) +_qt5gui_find_extra_libs(OPENGL \"$$CMAKE_OPENGL_LIBS\" \"$$CMAKE_OPENGL_LIBDIR\" \"$$CMAKE_OPENGL_INCDIRS\") + +!!ENDIF + +!!ENDIF + +set(Qt5Gui_OPENGL_IMPLEMENTATION $$CMAKE_QT_OPENGL_IMPLEMENTATION) + +get_target_property(_configs Qt5::Gui IMPORTED_CONFIGURATIONS) +foreach(_config ${_configs}) + set_property(TARGET Qt5::Gui APPEND PROPERTY + IMPORTED_LINK_DEPENDENT_LIBRARIES_${_config} + ${Qt5Gui_EGL_LIBRARIES} ${Qt5Gui_OPENGL_LIBRARIES} + ) +endforeach() +unset(_configs) diff --git a/src/gui/accessible/qaccessible.cpp b/src/gui/accessible/qaccessible.cpp index 6b48f573b2..46dec7f28d 100644 --- a/src/gui/accessible/qaccessible.cpp +++ b/src/gui/accessible/qaccessible.cpp @@ -654,7 +654,7 @@ void QAccessible::removeActivationObserver(ActivationObserver *observer) /*! If a QAccessibleInterface implementation exists for the given \a object, this function returns a pointer to the implementation; otherwise it - returns 0. + returns \nullptr. The function calls all installed factory functions (from most recently installed to least recently installed) until one is found @@ -770,7 +770,7 @@ QAccessible::Id QAccessible::uniqueId(QAccessibleInterface *iface) /*! Returns the QAccessibleInterface belonging to the \a id. - Returns 0 if the id is invalid. + Returns \nullptr if the id is invalid. */ QAccessibleInterface *QAccessible::accessibleInterface(Id id) { @@ -1119,7 +1119,7 @@ QAccessibleInterface *QAccessibleInterface::focusChild() const \fn QAccessibleInterface *QAccessibleInterface::childAt(int x, int y) const Returns the QAccessibleInterface of a child that contains the screen coordinates (\a x, \a y). - If there are no children at this position this function returns 0. + If there are no children at this position this function returns \nullptr. The returned accessible must be a child, but not necessarily a direct child. This function is only relyable for visible objects (invisible @@ -1139,7 +1139,7 @@ QAccessibleInterface *QAccessibleInterface::focusChild() const Returns the QAccessibleInterface of the parent in the accessible object hierarchy. - Returns 0 if no parent exists (e.g. for the top level application object). + Returns \nullptr if no parent exists (e.g. for the top level application object). \sa child() */ @@ -1150,7 +1150,7 @@ QAccessibleInterface *QAccessibleInterface::focusChild() const Returns the accessible child with index \a index. 0-based index. The number of children of an object can be checked with childCount. - Returns 0 when asking for an invalid child (e.g. when the child became invalid in the meantime). + Returns \nullptr when asking for an invalid child (e.g. when the child became invalid in the meantime). \sa childCount(), parent() */ @@ -1309,14 +1309,7 @@ QColor QAccessibleInterface::backgroundColor() const For example to notify about a focus change when re-implementing QWidget::setFocus, the event could be used as follows: - \code - void MyWidget::setFocus(Qt::FocusReason reason) - { - // handle custom focus setting... - QAccessibleEvent event(f, QAccessible::Focus); - QAccessible::updateAccessibility(&event); - } - \endcode + \snippet code/src_gui_accessible_qaccessible.cpp 2 To enable in process screen readers, all events must be sent after the change has happened. */ @@ -1363,7 +1356,7 @@ QAccessibleEvent::~QAccessibleEvent() \internal Returns the uniqueId of the QAccessibleInterface represented by this event. - In case the object() function returns 0 this is the only way to access the + In case the object() function returns \nullptr, this is the only way to access the interface. */ QAccessible::Id QAccessibleEvent::uniqueId() const @@ -1793,7 +1786,7 @@ QAccessibleInterface *QAccessibleEvent::accessibleInterface() const (This means that at least one interface among the ancestors should return a valid QWindow pointer). - The default implementation returns 0. + The default implementation returns \nullptr. */ QWindow *QAccessibleInterface::window() const { @@ -1826,14 +1819,7 @@ void QAccessibleInterface::virtual_hook(int /*id*/, void * /*data*/) Qt's QLineEdit for example has its accessibility support implemented in QAccessibleLineEdit. - \code -void *QAccessibleLineEdit::interface_cast(QAccessible::InterfaceType t) -{ - if (t == QAccessible::TextInterface) - return static_cast<QAccessibleTextInterface*>(this); - return QAccessibleWidget::interface_cast(t); -} - \endcode + \snippet code/src_gui_accessible_qaccessible.cpp 3 \sa QAccessible::InterfaceType, QAccessibleTextInterface, QAccessibleValueInterface, QAccessibleActionInterface, diff --git a/src/gui/accessible/qaccessible.h b/src/gui/accessible/qaccessible.h index 1309f17efd..e2163b06d0 100644 --- a/src/gui/accessible/qaccessible.h +++ b/src/gui/accessible/qaccessible.h @@ -966,8 +966,10 @@ protected: int m_lastColumn; }; +#ifndef Q_CLANG_QDOC #define QAccessibleInterface_iid "org.qt-project.Qt.QAccessibleInterface" Q_DECLARE_INTERFACE(QAccessibleInterface, QAccessibleInterface_iid) +#endif Q_GUI_EXPORT const char *qAccessibleRoleString(QAccessible::Role role); Q_GUI_EXPORT const char *qAccessibleEventString(QAccessible::Event event); diff --git a/src/gui/accessible/qaccessiblecache_p.h b/src/gui/accessible/qaccessiblecache_p.h index a976277c1d..cf1ed04f35 100644 --- a/src/gui/accessible/qaccessiblecache_p.h +++ b/src/gui/accessible/qaccessiblecache_p.h @@ -73,7 +73,7 @@ public: QAccessibleInterface *interfaceForId(QAccessible::Id id) const; QAccessible::Id idForInterface(QAccessibleInterface *iface) const; QAccessible::Id insert(QObject *object, QAccessibleInterface *iface) const; - void deleteInterface(QAccessible::Id id, QObject *obj = 0); + void deleteInterface(QAccessible::Id id, QObject *obj = nullptr); #ifdef Q_OS_MAC QT_MANGLE_NAMESPACE(QMacAccessibilityElement) *elementForId(QAccessible::Id axid) const; diff --git a/src/gui/animation/qguivariantanimation.cpp b/src/gui/animation/qguivariantanimation.cpp index b72764e048..a5b6d8b95c 100644 --- a/src/gui/animation/qguivariantanimation.cpp +++ b/src/gui/animation/qguivariantanimation.cpp @@ -38,8 +38,6 @@ ****************************************************************************/ #include <QtGui/qtguiglobal.h> -#ifndef QT_NO_ANIMATION - #include <QtCore/qvariantanimation.h> #include <private/qvariantanimation_p.h> #include <QtGui/qcolor.h> @@ -90,5 +88,3 @@ static void qUnregisterGuiGetInterpolator() Q_DESTRUCTOR_FUNCTION(qUnregisterGuiGetInterpolator) QT_END_NAMESPACE - -#endif //QT_NO_ANIMATION diff --git a/src/gui/configure.cmake b/src/gui/configure.cmake index 8d2417d7d0..354be5bd44 100644 --- a/src/gui/configure.cmake +++ b/src/gui/configure.cmake @@ -18,14 +18,6 @@ set_property(CACHE INPUT_libpng PROPERTY STRINGS undefined no qt system) set(INPUT_xcb "undefined" CACHE STRING "") set_property(CACHE INPUT_xcb PROPERTY STRINGS undefined no yes qt system) -# input xkbcommon -set(INPUT_xkbcommon "undefined" CACHE STRING "") -set_property(CACHE INPUT_xkbcommon PROPERTY STRINGS undefined no qt system) - -# input xkbcommon-x11 -set(INPUT_xkbcommon_x11 "undefined" CACHE STRING "") -set_property(CACHE INPUT_xkbcommon_x11 PROPERTY STRINGS undefined no qt system) - #### Libraries @@ -91,27 +83,6 @@ D3D11_QUERY_DATA_TIMESTAMP_DISJOINT qdtd; } ") -# directwrite2 -qt_config_compile_test(directwrite2 - LABEL "DirectWrite 2" -" -#include <dwrite_2.h> -#include <d2d1.h> - -int main(int argc, char **argv) -{ - (void)argc; (void)argv; - /* BEGIN TEST: */ -IUnknown *factory = 0; -(void)(size_t(DWRITE_E_NOCOLOR) + sizeof(IDWriteFontFace2)); -DWriteCreateFactory(DWRITE_FACTORY_TYPE_SHARED, __uuidof(IDWriteFactory2), - &factory); - /* END TEST: */ - return 0; -} -"# FIXME: use: directwrite -) - # drm_atomic qt_config_compile_test(drm_atomic LABEL "DRM Atomic API" @@ -133,22 +104,15 @@ drmModeAtomicReq *request; ) # egl-x11 -if (HAVE_EGL AND X11_XCB_FOUND AND X11_FOUND) - set(egl_x11_TEST_LIBRARIES EGL::EGL X11::X11 X11::XCB) -endif() qt_config_compile_test(egl_x11 LABEL "EGL on X11" - LIBRARIES "${egl_x11_TEST_LIBRARIES}" - CODE "// Check if EGL is compatible with X. Some EGL implementations, typically on // embedded devices, are not intended to be used together with X. EGL support // has to be disabled in plugins like xcb in this case since the native display, // window and pixmap types will be different than what an X-based platform // plugin would expect. #include <EGL/egl.h> -#include <xcb/xcb.h> #include <X11/Xlib.h> -#include <X11/Xlib-xcb.h> int main(int argc, char **argv) { @@ -163,7 +127,8 @@ XCloseDisplay(dpy); /* END TEST: */ return 0; } -") +"# FIXME: use: egl xlib +) # egl-brcm qt_config_compile_test(egl_brcm @@ -412,6 +377,60 @@ glProgramUniform1i(0, 0, 0); "# FIXME: use: opengl_es2 ) +# opengles32 +qt_config_compile_test(opengles32 + LABEL "OpenGL ES 3.2" +" +#include <GLES3/gl32.h> + +int main(int argc, char **argv) +{ + (void)argc; (void)argv; + /* BEGIN TEST: */ +glFramebufferTexture(GL_TEXTURE_2D, GL_DEPTH_STENCIL_ATTACHMENT, 1, 0); + /* END TEST: */ + return 0; +} +"# FIXME: use: opengl_es2 +) + +# xcb_syslibs +qt_config_compile_test(xcb_syslibs + LABEL "XCB (extensions)" +" +#include <xcb/xcb.h> +#include <xcb/xcb_image.h> +#include <xcb/xcb_keysyms.h> +#include <xcb/randr.h> +#include <xcb/render.h> +#include <xcb/shape.h> +#include <xcb/shm.h> +#include <xcb/sync.h> +#include <xcb/xfixes.h> +#include <xcb/xinerama.h> +#include <xcb/xcb_icccm.h> +#include <xcb/xcb_renderutil.h> + +int main(int argc, char **argv) +{ + (void)argc; (void)argv; + /* BEGIN TEST: */ +int primaryScreen = 0; +xcb_connection_t *c = xcb_connect(\"\", &primaryScreen); +/* RENDER */ +xcb_generic_error_t *error = nullptr; +xcb_render_query_pict_formats_cookie_t formatsCookie = + xcb_render_query_pict_formats(c); +xcb_render_query_pict_formats_reply_t *formatsReply = + xcb_render_query_pict_formats_reply(c, formatsCookie, &error); +/* RENDERUTIL: xcb_renderutil.h include won't compile unless version >= 0.3.9 */ +xcb_render_util_find_standard_format(nullptr, XCB_PICT_STANDARD_ARGB_32); + /* END TEST: */ + return 0; +} +"# FIXME: use: xcb_icccm xcb_image xcb_keysyms xcb_randr xcb_render xcb_renderutil xcb_shape xcb_shm xcb_sync xcb_xfixes xcb_xinerama xcb +) + #### Features @@ -424,7 +443,7 @@ qt_feature_definition("accessibility_atspi_bridge" "QT_NO_ACCESSIBILITY_ATSPI_BR qt_feature("angle" PUBLIC LABEL "ANGLE" AUTODETECT QT_FEATURE_opengles2 OR QT_FEATURE_opengl_dynamic - CONDITION WIN32 AND tests.directx OR FIXME + CONDITION NOT QT_FEATURE_opengl_desktop AND QT_FEATURE_dxguid AND tests.fxc AND ( QT_FEATURE_direct3d9 OR ( WINRT AND QT_FEATURE_direct3d11 AND libs.d3dcompiler ) ) OR FIXME ) qt_feature_definition("angle" "QT_OPENGL_ES_2_ANGLE") qt_feature("angle_d3d11_qdtd" PRIVATE @@ -444,18 +463,50 @@ qt_feature("directfb" PRIVATE ) qt_feature("directwrite" PRIVATE LABEL "DirectWrite" - CONDITION libs.directwrite OR FIXME + CONDITION libs.dwrite OR FIXME + EMIT_IF WIN32 +) +qt_feature("directwrite1" PRIVATE + LABEL "DirectWrite 1" + CONDITION libs.dwrite_1 OR FIXME EMIT_IF WIN32 ) qt_feature("directwrite2" PRIVATE LABEL "DirectWrite 2" - CONDITION QT_FEATURE_directwrite AND TEST_directwrite2 + CONDITION QT_FEATURE_directwrite1 AND libs.dwrite_2 OR FIXME EMIT_IF WIN32 ) +qt_feature("dxguid" PRIVATE + LABEL "DirectX GUID" + CONDITION WIN32 AND libs.dxguid OR FIXME +) +qt_feature("direct3d9" PRIVATE + LABEL "Direct 3D 9" + CONDITION WIN32 AND NOT WINRT AND libs.d3d9 OR FIXME +) +qt_feature("dxgi" PRIVATE + LABEL "DirectX GI" + CONDITION WIN32 AND libs.dxgi OR FIXME +) +qt_feature("dxgi1_2" PRIVATE + LABEL "DirectX GI 1.2" + CONDITION QT_FEATURE_dxgi AND libs.dxgi1_2 OR FIXME +) +qt_feature("direct3d11" PRIVATE + LABEL "Direct 3D 11" + CONDITION QT_FEATURE_dxgi AND libs.d3d11 OR FIXME +) +qt_feature("direct3d11_1" PRIVATE + LABEL "Direct 3D 11.1" + CONDITION QT_FEATURE_direct3d11 AND QT_FEATURE_dxgi1_2 AND libs.d3d11_1 OR FIXME +) qt_feature("direct2d" PRIVATE - SECTION "Platform plugins" LABEL "Direct 2D" - CONDITION WIN32 AND NOT WINRT AND libs.direct2d OR FIXME + CONDITION WIN32 AND NOT WINRT AND QT_FEATURE_direct3d11 AND libs.d2d1 OR FIXME +) +qt_feature("direct2d1_1" PRIVATE + LABEL "Direct 2D 1.1" + CONDITION QT_FEATURE_direct2d AND libs.d2d1_1 OR FIXME ) qt_feature("evdev" PRIVATE LABEL "evdev" @@ -523,12 +574,6 @@ qt_feature("vnc" PRIVATE LABEL "VNC" CONDITION ( UNIX AND NOT ANDROID AND NOT APPLE ) AND ( QT_FEATURE_regularexpression AND QT_FEATURE_network ) ) -qt_feature("mirclient" PRIVATE - SECTION "Platform plugins" - LABEL "Mir client" - AUTODETECT OFF - CONDITION libs.mirclient OR FIXME -) qt_feature("mtdev" PRIVATE LABEL "mtdev" CONDITION Mtdev_FOUND @@ -536,7 +581,7 @@ qt_feature("mtdev" PRIVATE qt_feature("opengles2" PUBLIC LABEL "OpenGL ES 2.0" CONDITION NOT WIN32 AND ( NOT APPLE_WATCHOS AND NOT QT_FEATURE_opengl_desktop AND GLESv2_FOUND ) - ENABLE INPUT_opengl STREQUAL 'es2' + ENABLE INPUT_opengl STREQUAL 'es2' OR INPUT_angle STREQUAL 'yes' DISABLE INPUT_opengl STREQUAL 'desktop' OR INPUT_opengl STREQUAL 'dynamic' OR INPUT_opengl STREQUAL 'no' ) qt_feature_definition("opengles2" "QT_OPENGL_ES") @@ -566,13 +611,13 @@ qt_feature("opengl_dynamic" LABEL "Dynamic OpenGL" AUTODETECT OFF CONDITION WIN32 AND NOT WINRT - ENABLE INPUT_opengl STREQUAL 'dynamic' + DISABLE INPUT_angle STREQUAL 'yes' OR INPUT_opengl STREQUAL 'no' OR INPUT_opengl STREQUAL 'desktop' ) qt_feature("dynamicgl" PUBLIC LABEL "Dynamic OpenGL: dynamicgl" AUTODETECT OFF CONDITION WIN32 AND NOT WINRT - ENABLE INPUT_opengl STREQUAL 'dynamic' + DISABLE INPUT_angle STREQUAL 'yes' OR INPUT_opengl STREQUAL 'no' OR INPUT_opengl STREQUAL 'desktop' ) qt_feature_definition("opengl_dynamic" "QT_OPENGL_DYNAMIC") qt_feature("opengl" PUBLIC @@ -600,7 +645,7 @@ qt_feature("egl_x11" PRIVATE qt_feature("eglfs" PRIVATE SECTION "Platform plugins" LABEL "EGLFS" - CONDITION NOT ANDROID AND NOT APPLE AND NOT WIN32 AND QT_FEATURE_egl + CONDITION NOT ANDROID AND NOT APPLE AND NOT WIN32 AND NOT WASM AND QT_FEATURE_egl ) qt_feature("eglfs_brcm" PRIVATE LABEL "EGLFS Raspberry Pi" @@ -638,6 +683,10 @@ qt_feature("eglfs_openwfd" PRIVATE LABEL "EGLFS OpenWFD" CONDITION INTEGRITY AND QT_FEATURE_eglfs AND TEST_egl_openwfd ) +qt_feature("eglfs_x11" PRIVATE + LABEL "EGLFS X11" + CONDITION QT_FEATURE_eglfs AND QT_FEATURE_xcb_xlib AND QT_FEATURE_egl_x11 +) qt_feature("gif" PRIVATE LABEL "GIF" CONDITION QT_FEATURE_imageformatplugin @@ -678,12 +727,22 @@ qt_feature("xcb" PRIVATE SECTION "Platform plugins" LABEL "XCB" AUTODETECT NOT APPLE - CONDITION QT_FEATURE_thread AND XCB_FOUND + CONDITION QT_FEATURE_thread AND QT_FEATURE_xkbcommon AND XCB_FOUND ENABLE INPUT_xcb STREQUAL 'system' OR INPUT_xcb STREQUAL 'qt' OR INPUT_xcb STREQUAL 'yes' ) +qt_feature("xcb_glx_plugin" PRIVATE + LABEL "GLX Plugin" + CONDITION QT_FEATURE_xcb_xlib AND QT_FEATURE_opengl AND NOT QT_FEATURE_opengles2 + EMIT_IF QT_FEATURE_xcb +) qt_feature("xcb_glx" PRIVATE - LABEL "XCB GLX" + LABEL " XCB GLX" CONDITION XCB_GLX_FOUND + EMIT_IF QT_FEATURE_xcb AND QT_FEATURE_xcb_glx_plugin +) +qt_feature("xcb_egl_plugin" PRIVATE + LABEL "EGL-X11 Plugin" + CONDITION QT_FEATURE_egl_x11 AND QT_FEATURE_opengl EMIT_IF QT_FEATURE_xcb ) qt_feature("xcb_native_painting" PRIVATE @@ -696,20 +755,14 @@ qt_feature("xrender" PRIVATE CONDITION QT_FEATURE_xcb_native_painting EMIT_IF QT_FEATURE_xcb AND QT_FEATURE_xcb_native_painting ) -qt_feature("xcb_render" PRIVATE - LABEL "XCB render" - CONDITION NOT ON OR XCB_RENDER_FOUND - EMIT_IF QT_FEATURE_xcb -) qt_feature("xkb" PRIVATE LABEL "XCB XKB" - CONDITION NOT ON OR XCB_XKB_FOUND + CONDITION ( NOT ON OR XCB_XKB_FOUND ) AND libs.xkbcommon_x11 OR FIXME EMIT_IF QT_FEATURE_xcb ) qt_feature("xcb_xlib" PRIVATE LABEL "XCB Xlib" CONDITION QT_FEATURE_xlib AND X11_XCB_FOUND - EMIT_IF QT_FEATURE_xcb ) qt_feature("xcb_sm" PRIVATE LABEL "xcb-sm" @@ -721,8 +774,8 @@ qt_feature("xcb_xinput" PRIVATE CONDITION NOT ON OR XCB_XINPUT_FOUND EMIT_IF QT_FEATURE_xcb ) -qt_feature("xkbcommon_evdev" PRIVATE - LABEL "xkbcommon-evdev" +qt_feature("xkbcommon" PRIVATE + LABEL "xkbcommon" CONDITION XKB_FOUND ) qt_feature("xlib" PRIVATE @@ -930,3 +983,8 @@ qt_feature("whatsthis" PUBLIC PURPOSE "Supports displaying \"What's this\" help." ) qt_feature_definition("whatsthis" "QT_NO_WHATSTHIS" NEGATE VALUE "1") +qt_feature("raster_64bit" PRIVATE + SECTION "Painting" + LABEL "QPainter - 64 bit raster" + PURPOSE "Internal painting support for 64 bit (16 bpc) rasterization." +) diff --git a/src/gui/configure.json b/src/gui/configure.json index adc0000322..ce6524ac2f 100644 --- a/src/gui/configure.json +++ b/src/gui/configure.json @@ -30,7 +30,6 @@ "libjpeg": { "type": "enum", "values": [ "no", "qt", "system" ] }, "libpng": { "type": "enum", "values": [ "no", "qt", "system" ] }, "linuxfb": "boolean", - "mirclient": "boolean", "mtdev": "boolean", "opengl": { "type": "optionalString", "values": [ "no", "yes", "desktop", "es2", "dynamic" ] }, "opengl-es-2": { "type": "void", "name": "opengl", "value": "es2" }, @@ -46,9 +45,7 @@ "xcb-xlib": "boolean", "xcb-xinput": "boolean", "xkb": "boolean", - "xkbcommon": { "type": "enum", "values": [ "no", "qt", "system" ] }, - "xkbcommon-evdev": "boolean", - "xkbcommon-x11": { "type": "enum", "name": "xkbcommon", "values": [ "no", "qt", "system" ] } + "xkbcommon": "boolean" } }, @@ -61,52 +58,132 @@ }, "bcm_host": { "export": "", + "headers": ["bcm_host.h"], "sources": [ - "-lbcm_host" + { "type": "makeSpec", "spec": "BCM_HOST" } ] }, - "direct2d": { - "label": "Direct 2D", - "export": "", + "dxguid": { + "label": "DirectX GUID", + "sources": [ + "-ldxguid" + ] + }, + "dxgi": { + "label": "DirectX GI", + "headers": "dxgi.h", + "sources": [ + "-ldxgi" + ] + }, + "dxgi1_2": { + "label": "DirectX GI 1.2", "test": { - "include": [ "d3d11_1.h", "d2d1_1.h", "d2d1_1helper.h", "dxgi1_2.h", "wrl.h", "dwrite.h" ], - "tail": "using Microsoft::WRL::ComPtr;", "main": [ - "ComPtr<ID2D1Factory1> d2dFactory;", - "D2D1CreateFactory(D2D1_FACTORY_TYPE_SINGLE_THREADED, d2dFactory.ReleaseAndGetAddressOf());", - "ComPtr<IDXGISurface1> surface;", + "// fails with mingw-w64 5.4.0 - declaration is missing from header", + "IDXGISurface1 *surface;", "(void) surface;" ] }, + "headers": "dxgi1_2.h", + "sources": [ + "-ldxgi" + ] + }, + "d3d9": { + "label": "Direct3D 9", + "headers": "d3d9.h", + "sources": [ + "-ld3d9" + ] + }, + "d3d11": { + "label": "Direct3D 11", + "headers": "d3d11.h", + "sources": [ + "-ld3d11" + ] + }, + "d3d11_1": { + "label": "Direct3D 11.1", + "headers": "d3d11_1.h", "sources": [ - "-ld2d1 -ldwrite -ld3d11" + "-ld3d11" + ] + }, + "d3dcompiler": { + "label": "Direct3D Shader Compiler Library", + "headers": "d3dcompiler.h", + "sources": [ + "-ld3dcompiler" + ] + }, + "d2d1": { + "label": "Direct2D 1", + "headers": [ "d2d1.h", "d2d1helper.h" ], + "sources": [ + "-ld2d1" + ] + }, + "d2d1_1": { + "label": "Direct2D 1.1", + "test": { + "main": [ + "ID2D1Factory1 *d2dFactory;", + "D2D1CreateFactory(D2D1_FACTORY_TYPE_SINGLE_THREADED, &d2dFactory);" + ] + }, + "headers": [ "d2d1_1.h", "d2d1_1helper.h" ], + "sources": [ + "-ld2d1" ] }, "directfb": { "label": "DirectFB", "test": { - "include": "directfb.h", "tail": [ "#ifdef __typeof__", "# error DirectFB headers are unclean and cannot compile", "#endif" ] }, + "headers": "directfb.h", "sources": [ { "type": "pkgConfig", "args": "directfb" } ] }, - "directwrite": { + "dwrite": { "label": "DirectWrite", - "export": "", "test": { - "include": [ "dwrite.h", "d2d1.h" ], "main": [ "IDWriteFactory *factory = 0;", "DWriteCreateFactory(DWRITE_FACTORY_TYPE_SHARED, __uuidof(IDWriteFactory),", " (IUnknown **)(&factory));" ] }, + "headers": "dwrite.h", + "sources": [ + "-ldwrite" + ] + }, + "dwrite_1": { + "label": "DirectWrite 1", + "headers": "dwrite_1.h", + "sources": [ + "-ldwrite" + ] + }, + "dwrite_2": { + "label": "DirectWrite 2", + "test": { + "main": [ + "IUnknown *factory = 0;", + "(void)(size_t(DWRITE_E_NOCOLOR) + sizeof(IDWriteFontFace2));", + "DWriteCreateFactory(DWRITE_FACTORY_TYPE_SHARED, __uuidof(IDWriteFactory2),", + " &factory);" + ] + }, + "headers": "dwrite_2.h", "sources": [ "-ldwrite" ] @@ -119,15 +196,12 @@ "#include <stdint.h>", "extern \"C\" {" ], - "include": [ - "xf86drmMode.h", - "xf86drm.h" - ], "tail": [ "}" ], "main": "(void) drmModeGetCrtc(0, 0);" }, + "headers": [ "xf86drmMode.h", "xf86drm.h" ], "sources": [ { "type": "pkgConfig", "args": "libdrm" }, { "libs": "-ldrm", "condition": "!config.integrity" }, @@ -137,12 +211,12 @@ "egl": { "label": "EGL", "test": { - "include": "EGL/egl.h", "main": [ "EGLint x = 0; EGLDisplay dpy = 0; EGLContext ctx = 0;", "eglDestroyContext(dpy, ctx);" ] }, + "headers": "EGL/egl.h", "sources": [ { "type": "pkgConfig", "args": "egl" }, { "type": "makeSpec", "spec": "EGL" } @@ -151,7 +225,6 @@ "freetype": { "label": "FreeType", "test": { - "include": "ft2build.h", "tail": [ "#include FT_FREETYPE_H", "#if ((FREETYPE_MAJOR*10000 + FREETYPE_MINOR*100 + FREETYPE_PATCH) < 20200)", @@ -162,25 +235,30 @@ "FT_Face face = 0;" ] }, + "headers": "ft2build.h", "sources": [ { "type": "pkgConfig", "args": "freetype2" }, { "type": "freetype", "libs": "-lfreetype", "condition": "!config.wasm" }, - { "type": "freetype", "libs": "-s USE_FREETYPE=1", "condition": "config.wasm" } + { "libs": "-s USE_FREETYPE=1", "condition": "config.wasm" }, + { "libs": "-lfreetype" } + ], + "use": [ + { "lib": "zlib", "condition": "features.system-zlib" } ] }, "fontconfig": { "label": "Fontconfig", "test": { - "include": "fontconfig/fontconfig.h", "tail": [ "#ifndef FC_RGBA_UNKNOWN", - "# error This version of fontconfig is tool old, it is missing the FC_RGBA_UNKNOWN define", + "# error This version of fontconfig is too old, it is missing the FC_RGBA_UNKNOWN define", "#endif" ], "main": [ "FcPattern *pattern = 0;" ] }, + "headers": "fontconfig/fontconfig.h", "sources": [ { "type": "pkgConfig", "args": "fontconfig" }, { "type": "freetype", "libs": "-lfontconfig" } @@ -195,12 +273,12 @@ "#include <stdint.h>", "extern \"C\" {" ], - "include": "gbm.h", "tail": [ "}" ], "main": "gbm_surface *surface = 0;" }, + "headers": "gbm.h", "sources": [ { "type": "pkgConfig", "args": "gbm" } ] @@ -208,7 +286,6 @@ "harfbuzz": { "label": "HarfBuzz", "test": { - "include": "harfbuzz/hb.h", "tail": [ "#if !HB_VERSION_ATLEAST(1, 6, 0)", "# error This version of harfbuzz is too old.", @@ -223,6 +300,7 @@ "hb_buffer_destroy(buffer);" ] }, + "headers": "harfbuzz/hb.h", "sources": [ "-lharfbuzz" ] @@ -231,9 +309,9 @@ "label": "IMF", "export": "", "test": { - "include": "imf/imf_client.h", "main": "imf_client_init();" }, + "headers": "imf/imf_client.h", "sources": [ "-linput_client" ] @@ -241,9 +319,9 @@ "lgmon": { "label": "lgmon", "test": { - "include": "lgmon.h", "main": "lgmon_supported(getpid());" }, + "headers": "lgmon.h", "sources": [ "-llgmon" ] @@ -251,9 +329,9 @@ "libinput": { "label": "libinput", "test": { - "include": "libinput.h", "main": "libinput_udev_create_context(NULL, NULL, NULL);" }, + "headers": "libinput.h", "sources": [ { "type": "pkgConfig", "args": "libinput" } ] @@ -265,7 +343,6 @@ "#include <stdlib.h>", "#include <stdint.h>" ], - "include": "device/hiddriver.h", "main": [ "HIDDriver *driver;", "uintptr_t devicecontext;", @@ -273,6 +350,7 @@ "gh_hid_enum_devices(driver, &device_id, &devicecontext);" ] }, + "headers": "device/hiddriver.h", "sources": [ { "libs": "-lhiddev -lusbhid -lusb" } ] @@ -285,7 +363,6 @@ "#include <stdio.h>", "extern \"C\" {" ], - "include": "jpeglib.h", "tail": [ "}", "", @@ -293,6 +370,7 @@ ], "main": "jpeg_create_compress(cinfo);" }, + "headers": "jpeglib.h", "sources": [ { "libs": "-llibjpeg", "condition": "config.msvc" }, "-ljpeg" @@ -301,9 +379,9 @@ "libpng": { "label": "libpng", "test": { - "include": "png.h", "main": "(void) png_create_read_struct(PNG_LIBPNG_VER_STRING,0,0,0);" }, + "headers": "png.h", "sources": [ { "type": "pkgConfig", "args": "libpng" }, { "libs": "-llibpng16", "condition": "config.msvc" }, @@ -316,29 +394,15 @@ { "lib": "zlib", "condition": "features.system-zlib" } ] }, - "mirclient": { - "label": "Mir client libraries", - "test": { - "include": [ "mir_toolkit/mir_client_library.h", "ubuntu/application/lifecycle_delegate.h", "EGL/egl.h" ], - "tail": "static void surfaceCreateCallback(MirSurface*, void*) {}", - "main": [ - "u_application_lifecycle_delegate_new();", - "mir_surface_create(0, surfaceCreateCallback, 0);" - ] - }, - "sources": [ - { "type": "pkgConfig", "args": "egl mirclient ubuntu-platform-api libcontent-hub >= 0.2.0" } - ] - }, "mtdev": { "label": "mtdev", "test": { - "include": "mtdev.h", "main": [ "mtdev m;", "mtdev_open(&m, 0);" ] }, + "headers": "mtdev.h", "sources": [ { "type": "pkgConfig", "args": "mtdev" } ] @@ -351,7 +415,6 @@ "# include <OpenGL/gl.h>", "#else", "# define GL_GLEXT_PROTOTYPES", - "# include <GL/gl.h>", "#endif" ], "main": [ @@ -362,9 +425,15 @@ "glEnd();" ] }, + "headers": [ + { + "condition": "!config.darwin", + "headers": "GL/gl.h" + } + ], "sources": [ { "type": "pkgConfig", "args": "gl", "condition": "!config.darwin" }, - { "type": "makeSpec", "spec": "OPENGL" } + { "type": "openglMakeSpec" } ] }, "opengl_es2": { @@ -375,7 +444,6 @@ "# include <OpenGLES/ES2/gl.h>", "#else", "# define GL_GLEXT_PROTOTYPES", - "# include <GLES2/gl2.h>", "#endif" ], "main": [ @@ -383,6 +451,12 @@ "glClear(GL_COLOR_BUFFER_BIT);" ] }, + "headers": [ + { + "condition": "!config.darwin", + "headers": "GLES2/gl2.h" + } + ], "sources": [ { "type": "pkgConfig", "args": "glesv2", "condition": "!config.darwin" }, { "type": "makeSpec", "spec": "OPENGL_ES2" } @@ -391,9 +465,9 @@ "openvg": { "label": "OpenVG", "test": { - "include": "VG/openvg.h", "main": "VGint i = 2; vgFlush();" }, + "headers": "VG/openvg.h", "sources": [ { "type": "pkgConfig", "args": "vg" }, { "type": "makeSpec", "spec": "OPENVG" } @@ -402,9 +476,9 @@ "tslib": { "label": "tslib", "test": { - "include": "tslib.h", "main": "ts_open(\"foo\", 0);" }, + "headers": "tslib.h", "sources": [ "-lts" ] @@ -416,10 +490,6 @@ "#include <cstddef>", "extern \"C\" {" ], - "include": [ - "mediactl/mediactl.h", - "mediactl/v4l2subdev.h" - ], "tail": [ "}" ], @@ -430,6 +500,7 @@ "v4l2_subdev_set_format(nullptr, nullptr, 0, V4L2_SUBDEV_FORMAT_ACTIVE);" ] }, + "headers": [ "mediactl/mediactl.h", "mediactl/v4l2subdev.h" ], "sources": [ { "type": "pkgConfig", "args": "libv4l2 libmediactl" }, "-lmediactl -lv4l2 -lv4l2subdev" @@ -437,7 +508,23 @@ }, "vulkan": { "label": "Vulkan", - "test": "qpa/vulkan", + "test": { + "comment": "Note: Qt does not rely on linking to a Vulkan library directly.", + "tail": [ + "// The pData parameter has changed from uint32_t* to void* at some point.", + "// Ensure the headers have the updated one to prevent compile errors later on.", + "PFN_vkCmdUpdateBuffer cmdUpdBuf;", + "void testUpdateBuffer(VkCommandBuffer commandBuffer, VkBuffer dstBuffer, VkDeviceSize dstOffset, VkDeviceSize dataSize, const void* pData)", + "{", + " cmdUpdBuf(commandBuffer, dstBuffer, dstOffset, dataSize, pData);", + "}" + ], + "main": [ + "VkInstanceCreateInfo info;", + "testUpdateBuffer(0, 0, 0, 0, 0);" + ] + }, + "headers": "vulkan/vulkan.h", "sources": [ { "type": "pkgConfig", "args": "vulkan" }, { "type": "makeSpec", "spec": "VULKAN" } @@ -446,13 +533,26 @@ "wayland_server": { "label": "Wayland Server", "test": { - "include": "wayland-server.h", "main": "wl_display_create();" }, + "headers": "wayland-server.h", "sources": [ { "type": "pkgConfig", "args": "wayland-server" } ] }, + "xlib": { + "label": "XLib", + "test": { + "main": [ + "Display *d = XOpenDisplay(NULL);", + "XCloseDisplay(d);" + ] + }, + "headers": "X11/Xlib.h", + "sources": [ + { "type": "makeSpec", "spec": "X11" } + ] + }, "x11sm": { "label": "X11 session management", "sources": [ @@ -460,9 +560,8 @@ ] }, "xcb": { - "label": "XCB >= 1.9 (core)", + "label": "XCB >= 1.9", "test": { - "include": "xcb/xcb.h", "main": [ "int primaryScreen = 0;", "(void)xcb_connect(\"\", &primaryScreen);", @@ -470,54 +569,113 @@ "int xcbScreenError = XCB_CONN_CLOSED_INVALID_SCREEN;" ] }, + "headers": "xcb/xcb.h", "sources": [ { "type": "pkgConfig", "args": "xcb >= 1.9" }, "-lxcb" ] }, - "xcb_syslibs": { - "label": "XCB (extensions)", - "test": { - "include": [ - "xcb/xcb.h", - "xcb/xfixes.h", - "xcb/xcb_image.h", - "xcb/xcb_keysyms.h", - "xcb/xinerama.h", - "xcb/sync.h", - "xcb/randr.h", - "xcb/shm.h" - ], - "tail": [ - "// This workaround can be removed for xcb-icccm > 3.8", - "#define class class_name", - "#include <xcb/xcb_icccm.h>", - "#undef class" - ], - "main": [ - "int primaryScreen = 0;", - "(void) xcb_connect(\"\", &primaryScreen);" - ] - }, + "xcb_icccm": { + "label": "XCB ICCCM >= 0.3.9", + "headers": "xcb/xcb_icccm.h", "sources": [ - { "type": "pkgConfig", - "args": "xcb xcb-shm xcb-sync xcb-xfixes xcb-xinerama xcb-randr xcb-image xcb-keysyms xcb-icccm xcb-shape" }, - "-lxcb -lxcb-shm -lxcb-sync -lxcb-xfixes -lxcb-xinerama -lxcb-randr -lxcb-image -lxcb-keysyms -lxcb-icccm -lxcb-shape" - ] + { "type": "pkgConfig", "args": "xcb-icccm >= 0.3.9" }, + "-lxcb-icccm" + ], + "use": "xcb" + }, + "xcb_image": { + "label": "XCB Image >= 0.3.9", + "headers": "xcb/xcb_image.h", + "sources": [ + { "type": "pkgConfig", "args": "xcb-image >= 0.3.9" }, + "-lxcb-image" + ], + "use": "xcb_shm xcb" + }, + "xcb_keysyms": { + "label": "XCB Keysyms >= 0.3.9", + "headers": "xcb/xcb_keysyms.h", + "sources": [ + { "type": "pkgConfig", "args": "xcb-keysyms >= 0.3.9" }, + "-lxcb-keysyms" + ], + "use": "xcb" + }, + "xcb_renderutil": { + "label": "XCB Renderutil >= 0.3.9", + "headers": "xcb/xcb_renderutil.h", + "sources": [ + { "type": "pkgConfig", "args": "xcb-renderutil >= 0.3.9" }, + "-lxcb-render-util" + ], + "use": "xcb xcb_render" + }, + "xcb_randr": { + "label": "XCB RandR", + "headers": "xcb/randr.h", + "sources": [ + { "type": "pkgConfig", "args": "xcb-randr" }, + "-lxcb-randr" + ], + "use": "xcb" + }, + "xcb_shape": { + "label": "XCB Shape", + "headers": "xcb/shape.h", + "sources": [ + { "type": "pkgConfig", "args": "xcb-shape" }, + "-lxcb-shape" + ], + "use": "xcb" + }, + "xcb_shm": { + "label": "XCB SHM", + "headers": "xcb/shm.h", + "sources": [ + { "type": "pkgConfig", "args": "xcb-shm" }, + "-lxcb-shm" + ], + "use": "xcb" + }, + "xcb_sync": { + "label": "XCB Sync", + "headers": "xcb/sync.h", + "sources": [ + { "type": "pkgConfig", "args": "xcb-sync" }, + "-lxcb-sync" + ], + "use": "xcb" + }, + "xcb_xfixes": { + "label": "XCB Xfixes", + "headers": "xcb/xfixes.h", + "sources": [ + { "type": "pkgConfig", "args": "xcb-xfixes" }, + "-lxcb-xfixes" + ], + "use": "xcb" + }, + "xcb_xinerama": { + "label": "XCB Xinerama", + "headers": "xcb/xinerama.h", + "sources": [ + { "type": "pkgConfig", "args": "xcb-xinerama" }, + "-lxcb-xinerama" + ], + "use": "xcb" }, "xcb_xlib": { "label": "XCB Xlib", "test": { - "include": [ "xcb/xcb.h", "X11/Xlib.h", "X11/Xlib-xcb.h" ], - "main": [ - "Display *dpy = XOpenDisplay(\"\");", - "(void) XGetXCBConnection(dpy);" - ] + "main": "(void) XGetXCBConnection((Display *)0);" }, + "headers": "X11/Xlib-xcb.h", "sources": [ - { "type": "pkgConfig", "args": "x11-xcb x11 xcb" }, - "-lxcb -lX11 -lX11-xcb" - ] + { "type": "pkgConfig", "args": "x11-xcb" }, + "-lX11-xcb" + ], + "use": "xcb xlib" }, "xcb_xkb": { "label": "XCB XKB >= 1.10", @@ -526,116 +684,104 @@ "// xkb.h is using a variable called 'explicit', which is a reserved keyword in C++", "#define explicit dont_use_cxx_explicit" ], - "include": "xcb/xkb.h", "tail": "#undef explicit", "main": [ "// This takes more arguments in xcb-xkb < 1.10.", "xcb_xkb_get_kbd_by_name_unchecked(NULL, 0, 0, 0, 0);" ] }, + "headers": "xcb/xkb.h", "sources": [ - { "type": "pkgConfig", "args": "xcb-xkb >= 1.10 xcb" }, - "-lxcb-xkb -lxcb" - ] + { "type": "pkgConfig", "args": "xcb-xkb >= 1.10" }, + "-lxcb-xkb" + ], + "use": "xcb" }, "xcb_render": { "label": "XCB XRender", - "test": { - "include": [ "xcb/xcb.h", "xcb/render.h" ], - "tail": [ - "// 'template' is used as a function argument name in xcb_renderutil.h", - "#define template template_param", - "// extern \"C\" is missing, too", - "extern \"C\" {", - "#include <xcb/xcb_renderutil.h>", - "}", - "#undef template" - ], - "main": [ - "int primaryScreen = 0;", - "xcb_generic_error_t *error = 0;", - "xcb_connection_t *connection = xcb_connect(\"\", &primaryScreen);", - "xcb_render_query_pict_formats_cookie_t formatsCookie =", - " xcb_render_query_pict_formats(connection);", - "xcb_render_query_pict_formats_reply_t *formatsReply =", - " xcb_render_query_pict_formats_reply(", - " connection, formatsCookie, &error);", - "xcb_render_util_find_standard_format(", - " formatsReply, XCB_PICT_STANDARD_ARGB_32);" - ] - }, + "headers": "xcb/render.h", "sources": [ - { "type": "pkgConfig", "args": "xcb-renderutil xcb-render xcb" }, - "-lxcb-render-util -lxcb-render -lxcb" - ] + { "type": "pkgConfig", "args": "xcb-render" }, + "-lxcb-render" + ], + "use": "xcb" }, "xcb_glx": { "label": "XCB GLX", "test": { - "include": [ "xcb/xcb.h", "xcb/glx.h" ], "main": [ - "int primaryScreen = 0;", - "xcb_connection_t *connection = xcb_connect(\"\", &primaryScreen);", + "xcb_connection_t *connection = 0;", "xcb_generic_error_t *error = 0;", "xcb_glx_query_version_cookie_t xglx_query_cookie = xcb_glx_query_version(", " connection, XCB_GLX_MAJOR_VERSION, XCB_GLX_MINOR_VERSION);", "xcb_glx_query_version_reply(connection, xglx_query_cookie, &error);" ] }, + "headers": "xcb/glx.h", "sources": [ - { "type": "pkgConfig", "args": "xcb-glx xcb" }, - "-lxcb-glx -lxcb" - ] + { "type": "pkgConfig", "args": "xcb-glx" }, + "-lxcb-glx" + ], + "use": "xcb" }, "xcb_xinput": { "label": "XCB XInput", "test": { - "include": [ "xcb/xcb.h", "xcb/xinput.h" ], "main": [ - "int primaryScreen = 0;", - "xcb_connection_t *connection = xcb_connect(\"\", &primaryScreen);", + "xcb_connection_t *connection = 0;", "xcb_generic_error_t *error = 0;", "xcb_input_xi_query_version_cookie_t xinput_query_cookie = xcb_input_xi_query_version(", " connection, XCB_INPUT_MAJOR_VERSION, XCB_INPUT_MINOR_VERSION);", "xcb_input_xi_query_version_reply(connection, xinput_query_cookie, &error);" ] }, + "headers": "xcb/xinput.h", "sources": [ - { "type": "pkgConfig", "args": "xcb-xinput >= 1.12 xcb" }, - "-lxcb-xinput -lxcb" - ] + { "type": "pkgConfig", "args": "xcb-xinput >= 1.12" }, + "-lxcb-xinput" + ], + "use": "xcb" }, "xkbcommon": { - "label": "xkbcommon", - "export": "xkbcommon_evdev", + "label": "xkbcommon >= 0.5.0", "test": { - "include": [ "xkbcommon/xkbcommon.h", "xkbcommon/xkbcommon-keysyms.h", "xkbcommon/xkbcommon-names.h" ], "main": "xkb_context_new(XKB_CONTEXT_NO_FLAGS);" }, + "headers": [ "xkbcommon/xkbcommon.h" ], "sources": [ - { "type": "pkgConfig", "args": "xkbcommon" } + { "type": "pkgConfig", "args": "xkbcommon >= 0.5.0" }, + "-lxkbcommon" ] }, "xkbcommon_x11": { - "label": "xkbcommon-x11 >= 0.4.1", - "export": "xkbcommon", + "label": "xkbcommon-x11", + "test": { + "main": "xkb_x11_get_core_keyboard_device_id(nullptr);" + }, + "headers": [ "xkbcommon/xkbcommon-x11.h" ], "sources": [ - { "type": "pkgConfig", "args": "xkbcommon xkbcommon-x11 >= 0.4.1" } + { "type": "pkgConfig", "args": "xkbcommon-x11" }, + "-lxkbcommon -lxkbcommon-x11" ] }, "xrender": { "label": "XRender for native painting", - "test": "x11/xrender", + "test": { + "tail": [ + "#if RENDER_MAJOR == 0 && RENDER_MINOR < 5", + "# error Required Xrender version 0.6 not found.", + "#endif" + ], + "main": "XRenderPictFormat *format = 0;" + }, + "headers": "X11/extensions/Xrender.h", "sources": [ "-lXrender" - ] + ], + "use": "xlib" } }, - "testTypeAliases": { - "files": [ "directX" ] - }, - "tests": { "angle_d3d11_qdtd": { "label": "D3D11_QUERY_DATA_TIMESTAMP_DISJOINT", @@ -648,28 +794,10 @@ ] } }, - "directwrite2": { - "label": "DirectWrite 2", - "type": "compile", - "test": { - "include": [ "dwrite_2.h", "d2d1.h" ], - "main": [ - "IUnknown *factory = 0;", - "(void)(size_t(DWRITE_E_NOCOLOR) + sizeof(IDWriteFontFace2));", - "DWriteCreateFactory(DWRITE_FACTORY_TYPE_SHARED, __uuidof(IDWriteFactory2),", - " &factory);" - ] - }, - "use": "directwrite" - }, - "directx": { - "label": "DirectX SDK", - "type": "directX", - "files": [ - "d3dcompiler.h", - "d3d11.lib", - "fxc.exe" - ] + "fxc": { + "label": "Direct3D Shader Compiler", + "type": "fxc", + "log": "value" }, "drm_atomic": { "label": "DRM Atomic API", @@ -702,7 +830,7 @@ "// window and pixmap types will be different than what an X-based platform", "// plugin would expect." ], - "include": [ "EGL/egl.h", "xcb/xcb.h", "X11/Xlib.h", "X11/Xlib-xcb.h" ], + "include": [ "EGL/egl.h", "X11/Xlib.h" ], "main": [ "Display *dpy = EGL_DEFAULT_DISPLAY;", "EGLNativeDisplayType egldpy = XOpenDisplay(\"\");", @@ -712,7 +840,7 @@ "XCloseDisplay(dpy);" ] }, - "use": "egl xcb_xlib" + "use": "egl xlib" }, "egl-brcm": { "label": "Broadcom EGL (Raspberry Pi)", @@ -900,7 +1028,10 @@ "opengles32": { "label": "OpenGL ES 3.2", "type": "compile", - "test": "unix/opengles32", + "test": { + "include": "GLES3/gl32.h", + "main": "glFramebufferTexture(GL_TEXTURE_2D, GL_DEPTH_STENCIL_ATTACHMENT, 1, 0);" + }, "use": "opengl_es2" }, "qpa_default_platform": { @@ -908,6 +1039,41 @@ "type": "qpaDefaultPlatform", "log": "value" }, + "xcb_syslibs": { + "label": "XCB (extensions)", + "type": "compile", + "test": { + "include": [ + "xcb/xcb.h", + "xcb/xcb_image.h", + "xcb/xcb_keysyms.h", + "xcb/randr.h", + "xcb/render.h", + "xcb/shape.h", + "xcb/shm.h", + "xcb/sync.h", + "xcb/xfixes.h", + "xcb/xinerama.h", + "xcb/xcb_icccm.h", + "xcb/xcb_renderutil.h" + ], + "main": [ + "int primaryScreen = 0;", + "xcb_connection_t *c = xcb_connect(\"\", &primaryScreen);", + + "/* RENDER */", + "xcb_generic_error_t *error = nullptr;", + "xcb_render_query_pict_formats_cookie_t formatsCookie =", + " xcb_render_query_pict_formats(c);", + "xcb_render_query_pict_formats_reply_t *formatsReply =", + " xcb_render_query_pict_formats_reply(c, formatsCookie, &error);", + + "/* RENDERUTIL: xcb_renderutil.h include won't compile unless version >= 0.3.9 */", + "xcb_render_util_find_standard_format(nullptr, XCB_PICT_STANDARD_ARGB_32);" + ] + }, + "use": "xcb_icccm xcb_image xcb_keysyms xcb_randr xcb_render xcb_renderutil xcb_shape xcb_shm xcb_sync xcb_xfixes xcb_xinerama xcb" + }, "x11prefix": { "label": "X11 prefix", "type": "getPkgConfigVariable", @@ -915,18 +1081,6 @@ "pkg-config-variable": "prefix", "value": "/usr", "log": "value" - }, - "xlib": { - "label": "XLib", - "type": "compile", - "test": { - "include": "X11/Xlib.h", - "main": [ - "Display *d = XOpenDisplay(NULL);", - "XCloseDisplay(d);" - ], - "qmake": "CONFIG += x11" - } } }, @@ -939,10 +1093,11 @@ "angle": { "label": "ANGLE", "autoDetect": "features.opengles2 || features.opengl-dynamic", - "condition": "config.win32 && tests.directx", + "condition": "!features.opengl-desktop && features.dxguid && tests.fxc && (features.direct3d9 || (config.winrt && features.direct3d11 && libs.d3dcompiler))", "output": [ "publicFeature", - { "type": "define", "name": "QT_OPENGL_ES_2_ANGLE" } + { "type": "define", "name": "QT_OPENGL_ES_2_ANGLE" }, + { "type": "varAssign", "name": "QMAKE_FXC_LOCATION", "value": "tests.fxc.value" } ] }, "angle_d3d11_qdtd": { @@ -966,19 +1121,59 @@ "directwrite": { "label": "DirectWrite", "emitIf": "config.win32", - "condition": "libs.directwrite", + "condition": "libs.dwrite", + "output": [ "privateFeature" ] + }, + "directwrite1": { + "label": "DirectWrite 1", + "emitIf": "config.win32", + "condition": "libs.dwrite_1", "output": [ "privateFeature" ] }, "directwrite2": { "label": "DirectWrite 2", "emitIf": "config.win32", - "condition": "features.directwrite && tests.directwrite2", + "condition": "features.directwrite1 && libs.dwrite_2", + "output": [ "privateFeature" ] + }, + "dxguid": { + "label": "DirectX GUID", + "condition": "config.win32 && libs.dxguid", + "output": [ "privateFeature" ] + }, + "direct3d9": { + "label": "Direct 3D 9", + "condition": "config.win32 && !config.winrt && libs.d3d9", + "output": [ "privateFeature" ] + }, + "dxgi": { + "label": "DirectX GI", + "condition": "config.win32 && libs.dxgi", + "output": [ "privateFeature" ] + }, + "dxgi1_2": { + "label": "DirectX GI 1.2", + "condition": "features.dxgi && libs.dxgi1_2", + "output": [ "privateFeature" ] + }, + "direct3d11": { + "label": "Direct 3D 11", + "condition": "features.dxgi && libs.d3d11", + "output": [ "privateFeature" ] + }, + "direct3d11_1": { + "label": "Direct 3D 11.1", + "condition": "features.direct3d11 && features.dxgi1_2 && libs.d3d11_1", "output": [ "privateFeature" ] }, "direct2d": { "label": "Direct 2D", - "section": "Platform plugins", - "condition": "config.win32 && !config.winrt && libs.direct2d", + "condition": "config.win32 && !config.winrt && features.direct3d11 && libs.d2d1", + "output": [ "privateFeature" ] + }, + "direct2d1_1": { + "label": "Direct 2D 1.1", + "condition": "features.direct2d && libs.d2d1_1", "output": [ "privateFeature" ] }, "evdev": { @@ -1087,13 +1282,6 @@ ], "output": [ "privateFeature" ] }, - "mirclient": { - "label": "Mir client", - "section": "Platform plugins", - "autoDetect": false, - "condition": "libs.mirclient", - "output": [ "privateFeature" ] - }, "mtdev": { "label": "mtdev", "condition": "libs.mtdev", @@ -1101,9 +1289,9 @@ }, "opengles2": { "label": "OpenGL ES 2.0", - "enable": "input.opengl == 'es2'", + "enable": "input.opengl == 'es2' || input.angle == 'yes'", "disable": "input.opengl == 'desktop' || input.opengl == 'dynamic' || input.opengl == 'no'", - "condition": "config.win32 || (!config.watchos && !features.opengl-desktop && libs.opengl_es2)", + "condition": "(config.win32 && !features.opengl-dynamic) || (!config.watchos && !features.opengl-desktop && libs.opengl_es2)", "output": [ "publicFeature", "publicQtConfig", @@ -1137,14 +1325,14 @@ }, "opengl-desktop": { "label": "Desktop OpenGL", + "autoDetect": "!config.win32", "enable": "input.opengl == 'desktop'", "disable": "input.opengl == 'es2' || input.opengl == 'dynamic' || input.opengl == 'no'", "condition": "(config.win32 && !config.winrt && !features.opengles2 && (config.msvc || libs.opengl)) || (!config.watchos && !config.win32 && !config.wasm && libs.opengl)" }, "opengl-dynamic": { "label": "Dynamic OpenGL", - "enable": "input.opengl == 'dynamic'", - "autoDetect": false, + "disable": "input.angle == 'yes' || input.opengl == 'no' || input.opengl == 'desktop'", "condition": "config.win32 && !config.winrt", "output": [ { "type": "publicFeature", "name": "dynamicgl" }, @@ -1179,7 +1367,7 @@ "eglfs": { "label": "EGLFS", "section": "Platform plugins", - "condition": "!config.android && !config.darwin && !config.win32 && features.egl", + "condition": "!config.android && !config.darwin && !config.win32 && !config.wasm && features.egl", "output": [ "privateFeature" ] }, "eglfs_brcm": { @@ -1227,6 +1415,11 @@ "condition": "config.integrity && features.eglfs && tests.egl-openwfd", "output": [ "privateFeature" ] }, + "eglfs_x11": { + "label": "EGLFS X11", + "condition": "features.eglfs && features.xcb-xlib && features.egl_x11", + "output": [ "privateFeature" ] + }, "gif": { "label": "GIF", "condition": "features.imageformatplugin", @@ -1303,7 +1496,7 @@ "section": "Platform plugins", "autoDetect": "!config.darwin", "enable": "input.xcb == 'system' || input.xcb == 'qt' || input.xcb == 'yes'", - "condition": "features.thread && libs.xcb", + "condition": "features.thread && features.xkbcommon && libs.xcb", "output": [ "privateFeature" ] }, "system-xcb": { @@ -1311,7 +1504,7 @@ "enable": "input.xcb == 'system'", "disable": "input.xcb == 'qt'", "autoDetect": "!config.darwin", - "condition": "features.xcb && libs.xcb_syslibs", + "condition": "features.xcb && tests.xcb_syslibs", "output": [ "privateFeature" ] }, "x11-prefix": { @@ -1319,12 +1512,24 @@ "emitIf": "features.xcb", "output": [ { "type": "varAssign", "name": "QMAKE_X11_PREFIX", "value": "tests.x11prefix.value" } ] }, - "xcb-glx": { - "label": "XCB GLX", + "xcb-glx-plugin": { + "label": "GLX Plugin", "emitIf": "features.xcb", + "condition": "features.xcb-xlib && features.opengl && !features.opengles2", + "output": [ "privateFeature" ] + }, + "xcb-glx": { + "label": " XCB GLX", + "emitIf": "features.xcb && features.xcb-glx-plugin", "condition": "libs.xcb_glx", "output": [ "privateFeature" ] }, + "xcb-egl-plugin": { + "label": "EGL-X11 Plugin", + "emitIf": "features.xcb", + "condition": "features.egl_x11 && features.opengl", + "output": [ "privateFeature" ] + }, "xcb-native-painting": { "label": "Native painting (experimental)", "emitIf": "features.xcb", @@ -1337,21 +1542,14 @@ "condition": "features.xcb-native-painting", "output": [ "privateFeature" ] }, - "xcb-render": { - "label": "XCB render", - "emitIf": "features.xcb", - "condition": "!features.system-xcb || libs.xcb_render", - "output": [ "privateFeature" ] - }, "xkb": { "label": "XCB XKB", "emitIf": "features.xcb", - "condition": "!features.system-xcb || libs.xcb_xkb", + "condition": "(!features.system-xcb || libs.xcb_xkb) && libs.xkbcommon_x11", "output": [ "privateFeature" ] }, "xcb-xlib": { "label": "XCB Xlib", - "emitIf": "features.xcb", "condition": "features.xlib && libs.xcb_xlib", "output": [ "privateFeature" ] }, @@ -1367,23 +1565,15 @@ "condition": "!features.system-xcb || libs.xcb_xinput", "output": [ "privateFeature" ] }, - "xkbcommon-evdev": { - "label": "xkbcommon-evdev", + "xkbcommon": { + "label": "xkbcommon", "condition": "libs.xkbcommon", "output": [ "privateFeature" ] }, - "xkbcommon-system": { - "label": "Using system-provided xkbcommon", - "emitIf": "features.xcb", - "enable": "input.xkbcommon == 'system'", - "disable": "input.xkbcommon == 'qt' || input.xkbcommon == 'no'", - "condition": "libs.xkbcommon_x11", - "output": [ "privateFeature" ] - }, "xlib": { "label": "XLib", "autoDetect": "!config.darwin || features.xcb", - "condition": "tests.xlib", + "condition": "libs.xlib", "output": [ "privateFeature" ] }, "texthtmlparser": { @@ -1576,7 +1766,7 @@ }, "multiprocess": { "label": "Multi process", - "description": "Provides support for detecting the desktop environment, launching external processes and opening URLs.", + "purpose": "Provides support for detecting the desktop environment, launching external processes and opening URLs.", "section": "Utilities", "condition": "!config.integrity", "output": [ "privateFeature" ] @@ -1586,6 +1776,12 @@ "purpose": "Supports displaying \"What's this\" help.", "section": "Widget Support", "output": [ "publicFeature", "feature" ] + }, + "raster-64bit": { + "label": "QPainter - 64 bit raster", + "purpose": "Internal painting support for 64 bit (16 bpc) rasterization.", + "section": "Painting", + "output": [ "privateFeature" ] } }, @@ -1593,7 +1789,7 @@ { "type": "error", "condition": "input.xcb != '' && input.xcb != 'no' && input.xkbcommon == 'no'", - "message": "XCB plugin requires libxkbcommon. See -qt-xkbcommon-x11 and -system-xkbcommon-x11." + "message": "XCB plugin requires xkbcommon, but -no-xkbcommon was provided." } ], @@ -1615,8 +1811,8 @@ }, { "type": "warning", - "condition": "features.gui && config.linux && !config.android && !features.xcb && !features.eglfs && !features.directfb && !features.linuxfb && !features.mirclient", - "message": "No QPA platform plugin enabled! This will produce a Qt that cannot run GUI applications. The dependencies needed for xcb to build are listed in src/plugins/platforms/xcb/README" + "condition": "features.gui && config.linux && !config.android && !features.xcb && !features.eglfs && !features.directfb && !features.linuxfb", + "message": "No QPA platform plugin enabled! This will produce a Qt that cannot run GUI applications. See \"Platform backends\" in the output of --help." }, { "type": "warning", @@ -1695,7 +1891,15 @@ "integrityhid", "mtdev", "tslib", - "xkbcommon-evdev" + "xkbcommon", + { + "section": "X11 specific", + "entries": [ + "xlib", + "xcb-xlib", + "egl_x11" + ] + } ] }, { @@ -1706,10 +1910,10 @@ "section": "EGLFS details", "condition": "features.eglfs", "entries": [ - "eglfs_openwfd", "eglfs_viv", "eglfs_viv_wl", "eglfs_rcar", "eglfs_egldevice", "eglfs_gbm", "eglfs_vsp2", "eglfs_mali", "eglfs_brcm", "egl_x11" + "eglfs_openwfd", "eglfs_viv", "eglfs_viv_wl", "eglfs_rcar", "eglfs_egldevice", "eglfs_gbm", "eglfs_vsp2", "eglfs_mali", "eglfs_brcm", "eglfs_x11" ] }, - "linuxfb", "vnc", "mirclient", + "linuxfb", "vnc", { "type": "feature", "condition": "config.integrity", @@ -1723,10 +1927,18 @@ ] }, { - "section": "X11", + "section": "XCB", "condition": "features.xcb", "entries": [ - "system-xcb", "egl_x11", "xkb", "xlib", "xcb-render", "xcb-glx", "xcb-xinput", "xcb-xlib", "xkbcommon-system", "xcb-native-painting" + "system-xcb", "xkb", "xcb-xinput", "xcb-native-painting", + { + "section": "GL integrations", + "entries": [ + "xcb-glx-plugin", + "xcb-glx", + "xcb-egl-plugin" + ] + } ] }, { diff --git a/src/gui/configure.pri b/src/gui/configure.pri index 2971fd136e..0db106597e 100644 --- a/src/gui/configure.pri +++ b/src/gui/configure.pri @@ -15,30 +15,51 @@ defineTest(qtConfLibrary_freetype) { return(true) } -# Check for Direct X SDK (include, lib, and direct shader compiler 'fxc'). +defineTest(qtConfLibrary_openglMakeSpec) { + darwin:sdk { + sysrootified = + for(val, QMAKE_INCDIR_OPENGL): sysrootified += $${QMAKE_MAC_SDK_PATH}$$val + QMAKE_INCDIR_OPENGL = $$sysrootified + } + $${1}.spec = OPENGL + !qtConfLibrary_makeSpec($$1, $$2): return(false) + return(true) +} + +# Check for Direct X shader compiler 'fxc'. # Up to Direct X SDK June 2010 and for MinGW, this is pointed to by the # DXSDK_DIR variable. Starting with Windows Kit 8, it is included in -# the Windows SDK. Checking for the header is not sufficient, since it -# is also present in MinGW. -defineTest(qtConfTest_directX) { - dxdir = $$getenv("DXSDK_DIR") - !isEmpty(dxdir) { - EXTRA_INCLUDEPATH += $$dxdir/include - equals(QT_ARCH, x86_64): \ - EXTRA_LIBDIR += $$dxdir/lib/x64 +# the Windows SDK. +defineTest(qtConfTest_fxc) { + !mingw { + fxc = $$qtConfFindInPath("fxc.exe") + } else { + equals(QMAKE_HOST.arch, x86_64): \ + fns = x64/fxc.exe else: \ - EXTRA_LIBDIR += $$dxdir/lib/x86 - EXTRA_PATH += $$dxdir/Utilities/bin/x86 + fns = x86/fxc.exe + dxdir = $$(DXSDK_DIR) + !isEmpty(dxdir) { + fxc = $$dxdir/Utilities/bin/$$fns + } else { + winkitbindir = $$(WindowsSdkVerBinPath) + !isEmpty(winkitbindir) { + fxc = $$winkitbindir/$$fns + } else { + winkitdir = $$(WindowsSdkDir) + !isEmpty(winkitdir): \ + fxc = $$winkitdir/bin/$$fns + } + } } - $$qtConfEvaluate("features.sse2") { - ky = $$size($${1}.files._KEYS_) - $${1}.files._KEYS_ += $$ky - # Not present on MinGW-32 - $${1}.files.$${ky} = "intrin.h" + !isEmpty(fxc):exists($$fxc) { + $${1}.value = $$clean_path($$fxc) + export($${1}.value) + $${1}.cache += value + export($${1}.cache) + return(true) } - - qtConfTest_files($${1}): return(true) return(false) } @@ -55,7 +76,7 @@ defineTest(qtConfTest_qpaDefaultPlatform) { else: qnx: name = qnx else: integrity: name = integrityfb else: haiku: name = haiku - else: wasm: name = webassembly + else: wasm: name = wasm else: name = xcb $${1}.value = $$name diff --git a/src/gui/doc/qtgui.qdocconf b/src/gui/doc/qtgui.qdocconf index e546c817a7..b8b8a00cd6 100644 --- a/src/gui/doc/qtgui.qdocconf +++ b/src/gui/doc/qtgui.qdocconf @@ -54,7 +54,10 @@ exampledirs += ../../../examples/gui \ imagedirs += images \ ../../../examples/gui/doc/images \ - ../../../doc/src/images \ + ../../../doc/src/images + +# Included in qttestlib.qdocconf instead +excludefiles += ../kernel/qtestsupport_gui.cpp manifestmeta.highlighted.names = "QtGui/Analog Clock Window Example" diff --git a/src/gui/doc/snippets/clipboard/clipwindow.cpp b/src/gui/doc/snippets/clipboard/clipwindow.cpp index bf1b2d904b..d1b39070fa 100644 --- a/src/gui/doc/snippets/clipboard/clipwindow.cpp +++ b/src/gui/doc/snippets/clipboard/clipwindow.cpp @@ -48,7 +48,7 @@ ** ****************************************************************************/ -#include <QtGui> +#include <QtWidgets> #include "clipwindow.h" @@ -67,10 +67,11 @@ ClipWindow::ClipWindow(QWidget *parent) previousItems = new QListWidget(centralWidget); //! [0] - connect(clipboard, SIGNAL(dataChanged()), this, SLOT(updateClipboard())); + connect(clipboard, &QClipboard::dataChanged, + this, &ClipWindow::updateClipboard); //! [0] - connect(mimeTypeCombo, SIGNAL(activated(QString)), - this, SLOT(updateData(QString))); + connect(mimeTypeCombo, QOverload<QString>::of(&QComboBox::activated), + this, &ClipWindow::updateData); QVBoxLayout *currentLayout = new QVBoxLayout(currentItem); currentLayout->addWidget(mimeTypeLabel); diff --git a/src/gui/doc/snippets/code/src_gui_accessible_qaccessible.cpp b/src/gui/doc/snippets/code/src_gui_accessible_qaccessible.cpp index 98d40c94f9..2fd76d08c7 100644 --- a/src/gui/doc/snippets/code/src_gui_accessible_qaccessible.cpp +++ b/src/gui/doc/snippets/code/src_gui_accessible_qaccessible.cpp @@ -51,3 +51,21 @@ //! [1] typedef QAccessibleInterface* myFactoryFunction(const QString &key, QObject *); //! [1] + +//! [2] +void MyWidget::setFocus(Qt::FocusReason reason) +{ + // handle custom focus setting... + QAccessibleEvent event(f, QAccessible::Focus); + QAccessible::updateAccessibility(&event); +} +//! [2] + +//! [3] +void *QAccessibleLineEdit::interface_cast(QAccessible::InterfaceType t) +{ + if (t == QAccessible::TextInterface) + return static_cast<QAccessibleTextInterface*>(this); + return QAccessibleWidget::interface_cast(t); +} +//! [3] diff --git a/src/gui/doc/snippets/code/src_gui_itemviews_qstandarditemmodel.cpp b/src/gui/doc/snippets/code/src_gui_itemviews_qstandarditemmodel.cpp index 40893fae87..4266da0a11 100644 --- a/src/gui/doc/snippets/code/src_gui_itemviews_qstandarditemmodel.cpp +++ b/src/gui/doc/snippets/code/src_gui_itemviews_qstandarditemmodel.cpp @@ -73,8 +73,8 @@ for (int i = 0; i < 4; ++i) { //! [2] QTreeView *treeView = new QTreeView(this); treeView->setModel(myStandardItemModel); -connect(treeView, SIGNAL(clicked(QModelIndex)), - this, SLOT(clicked(QModelIndex))); +connect(treeView, &QTreeView::clicked, + this, &MyWidget::clicked); //! [2] diff --git a/src/gui/doc/snippets/code/src_gui_kernel_qguiapplication.cpp b/src/gui/doc/snippets/code/src_gui_kernel_qguiapplication.cpp index 7c5c387a5a..a399d444e1 100644 --- a/src/gui/doc/snippets/code/src_gui_kernel_qguiapplication.cpp +++ b/src/gui/doc/snippets/code/src_gui_kernel_qguiapplication.cpp @@ -64,7 +64,8 @@ MyMainWidget::MyMainWidget(QWidget *parent) :QWidget(parent) { QGuiApplication::setFallbackSessionManagementEnabled(false); - connect(qApp, SIGNAL(commitDataRequest(QSessionManager)), SLOT(commitData(QSessionManager))); + connect(qApp, &QGuiApplication::commitDataRequest, + this, &MyMainWidget::commitData); } void MyMainWidget::commitData(QSessionManager& manager) @@ -102,12 +103,14 @@ appname -session id //! [3] -foreach (const QString &command, mySession.restartCommand()) +const QStringList commands = mySession.restartCommand(); +for (const QString &command : commands) do_something(command); //! [3] //! [4] -foreach (const QString &command, mySession.discardCommand()) +const QStringList commands = mySession.discardCommand(); +for (const QString &command : mySession.discardCommand()) do_something(command); //! [4] diff --git a/src/gui/doc/snippets/code/src_gui_kernel_qguiapplication_x11.cpp b/src/gui/doc/snippets/code/src_gui_kernel_qguiapplication_x11.cpp index e91aa3d548..961ecd6cde 100644 --- a/src/gui/doc/snippets/code/src_gui_kernel_qguiapplication_x11.cpp +++ b/src/gui/doc/snippets/code/src_gui_kernel_qguiapplication_x11.cpp @@ -49,7 +49,7 @@ ****************************************************************************/ //! [0] -QApplication::setOverrideCursor(QCursor(Qt::WaitCursor)); +QGuiApplication::setOverrideCursor(QCursor(Qt::WaitCursor)); calculateHugeMandelbrot(); // lunch time... -QApplication::restoreOverrideCursor(); +QGuiApplication::restoreOverrideCursor(); //! [0] diff --git a/src/gui/doc/snippets/code/src_gui_math3d_qquaternion.cpp b/src/gui/doc/snippets/code/src_gui_math3d_qquaternion.cpp new file mode 100644 index 0000000000..8da438e3a7 --- /dev/null +++ b/src/gui/doc/snippets/code/src_gui_math3d_qquaternion.cpp @@ -0,0 +1,57 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the documentation of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:BSD$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** BSD License Usage +** Alternatively, you may use this file under the terms of the BSD license +** as follows: +** +** "Redistribution and use in source and binary forms, with or without +** modification, are permitted provided that the following conditions are +** met: +** * Redistributions of source code must retain the above copyright +** notice, this list of conditions and the following disclaimer. +** * Redistributions in binary form must reproduce the above copyright +** notice, this list of conditions and the following disclaimer in +** the documentation and/or other materials provided with the +** distribution. +** * Neither the name of The Qt Company Ltd nor the names of its +** contributors may be used to endorse or promote products derived +** from this software without specific prior written permission. +** +** +** THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +** "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +** LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +** A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +** OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +** SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +** LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +** DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +** THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +** (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +** OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE." +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +//! [0] + QVector3D result = q.rotatedVector(vector); +//! [0] + +//! [1] + QVector3D result = (q * QQuaternion(0, vector) * q.conjugated()).vector(); +//! [1] diff --git a/src/gui/doc/snippets/code/src_gui_opengl_qopenglbuffer.cpp b/src/gui/doc/snippets/code/src_gui_opengl_qopenglbuffer.cpp new file mode 100644 index 0000000000..57dc909598 --- /dev/null +++ b/src/gui/doc/snippets/code/src_gui_opengl_qopenglbuffer.cpp @@ -0,0 +1,60 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the documentation of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:BSD$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** BSD License Usage +** Alternatively, you may use this file under the terms of the BSD license +** as follows: +** +** "Redistribution and use in source and binary forms, with or without +** modification, are permitted provided that the following conditions are +** met: +** * Redistributions of source code must retain the above copyright +** notice, this list of conditions and the following disclaimer. +** * Redistributions in binary form must reproduce the above copyright +** notice, this list of conditions and the following disclaimer in +** the documentation and/or other materials provided with the +** distribution. +** * Neither the name of The Qt Company Ltd nor the names of its +** contributors may be used to endorse or promote products derived +** from this software without specific prior written permission. +** +** +** THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +** "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +** LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +** A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +** OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +** SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +** LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +** DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +** THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +** (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +** OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE." +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +//! [0] + QOpenGLBuffer buffer1(QOpenGLBuffer::IndexBuffer); + buffer1.create(); + + QOpenGLBuffer buffer2 = buffer1; +//! [0] + +//! [1] + QOpenGLBuffer::release(QOpenGLBuffer::VertexBuffer); +//! [1] diff --git a/src/gui/doc/snippets/code/src_gui_opengl_qopengldebug.cpp b/src/gui/doc/snippets/code/src_gui_opengl_qopengldebug.cpp new file mode 100644 index 0000000000..e82447a174 --- /dev/null +++ b/src/gui/doc/snippets/code/src_gui_opengl_qopengldebug.cpp @@ -0,0 +1,100 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the documentation of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:BSD$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** BSD License Usage +** Alternatively, you may use this file under the terms of the BSD license +** as follows: +** +** "Redistribution and use in source and binary forms, with or without +** modification, are permitted provided that the following conditions are +** met: +** * Redistributions of source code must retain the above copyright +** notice, this list of conditions and the following disclaimer. +** * Redistributions in binary form must reproduce the above copyright +** notice, this list of conditions and the following disclaimer in +** the documentation and/or other materials provided with the +** distribution. +** * Neither the name of The Qt Company Ltd nor the names of its +** contributors may be used to endorse or promote products derived +** from this software without specific prior written permission. +** +** +** THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +** "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +** LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +** A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +** OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +** SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +** LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +** DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +** THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +** (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +** OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE." +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +//! [0] + GLenum error = GL_NO_ERROR; + do { + error = glGetError(); + if (error != GL_NO_ERROR) + // handle the error + } while (error != GL_NO_ERROR); +//! [0] + +//! [1] + QSurfaceFormat format; + // asks for a OpenGL 3.2 debug context using the Core profile + format.setMajorVersion(3); + format.setMinorVersion(2); + format.setProfile(QSurfaceFormat::CoreProfile); + format.setOption(QSurfaceFormat::DebugContext); + + QOpenGLContext *context = new QOpenGLContext; + context->setFormat(format); + context->create(); +//! [1] + +//! [2] + QOpenGLContext *ctx = QOpenGLContext::currentContext(); + QOpenGLDebugLogger *logger = new QOpenGLDebugLogger(this); + + logger->initialize(); // initializes in the current context, i.e. ctx +//! [2] + +//! [3] + ctx->hasExtension(QByteArrayLiteral("GL_KHR_debug")) +//! [3] + +//! [4] + const QList<QOpenGLDebugMessage> messages = logger->loggedMessages(); + for (const QOpenGLDebugMessage &message : messages) + qDebug() << message; +//! [4] + +//! [5] + connect(logger, &QOpenGLDebugLogger::messageLogged, receiver, &LogHandler::handleLoggedMessage); + logger->startLogging(); +//! [5] + +//! [6] + QOpenGLDebugMessage message = + QOpenGLDebugMessage::createApplicationMessage(QStringLiteral("Custom message")); + + logger->logMessage(message); +//! [6] diff --git a/src/gui/doc/snippets/code/src_gui_opengl_qopenglfunctions.cpp b/src/gui/doc/snippets/code/src_gui_opengl_qopenglfunctions.cpp new file mode 100644 index 0000000000..e072c110f2 --- /dev/null +++ b/src/gui/doc/snippets/code/src_gui_opengl_qopenglfunctions.cpp @@ -0,0 +1,112 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the documentation of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:BSD$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** BSD License Usage +** Alternatively, you may use this file under the terms of the BSD license +** as follows: +** +** "Redistribution and use in source and binary forms, with or without +** modification, are permitted provided that the following conditions are +** met: +** * Redistributions of source code must retain the above copyright +** notice, this list of conditions and the following disclaimer. +** * Redistributions in binary form must reproduce the above copyright +** notice, this list of conditions and the following disclaimer in +** the documentation and/or other materials provided with the +** distribution. +** * Neither the name of The Qt Company Ltd nor the names of its +** contributors may be used to endorse or promote products derived +** from this software without specific prior written permission. +** +** +** THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +** "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +** LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +** A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +** OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +** SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +** LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +** DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +** THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +** (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +** OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE." +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +//! [0] + class MyGLWindow : public QWindow, protected QOpenGLFunctions + { + Q_OBJECT + public: + MyGLWindow(QScreen *screen = 0); + + protected: + void initializeGL(); + void paintGL(); + + QOpenGLContext *m_context; + }; + + MyGLWindow(QScreen *screen) + : QWindow(screen), QOpenGLWidget(parent) + { + setSurfaceType(OpenGLSurface); + create(); + + // Create an OpenGL context + m_context = new QOpenGLContext; + m_context->create(); + + // Setup scene and render it + initializeGL(); + paintGL(); + } + + void MyGLWindow::initializeGL() + { + m_context->makeCurrent(this); + initializeOpenGLFunctions(); + } +//! [0] + +//! [1] + void MyGLWindow::paintGL() + { + m_context->makeCurrent(this); + glActiveTexture(GL_TEXTURE1); + glBindTexture(GL_TEXTURE_2D, textureId); + ... + m_context->swapBuffers(this); + m_context->doneCurrent(); + } +//! [1] + +//! [2] + QOpenGLFunctions glFuncs(QOpenGLContext::currentContext()); + glFuncs.glActiveTexture(GL_TEXTURE1); +//! [2] + +//! [3] + QOpenGLFunctions *glFuncs = QOpenGLContext::currentContext()->functions(); + glFuncs->glActiveTexture(GL_TEXTURE1); +//! [3] + +//! [4] + QOpenGLFunctions funcs(QOpenGLContext::currentContext()); + bool npot = funcs.hasOpenGLFeature(QOpenGLFunctions::NPOTTextures); +//! [4] diff --git a/src/gui/doc/snippets/code/src_gui_util_qdesktopservices.cpp b/src/gui/doc/snippets/code/src_gui_util_qdesktopservices.cpp index b48e9e8610..b9a8d8d90e 100644 --- a/src/gui/doc/snippets/code/src_gui_util_qdesktopservices.cpp +++ b/src/gui/doc/snippets/code/src_gui_util_qdesktopservices.cpp @@ -68,3 +68,31 @@ mailto:user@foo.com?subject=Test&body=Just a test //! [2] QDesktopServices::openUrl(QUrl("file:///C:/Documents and Settings/All Users/Desktop", QUrl::TolerantMode)); //! [2] + +//! [3] +<key>LSApplicationQueriesSchemes</key> +<array> + <string>https</string> +</array> +//! [3] + +//! [4] +<key>CFBundleURLTypes</key> +<array> + <dict> + <key>CFBundleURLSchemes</key> + <array> + <string>myapp</string> + </array> + </dict> +</array> +//! [4] + +//! [5] +QDesktopServices::storageLocation(QDesktopServices::DataLocation) +//! [5] + +//! [6] +QStandardPaths::writableLocation(QStandardPaths::GenericDataLocation) + + "/data/organization/application" +//! [6] diff --git a/src/gui/doc/snippets/code/src_gui_vulkan_qvulkanfunctions.cpp b/src/gui/doc/snippets/code/src_gui_vulkan_qvulkanfunctions.cpp new file mode 100644 index 0000000000..0d13873f38 --- /dev/null +++ b/src/gui/doc/snippets/code/src_gui_vulkan_qvulkanfunctions.cpp @@ -0,0 +1,70 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the documentation of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:BSD$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** BSD License Usage +** Alternatively, you may use this file under the terms of the BSD license +** as follows: +** +** "Redistribution and use in source and binary forms, with or without +** modification, are permitted provided that the following conditions are +** met: +** * Redistributions of source code must retain the above copyright +** notice, this list of conditions and the following disclaimer. +** * Redistributions in binary form must reproduce the above copyright +** notice, this list of conditions and the following disclaimer in +** the documentation and/or other materials provided with the +** distribution. +** * Neither the name of The Qt Company Ltd nor the names of its +** contributors may be used to endorse or promote products derived +** from this software without specific prior written permission. +** +** +** THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +** "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +** LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +** A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +** OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +** SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +** LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +** DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +** THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +** (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +** OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE." +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +//! [0] + void Window::render() + { + QVulkanInstance *inst = vulkanInstance(); + QVulkanFunctions *f = inst->functions(); + ... + VkResult err = f->vkAllocateCommandBuffers(device, &cmdBufInfo, &cmdBuf); + ... + } +//! [0] + +//! [1] + void Window::render() + { + QVulkanInstance *inst = vulkanInstance(); + QVulkanDeviceFunctions *df = inst->deviceFunctions(device); + VkResult err = df->vkAllocateCommandBuffers(device, &cmdBufInfo, &cmdBuf); + ... + } +//! [1] diff --git a/src/gui/doc/snippets/code/src_gui_vulkan_qvulkaninstance.cpp b/src/gui/doc/snippets/code/src_gui_vulkan_qvulkaninstance.cpp new file mode 100644 index 0000000000..14ef9ed2d4 --- /dev/null +++ b/src/gui/doc/snippets/code/src_gui_vulkan_qvulkaninstance.cpp @@ -0,0 +1,146 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the documentation of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:BSD$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** BSD License Usage +** Alternatively, you may use this file under the terms of the BSD license +** as follows: +** +** "Redistribution and use in source and binary forms, with or without +** modification, are permitted provided that the following conditions are +** met: +** * Redistributions of source code must retain the above copyright +** notice, this list of conditions and the following disclaimer. +** * Redistributions in binary form must reproduce the above copyright +** notice, this list of conditions and the following disclaimer in +** the documentation and/or other materials provided with the +** distribution. +** * Neither the name of The Qt Company Ltd nor the names of its +** contributors may be used to endorse or promote products derived +** from this software without specific prior written permission. +** +** +** THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +** "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +** LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +** A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +** OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +** SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +** LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +** DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +** THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +** (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +** OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE." +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +//! [0] + int main(int argc, char **argv) + { + QGuiApplication app(argc, argv); + + QVulkanInstance inst; + if (!inst.create()) + return 1; + + ... + window->setVulkanInstance(&inst); + window->show(); + + return app.exec(); + } +//! [0] + +//! [1] + QVulkanInstance inst; + + // Enable validation layer, if supported. Messages go to qDebug by default. + inst.setLayers(QByteArrayList() << "VK_LAYER_LUNARG_standard_validation"); + + bool ok = inst.create(); + if (!ok) + ... // Vulkan not available + if (!inst.layers().contains("VK_LAYER_LUNARG_standard_validation")) + ... // validation layer not available +//! [1] + +//! [2] + QVulkanInstance inst; + + if (inst.supportedLayers().contains("VK_LAYER_LUNARG_standard_validation")) + ... + + bool ok = inst.create(); + ... +//! [2] + +//! [3] + class VulkanWindow : public QWindow + { + public: + VulkanWindow() { + setSurfaceType(VulkanSurface); + } + + void exposeEvent(QExposeEvent *) { + if (isExposed()) { + if (!m_initialized) { + m_initialized = true; + // initialize device, swapchain, etc. + QVulkanInstance *inst = vulkanInstance(); + QVulkanFunctions *f = inst->functions(); + uint32_t devCount = 0; + f->vkEnumeratePhysicalDevices(inst->vkInstance(), &devCount, nullptr); + ... + // build the first frame + render(); + } + } + } + + bool event(QEvent *e) { + if (e->type() == QEvent::UpdateRequest) + render(); + return QWindow::event(e); + } + + void render() { + ... + requestUpdate(); // render continuously + } + + private: + bool m_initialized = false; + }; + + int main(int argc, char **argv) + { + QGuiApplication app(argc, argv); + + QVulkanInstance inst; + if (!inst.create()) { + qWarning("Vulkan not available"); + return 1; + } + + VulkanWindow window; + window.showMaximized(); + + return app.exec(); + + } +//! [3] diff --git a/src/gui/doc/snippets/code/src_gui_vulkan_qvulkanwindow.cpp b/src/gui/doc/snippets/code/src_gui_vulkan_qvulkanwindow.cpp new file mode 100644 index 0000000000..81d51233a3 --- /dev/null +++ b/src/gui/doc/snippets/code/src_gui_vulkan_qvulkanwindow.cpp @@ -0,0 +1,132 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the documentation of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:BSD$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** BSD License Usage +** Alternatively, you may use this file under the terms of the BSD license +** as follows: +** +** "Redistribution and use in source and binary forms, with or without +** modification, are permitted provided that the following conditions are +** met: +** * Redistributions of source code must retain the above copyright +** notice, this list of conditions and the following disclaimer. +** * Redistributions in binary form must reproduce the above copyright +** notice, this list of conditions and the following disclaimer in +** the documentation and/or other materials provided with the +** distribution. +** * Neither the name of The Qt Company Ltd nor the names of its +** contributors may be used to endorse or promote products derived +** from this software without specific prior written permission. +** +** +** THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +** "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +** LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +** A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +** OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +** SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +** LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +** DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +** THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +** (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +** OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE." +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +//! [0] + class VulkanRenderer : public QVulkanWindowRenderer + { + public: + VulkanRenderer(QVulkanWindow *w) : m_window(w) { } + + void initResources() override + { + m_devFuncs = m_window->vulkanInstance()->deviceFunctions(m_window->device()); + ... + } + void initSwapChainResources() override { ... } + void releaseSwapChainResources() override { ... } + void releaseResources() override { ... } + + void startNextFrame() override + { + VkCommandBuffer cmdBuf = m_window->currentCommandBuffer(); + ... + m_devFuncs->vkCmdBeginRenderPass(...); + ... + m_window->frameReady(); + } + + private: + QVulkanWindow *m_window; + QVulkanDeviceFunctions *m_devFuncs; + }; + + class VulkanWindow : public QVulkanWindow + { + public: + QVulkanWindowRenderer *createRenderer() override { + return new VulkanRenderer(this); + } + }; + + int main(int argc, char *argv[]) + { + QGuiApplication app(argc, argv); + + QVulkanInstance inst; + // enable the standard validation layers, when available + inst.setLayers(QByteArrayList() << "VK_LAYER_LUNARG_standard_validation"); + if (!inst.create()) + qFatal("Failed to create Vulkan instance: %d", inst.errorCode()); + + VulkanWindow w; + w.setVulkanInstance(&inst); + w.showMaximized(); + + return app.exec(); + } +//! [0] + +//! [1] + class Renderer { + ... + VkDescriptorBufferInfo m_uniformBufInfo[QVulkanWindow::MAX_CONCURRENT_FRAME_COUNT]; + }; + + void Renderer::startNextFrame() + { + VkDescriptorBufferInfo &uniformBufInfo(m_uniformBufInfo[m_window->currentFrame()]); + ... + } +//! [1] + +//! [2] + class Renderer { + ... + VkDescriptorBufferInfo m_uniformBufInfo[QVulkanWindow::MAX_CONCURRENT_FRAME_COUNT]; + }; + + void Renderer::startNextFrame() + { + const int count = m_window->concurrentFrameCount(); + for (int i = 0; i < count; ++i) + m_uniformBufInfo[i] = ... + ... + } +//! [2] diff --git a/src/gui/doc/snippets/draganddrop/mainwindow.cpp b/src/gui/doc/snippets/draganddrop/mainwindow.cpp index 551114856e..11311a0b57 100644 --- a/src/gui/doc/snippets/draganddrop/mainwindow.cpp +++ b/src/gui/doc/snippets/draganddrop/mainwindow.cpp @@ -48,7 +48,7 @@ ** ****************************************************************************/ -#include <QtGui> +#include <QtWidgets> #include "dragwidget.h" #include "mainwindow.h" @@ -64,10 +64,10 @@ MainWindow::MainWindow(QWidget *parent) QLabel *dataLabel = new QLabel(tr("Amount of data (bytes):"), centralWidget); dragWidget = new DragWidget(centralWidget); - connect(dragWidget, SIGNAL(mimeTypes(QStringList)), - this, SLOT(setMimeTypes(QStringList))); - connect(dragWidget, SIGNAL(dragResult(QString)), - this, SLOT(setDragResult(QString))); + connect(dragWidget, &DragWidget::mimeTypes, + this, &MainWindow::setMimeTypes); + connect(dragWidget, &DragWidget:dragResult, + this, &MainWindow::setDragResult); QVBoxLayout *mainLayout = new QVBoxLayout(centralWidget); mainLayout->addWidget(mimeTypeLabel); diff --git a/src/gui/doc/snippets/picture/picture.cpp b/src/gui/doc/snippets/picture/picture.cpp index 3a7676f60a..863476fdbf 100644 --- a/src/gui/doc/snippets/picture/picture.cpp +++ b/src/gui/doc/snippets/picture/picture.cpp @@ -48,7 +48,7 @@ ** ****************************************************************************/ -#include <QtGui> +#include <QtWidgets> void myProcessing(const QString &) { @@ -85,8 +85,8 @@ int main() { // FORMATS //! [2] - QStringList list = QPicture::inputFormatList(); - foreach (const QString &string, list) + const QStringList list = QPicture::inputFormatList(); + for (const QString &string : list) myProcessing(string); //! [2] } @@ -94,8 +94,8 @@ int main() { // OUTPUT //! [3] - QStringList list = QPicture::outputFormatList(); - foreach (const QString &string, list) + const QStringList list = QPicture::outputFormatList(); + for (const QString &string : list) myProcessing(string); //! [3] } diff --git a/src/gui/doc/snippets/qfontdatabase/main.cpp b/src/gui/doc/snippets/qfontdatabase/main.cpp index ae078f374d..5a5aa7b485 100644 --- a/src/gui/doc/snippets/qfontdatabase/main.cpp +++ b/src/gui/doc/snippets/qfontdatabase/main.cpp @@ -48,7 +48,7 @@ ** ****************************************************************************/ -#include <QtGui> +#include <QtWidgets> int main(int argc, char **argv) { @@ -60,16 +60,19 @@ int main(int argc, char **argv) fontTree.setColumnCount(2); fontTree.setHeaderLabels(QStringList() << "Font" << "Smooth Sizes"); - foreach (const QString &family, database.families()) { + const QStringList fontFamilies = database.families(); + for (const QString &family : fontFamilies) { QTreeWidgetItem *familyItem = new QTreeWidgetItem(&fontTree); familyItem->setText(0, family); - foreach (const QString &style, database.styles(family)) { + const QStringList fontStyles = database.styles(family); + for (const QString &style : fontStyles) { QTreeWidgetItem *styleItem = new QTreeWidgetItem(familyItem); styleItem->setText(0, style); QString sizes; - foreach (int points, database.smoothSizes(family, style)) + const QList<int> smoothSizes = database.smoothSizes(family, style) + for (int points : smoothSizes) sizes += QString::number(points) + ' '; styleItem->setText(1, sizes.trimmed()); diff --git a/src/gui/doc/snippets/qimagewriter/main.cpp b/src/gui/doc/snippets/qimagewriter/main.cpp new file mode 100644 index 0000000000..3758110356 --- /dev/null +++ b/src/gui/doc/snippets/qimagewriter/main.cpp @@ -0,0 +1,71 @@ +/**************************************************************************** +** +** Copyright (C) 2018 Samuel Gaist <samuel.gaist@idiap.ch> +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the documentation of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:BSD$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** BSD License Usage +** Alternatively, you may use this file under the terms of the BSD license +** as follows: +** +** "Redistribution and use in source and binary forms, with or without +** modification, are permitted provided that the following conditions are +** met: +** * Redistributions of source code must retain the above copyright +** notice, this list of conditions and the following disclaimer. +** * Redistributions in binary form must reproduce the above copyright +** notice, this list of conditions and the following disclaimer in +** the documentation and/or other materials provided with the +** distribution. +** * Neither the name of The Qt Company Ltd nor the names of its +** contributors may be used to endorse or promote products derived +** from this software without specific prior written permission. +** +** +** THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +** "AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +** LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +** A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +** OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +** SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +** LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +** DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +** THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +** (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +** OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE." +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#include <QtGui> + +int main(int argc, char **argv) +{ + QApplication app(argc, argv); + +//! [0] + QString imagePath(QStringLiteral("path/image.jpeg")); + QImage image(64, 64, QImage::Format_RGB32); + image.fill(Qt::red); + { + QImageWriter writer(imagePath); + writer.write(image); + } + + QFile::rename(imagePath, + QStringLiteral("path/other_image.jpeg")); +//! [0] + + return 0; +} diff --git a/src/gui/doc/snippets/separations/screenwidget.cpp b/src/gui/doc/snippets/separations/screenwidget.cpp index 6f8be49bfa..d562991d26 100644 --- a/src/gui/doc/snippets/separations/screenwidget.cpp +++ b/src/gui/doc/snippets/separations/screenwidget.cpp @@ -105,8 +105,8 @@ ScreenWidget::ScreenWidget(QWidget *parent, QColor initialColor, //invertButton->setOn(inverted); invertButton->setEnabled(false); - connect(colorButton, SIGNAL(clicked()), this, SLOT(setColor())); - connect(invertButton, SIGNAL(clicked()), this, SLOT(invertImage())); + connect(colorButton, &QPushButton::clicked, this, &ScreenWidget::setColor); + connect(invertButton, &QPushButton::clicked, this, &ScreenWidget::invertImage); QGridLayout *gridLayout = new QGridLayout; gridLayout->addWidget(imageLabel, 0, 0, 1, 2); diff --git a/src/gui/doc/snippets/separations/viewer.cpp b/src/gui/doc/snippets/separations/viewer.cpp index 641294ea35..018b397f1a 100644 --- a/src/gui/doc/snippets/separations/viewer.cpp +++ b/src/gui/doc/snippets/separations/viewer.cpp @@ -58,7 +58,7 @@ A main menu provides entries for selecting files, and adjusting the brightness of the separations. */ -#include <QtGui> +#include <QtWidgets> #include "finalwidget.h" #include "screenwidget.h" @@ -126,11 +126,11 @@ void Viewer::createMenus() menuBar()->addMenu(fileMenu); menuBar()->addMenu(brightnessMenu); - connect(openAction, SIGNAL(triggered()), this, SLOT(chooseFile())); - connect(saveAction, SIGNAL(triggered()), this, SLOT(saveImage())); - connect(quitAction, SIGNAL(triggered()), qApp, SLOT(quit())); - connect(brightnessMenu, SIGNAL(triggered(QAction*)), this, - SLOT(setBrightness(QAction*))); + connect(openAction, &QAction::triggered, this, &Viewer::chooseFile); + connect(saveAction, &QAction::triggered, this, &Viewer::saveImage); + connect(quitAction, &QAction::triggered, qApp, QApplication::quit); + connect(brightnessMenu, &QMenu::triggered, + this, &Viewer::setBrightness); } /* @@ -160,9 +160,9 @@ QFrame* Viewer::createCentralWidget() yellowWidget = new ScreenWidget(frame, Qt::yellow, tr("Yellow"), ScreenWidget::Yellow, labelSize); - connect(cyanWidget, SIGNAL(imageChanged()), this, SLOT(createImage())); - connect(magentaWidget, SIGNAL(imageChanged()), this, SLOT(createImage())); - connect(yellowWidget, SIGNAL(imageChanged()), this, SLOT(createImage())); + connect(cyanWidget, &ScreenWidget::imageChanged, this, &Viewer::createImage); + connect(magentaWidget, &ScreenWidget::imageChanged, this, &Viewer::createImage); + connect(yellowWidget, &ScreenWidget::imageChanged, this, &Viewer::createImage); grid->addWidget(finalWidget, 0, 0, Qt::AlignTop | Qt::AlignHCenter); grid->addWidget(cyanWidget, 0, 1, Qt::AlignTop | Qt::AlignHCenter); diff --git a/src/gui/doc/snippets/textblock-fragments/mainwindow.cpp b/src/gui/doc/snippets/textblock-fragments/mainwindow.cpp index bcc5c7dc30..bf864ce48d 100644 --- a/src/gui/doc/snippets/textblock-fragments/mainwindow.cpp +++ b/src/gui/doc/snippets/textblock-fragments/mainwindow.cpp @@ -48,7 +48,7 @@ ** ****************************************************************************/ -#include <QtGui> +#include <QtWidgets> #include "mainwindow.h" #include "xmlwriter.h" @@ -73,9 +73,9 @@ MainWindow::MainWindow() editor = new QTextEdit(this); - connect(saveAction, SIGNAL(triggered()), this, SLOT(saveFile())); - connect(quitAction, SIGNAL(triggered()), this, SLOT(close())); - connect(calendarAction, SIGNAL(triggered()), this, SLOT(insertCalendar())); + connect(saveAction, &QAction::triggered, this, &MainWindow::saveFile); + connect(quitAction, &QAction::triggered, this, &MainWindow::close); + connect(calendarAction, &QAction::triggered, this, &MainWindow::insertCalendar); setCentralWidget(editor); setWindowTitle(tr("Text Document Writer")); diff --git a/src/gui/doc/snippets/textdocument-blocks/mainwindow.cpp b/src/gui/doc/snippets/textdocument-blocks/mainwindow.cpp index f512cf0dc6..a5801da67e 100644 --- a/src/gui/doc/snippets/textdocument-blocks/mainwindow.cpp +++ b/src/gui/doc/snippets/textdocument-blocks/mainwindow.cpp @@ -48,7 +48,7 @@ ** ****************************************************************************/ -#include <QtGui> +#include <QtWidgets> #include "mainwindow.h" #include "xmlwriter.h" @@ -75,9 +75,9 @@ MainWindow::MainWindow() editor = new QTextEdit(this); //! [0] - connect(saveAction, SIGNAL(triggered()), this, SLOT(saveFile())); - connect(quitAction, SIGNAL(triggered()), this, SLOT(close())); - connect(calendarAction, SIGNAL(triggered()), this, SLOT(insertCalendar())); + connect(saveAction, &QAction::triggered, this, &MainWindow::saveFile); + connect(quitAction, &QAction::triggered, this, &MainWindow::close); + connect(calendarAction, &QAction::triggered, this, &MainWindow::insertCalendar); setCentralWidget(editor); setWindowTitle(tr("Text Document Writer")); diff --git a/src/gui/doc/snippets/textdocument-frames/mainwindow.cpp b/src/gui/doc/snippets/textdocument-frames/mainwindow.cpp index f15ad45f2e..edfadb4c77 100644 --- a/src/gui/doc/snippets/textdocument-frames/mainwindow.cpp +++ b/src/gui/doc/snippets/textdocument-frames/mainwindow.cpp @@ -48,7 +48,7 @@ ** ****************************************************************************/ -#include <QtGui> +#include <QtWidgets> #include "mainwindow.h" #include "xmlwriter.h" @@ -64,7 +64,7 @@ MainWindow::MainWindow() quitAction->setShortcut(tr("Ctrl+Q")); menuBar()->addMenu(fileMenu); - editor = new QTextEdit(); + editor = new QTextEdit; QTextCursor cursor(editor->textCursor()); cursor.movePosition(QTextCursor::Start); @@ -130,8 +130,8 @@ MainWindow::MainWindow() plainCharFormat); - connect(saveAction, SIGNAL(triggered()), this, SLOT(saveFile())); - connect(quitAction, SIGNAL(triggered()), this, SLOT(close())); + connect(saveAction, &QAction::triggered, this, &MainWindow::saveFile); + connect(quitAction, &QAction::triggered, this, &MainWindow::close); setCentralWidget(editor); setWindowTitle(tr("Text Document Frames")); diff --git a/src/gui/doc/snippets/textdocument-lists/mainwindow.cpp b/src/gui/doc/snippets/textdocument-lists/mainwindow.cpp index 15a2752c8b..785f7ebcc9 100644 --- a/src/gui/doc/snippets/textdocument-lists/mainwindow.cpp +++ b/src/gui/doc/snippets/textdocument-lists/mainwindow.cpp @@ -48,7 +48,7 @@ ** ****************************************************************************/ -#include <QtGui> +#include <QtWidgets> #include "mainwindow.h" @@ -88,7 +88,8 @@ MainWindow::MainWindow() document = new QTextDocument(this); editor->setDocument(document); - connect(editor, SIGNAL(selectionChanged()), this, SLOT(updateMenus())); + connect(editor, &QTextEdit::selectionChanged, + this, &MainWindow::updateMenus); updateMenus(); diff --git a/src/gui/doc/snippets/textdocument-printing/mainwindow.cpp b/src/gui/doc/snippets/textdocument-printing/mainwindow.cpp index 40459b49da..a7bd90a9f1 100644 --- a/src/gui/doc/snippets/textdocument-printing/mainwindow.cpp +++ b/src/gui/doc/snippets/textdocument-printing/mainwindow.cpp @@ -74,7 +74,7 @@ MainWindow::MainWindow() document = new QTextDocument(this); editor->setDocument(document); - connect(editor, SIGNAL(selectionChanged()), this, SLOT(updateMenus())); + connect(editor, &QTextEdit::selectionChanged, this, &MainWindow::updateMenus); setCentralWidget(editor); setWindowTitle(tr("Text Document Writer")); diff --git a/src/gui/doc/snippets/textdocument-selections/mainwindow.cpp b/src/gui/doc/snippets/textdocument-selections/mainwindow.cpp index 8ac3913f3c..9253e87670 100644 --- a/src/gui/doc/snippets/textdocument-selections/mainwindow.cpp +++ b/src/gui/doc/snippets/textdocument-selections/mainwindow.cpp @@ -48,7 +48,7 @@ ** ****************************************************************************/ -#include <QtGui> +#include <QtWidgets> #include "mainwindow.h" @@ -90,7 +90,8 @@ MainWindow::MainWindow() document = new QTextDocument(this); editor->setDocument(document); - connect(editor, SIGNAL(selectionChanged()), this, SLOT(updateMenus())); + connect(editor, &QTextEdit::selectionChanged, + this, &MainWindow::updateMenus); setCentralWidget(editor); setWindowTitle(tr("Text Document Writer")); diff --git a/src/gui/doc/snippets/textdocument-tables/mainwindow.cpp b/src/gui/doc/snippets/textdocument-tables/mainwindow.cpp index 061c191f1c..bd976a8ce4 100644 --- a/src/gui/doc/snippets/textdocument-tables/mainwindow.cpp +++ b/src/gui/doc/snippets/textdocument-tables/mainwindow.cpp @@ -48,7 +48,7 @@ ** ****************************************************************************/ -#include <QtGui> +#include <QtWidgets> #include "mainwindow.h" #include "xmlwriter.h" @@ -132,9 +132,9 @@ MainWindow::MainWindow() } //! [8] - connect(saveAction, SIGNAL(triggered()), this, SLOT(saveFile())); - connect(quitAction, SIGNAL(triggered()), this, SLOT(close())); - connect(showTableAction, SIGNAL(triggered()), this, SLOT(showTable())); + connect(saveAction, &QAction:triggered, this, &MainWindow::saveFile); + connect(quitAction, &QAction:triggered, this, &MainWindow::close); + connect(showTableAction, &QAction:triggered, this, &MainWindow::showTable); setCentralWidget(editor); setWindowTitle(tr("Text Document Tables")); diff --git a/src/gui/gui.pro b/src/gui/gui.pro index 759d6f3cbf..edf8124081 100644 --- a/src/gui/gui.pro +++ b/src/gui/gui.pro @@ -45,9 +45,10 @@ include(painting/painting.pri) include(util/util.pri) include(math3d/math3d.pri) include(opengl/opengl.pri) -include(animation/animation.pri) +qtConfig(animation): include(animation/animation.pri) include(itemmodels/itemmodels.pri) include(vulkan/vulkan.pri) +include(platform/platform.pri) QMAKE_LIBS += $$QMAKE_LIBS_GUI diff --git a/src/gui/image/qbitmap.cpp b/src/gui/image/qbitmap.cpp index 2453242fa8..455045eb57 100644 --- a/src/gui/image/qbitmap.cpp +++ b/src/gui/image/qbitmap.cpp @@ -310,6 +310,7 @@ QBitmap QBitmap::transformed(const QTransform &matrix) const return bm; } +#if QT_DEPRECATED_SINCE(5, 13) /*! \overload \obsolete @@ -321,5 +322,6 @@ QBitmap QBitmap::transformed(const QMatrix &matrix) const { return transformed(QTransform(matrix)); } +#endif QT_END_NAMESPACE diff --git a/src/gui/image/qbitmap.h b/src/gui/image/qbitmap.h index 188064fccf..3cc360f670 100644 --- a/src/gui/image/qbitmap.h +++ b/src/gui/image/qbitmap.h @@ -61,7 +61,7 @@ public: QBitmap(const QBitmap &other) : QPixmap(other) {} // QBitmap(QBitmap &&other) : QPixmap(std::move(other)) {} // QPixmap doesn't, yet, have a move ctor QBitmap &operator=(const QBitmap &other) { QPixmap::operator=(other); return *this; } - QBitmap &operator=(QBitmap &&other) Q_DECL_NOTHROW { QPixmap::operator=(std::move(other)); return *this; } + QBitmap &operator=(QBitmap &&other) noexcept { QPixmap::operator=(std::move(other)); return *this; } ~QBitmap(); #endif @@ -76,7 +76,10 @@ public: static QBitmap fromData(const QSize &size, const uchar *bits, QImage::Format monoFormat = QImage::Format_MonoLSB); +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use QBitmap::transformed(QTransform) instead") QBitmap transformed(const QMatrix &) const; +#endif QBitmap transformed(const QTransform &matrix) const; typedef QExplicitlySharedDataPointer<QPlatformPixmap> DataPtr; diff --git a/src/gui/image/qbmphandler.cpp b/src/gui/image/qbmphandler.cpp index 5dff4ab0ac..7f8e072322 100644 --- a/src/gui/image/qbmphandler.cpp +++ b/src/gui/image/qbmphandler.cpp @@ -188,7 +188,7 @@ static bool read_dib_infoheader(QDataStream &s, BMP_INFOHDR &bi) if (!(comp == BMP_RGB || (nbits == 4 && comp == BMP_RLE4) || (nbits == 8 && comp == BMP_RLE8) || ((nbits == 16 || nbits == 32) && comp == BMP_BITFIELDS))) return false; // weird compression type - if (bi.biWidth < 0 || quint64(bi.biWidth) * qAbs(bi.biHeight) > 16384 * 16384) + if (bi.biWidth <= 0 || !bi.biHeight || quint64(bi.biWidth) * qAbs(bi.biHeight) > 16384 * 16384) return false; return true; @@ -866,10 +866,12 @@ void QBmpHandler::setOption(ImageOption option, const QVariant &value) Q_UNUSED(value); } +#if QT_DEPRECATED_SINCE(5, 13) QByteArray QBmpHandler::name() const { return formatName(); } +#endif QT_END_NAMESPACE diff --git a/src/gui/image/qbmphandler_p.h b/src/gui/image/qbmphandler_p.h index 56b39dd0f0..33b5b9c501 100644 --- a/src/gui/image/qbmphandler_p.h +++ b/src/gui/image/qbmphandler_p.h @@ -113,8 +113,9 @@ public: bool read(QImage *image) override; bool write(const QImage &image) override; +#if QT_DEPRECATED_SINCE(5, 13) QByteArray name() const override; - +#endif static bool canRead(QIODevice *device); QVariant option(ImageOption option) const override; diff --git a/src/gui/image/qicon.cpp b/src/gui/image/qicon.cpp index 5907d69f87..892a686c89 100644 --- a/src/gui/image/qicon.cpp +++ b/src/gui/image/qicon.cpp @@ -47,8 +47,10 @@ #include "private/qiconloader_p.h" #include "qpainter.h" #include "qfileinfo.h" +#if QT_CONFIG(mimetype) #include <qmimedatabase.h> #include <qmimetype.h> +#endif #include "qpixmapcache.h" #include "qvariant.h" #include "qcache.h" @@ -313,9 +315,9 @@ QPixmap QPixmapIconEngine::pixmap(const QSize &size, QIcon::Mode mode, QIcon::St % HexString<uint>(actualSize.height()); if (mode == QIcon::Active) { - if (QPixmapCache::find(key % HexString<uint>(mode), pm)) + if (QPixmapCache::find(key % HexString<uint>(mode), &pm)) return pm; // horray - if (QPixmapCache::find(key % HexString<uint>(QIcon::Normal), pm)) { + if (QPixmapCache::find(key % HexString<uint>(QIcon::Normal), &pm)) { QPixmap active = pm; if (QGuiApplication *guiApp = qobject_cast<QGuiApplication *>(qApp)) active = static_cast<QGuiApplicationPrivate*>(QObjectPrivate::get(guiApp))->applyQIconStyleHelper(QIcon::Active, pm); @@ -324,7 +326,7 @@ QPixmap QPixmapIconEngine::pixmap(const QSize &size, QIcon::Mode mode, QIcon::St } } - if (!QPixmapCache::find(key % HexString<uint>(mode), pm)) { + if (!QPixmapCache::find(key % HexString<uint>(mode), &pm)) { if (pm.size() != actualSize) pm = pm.scaled(actualSize, Qt::IgnoreAspectRatio, Qt::SmoothTransformation); if (pe->mode != mode && mode != QIcon::Normal) { @@ -661,7 +663,7 @@ QFactoryLoader *qt_iconEngineFactoryLoader() /*! Constructs a null icon. */ -QIcon::QIcon() Q_DECL_NOEXCEPT +QIcon::QIcon() noexcept : d(0) { } @@ -1079,10 +1081,10 @@ void QIcon::addFile(const QString &fileName, const QSize &size, Mode mode, State QFileInfo info(fileName); QString suffix = info.suffix(); -#ifndef QT_NO_MIMETYPE +#if QT_CONFIG(mimetype) if (suffix.isEmpty()) suffix = QMimeDatabase().mimeTypeForFile(info).preferredSuffix(); // determination from contents -#endif // !QT_NO_MIMETYPE +#endif // mimetype QIconEngine *engine = iconEngineFromSuffix(fileName, suffix); d = new QIconPrivate(engine ? engine : new QPixmapIconEngine); } diff --git a/src/gui/image/qicon.h b/src/gui/image/qicon.h index 6a4fc8927a..0f834fc2cb 100644 --- a/src/gui/image/qicon.h +++ b/src/gui/image/qicon.h @@ -50,6 +50,7 @@ QT_BEGIN_NAMESPACE class QIconPrivate; class QIconEngine; +class QPainter; class Q_GUI_EXPORT QIcon { @@ -57,11 +58,11 @@ public: enum Mode { Normal, Disabled, Active, Selected }; enum State { On, Off }; - QIcon() Q_DECL_NOEXCEPT; + QIcon() noexcept; QIcon(const QPixmap &pixmap); QIcon(const QIcon &other); #ifdef Q_COMPILER_RVALUE_REFS - QIcon(QIcon &&other) Q_DECL_NOEXCEPT + QIcon(QIcon &&other) noexcept : d(other.d) { other.d = nullptr; } #endif @@ -70,10 +71,10 @@ public: ~QIcon(); QIcon &operator=(const QIcon &other); #ifdef Q_COMPILER_RVALUE_REFS - inline QIcon &operator=(QIcon &&other) Q_DECL_NOEXCEPT + inline QIcon &operator=(QIcon &&other) noexcept { swap(other); return *this; } #endif - inline void swap(QIcon &other) Q_DECL_NOEXCEPT + inline void swap(QIcon &other) noexcept { qSwap(d, other.d); } operator QVariant() const; diff --git a/src/gui/image/qiconengine.h b/src/gui/image/qiconengine.h index 0c67ef2686..0c5b51dc71 100644 --- a/src/gui/image/qiconengine.h +++ b/src/gui/image/qiconengine.h @@ -90,6 +90,7 @@ public: QPixmap pixmap; }; + // ### Qt6: move content to proper virtual functions virtual void virtual_hook(int id, void *data); private: diff --git a/src/gui/image/qiconloader.cpp b/src/gui/image/qiconloader.cpp index 228de3adc3..1d0c93f26f 100644 --- a/src/gui/image/qiconloader.cpp +++ b/src/gui/image/qiconloader.cpp @@ -50,7 +50,9 @@ #include <QtCore/qmath.h> #include <QtCore/QList> #include <QtCore/QDir> +#if QT_CONFIG(settings) #include <QtCore/QSettings> +#endif #include <QtGui/QPainter> #include <private/qhexstring_p.h> @@ -348,7 +350,7 @@ QIconTheme::QIconTheme(const QString &themeName) m_valid = true; } } -#ifndef QT_NO_SETTINGS +#if QT_CONFIG(settings) if (themeIndex.exists()) { const QSettings indexReader(themeIndex.fileName(), QSettings::IniFormat); const QStringList keys = indexReader.allKeys(); @@ -407,7 +409,7 @@ QIconTheme::QIconTheme(const QString &themeName) if (!m_parents.contains(QLatin1String("hicolor"))) m_parents.append(QLatin1String("hicolor")); } -#endif //QT_NO_SETTINGS +#endif // settings } QThemeIconInfo QIconLoader::findIconHelper(const QString &themeName, @@ -627,7 +629,10 @@ void QIconLoaderEngine::ensureLoaded() void QIconLoaderEngine::paint(QPainter *painter, const QRect &rect, QIcon::Mode mode, QIcon::State state) { - QSize pixmapSize = rect.size(); + const qreal dpr = !qApp->testAttribute(Qt::AA_UseHighDpiPixmaps) ? + qreal(1.0) : painter->device()->devicePixelRatioF(); + + QSize pixmapSize = rect.size() * dpr; painter->drawPixmap(rect, pixmap(pixmapSize, mode, state)); } diff --git a/src/gui/image/qimage.cpp b/src/gui/image/qimage.cpp index 636cacfb9c..917dde3b0f 100644 --- a/src/gui/image/qimage.cpp +++ b/src/gui/image/qimage.cpp @@ -1,6 +1,6 @@ /**************************************************************************** ** -** Copyright (C) 2016 The Qt Company Ltd. +** Copyright (C) 2018 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** ** This file is part of the QtGui module of the Qt Toolkit. @@ -38,8 +38,10 @@ ****************************************************************************/ #include "qimage.h" -#include "qdatastream.h" + #include "qbuffer.h" +#include "qdatastream.h" +#include "qcolortransform.h" #include "qmap.h" #include "qmatrix.h" #include "qtransform.h" @@ -54,6 +56,7 @@ #include <stdlib.h> #include <limits.h> #include <qpa/qplatformpixmap.h> +#include <private/qcolortransform_p.h> #include <private/qdrawhelper_p.h> #include <private/qmemrotate_p.h> #include <private/qimagescale_p.h> @@ -113,26 +116,19 @@ QImageData::QImageData() \internal Creates a new image data. - Returns 0 if invalid parameters are give or anything else failed. + Returns \nullptr if invalid parameters are give or anything else failed. */ QImageData * QImageData::create(const QSize &size, QImage::Format format) { - if (!size.isValid() || format == QImage::Format_Invalid) - return 0; // invalid parameter(s) + if (size.isEmpty() || format == QImage::Format_Invalid) + return nullptr; // invalid parameter(s) - uint width = size.width(); - uint height = size.height(); - uint depth = qt_depthForFormat(format); - - const int bytes_per_line = ((width * depth + 31) >> 5) << 2; // bytes per scanline (must be multiple of 4) - - // sanity check for potential overflows - if (std::numeric_limits<int>::max()/depth < width - || bytes_per_line <= 0 - || height <= 0 - || std::numeric_limits<qsizetype>::max()/uint(bytes_per_line) < height - || std::numeric_limits<int>::max()/sizeof(uchar *) < uint(height)) - return 0; + int width = size.width(); + int height = size.height(); + int depth = qt_depthForFormat(format); + auto params = calculateImageParameters(width, height, depth); + if (!params.isValid()) + return nullptr; QScopedPointer<QImageData> d(new QImageData); @@ -154,18 +150,15 @@ QImageData * QImageData::create(const QSize &size, QImage::Format format) d->has_alpha_clut = false; d->is_cached = false; - d->bytes_per_line = bytes_per_line; - - d->nbytes = d->bytes_per_line*height; + d->bytes_per_line = params.bytesPerLine; + d->nbytes = params.totalSize; d->data = (uchar *)malloc(d->nbytes); - if (!d->data) { - return 0; - } + if (!d->data) + return nullptr; d->ref.ref(); return d.take(); - } QImageData::~QImageData() @@ -298,6 +291,7 @@ bool QImageData::checkForAlphaPixels() const case QImage::Format_BGR30: case QImage::Format_RGB30: case QImage::Format_Grayscale8: + case QImage::Format_Grayscale16: case QImage::Format_RGBX64: break; case QImage::Format_Invalid: @@ -720,6 +714,7 @@ bool QImageData::checkForAlphaPixels() const \value Format_A2RGB30_Premultiplied The image is stored using a 32-bit premultiplied ARGB format (2-10-10-10). (added in Qt 5.4) \value Format_Alpha8 The image is stored using an 8-bit alpha only format. (added in Qt 5.5) \value Format_Grayscale8 The image is stored using an 8-bit grayscale format. (added in Qt 5.5) + \value Format_Grayscale16 The image is stored using an 16-bit grayscale format. (added in Qt 5.13) \value Format_RGBX64 The image is stored using a 64-bit halfword-ordered RGB(x) format (16-16-16-16). This is the same as the Format_RGBX64 except alpha must always be 65535. (added in Qt 5.12) \value Format_RGBA64 The image is stored using a 64-bit halfword-ordered RGBA format (16-16-16-16). (added in Qt 5.12) @@ -746,7 +741,7 @@ bool QImageData::checkForAlphaPixels() const \sa isNull() */ -QImage::QImage() Q_DECL_NOEXCEPT +QImage::QImage() noexcept : QPaintDevice() { d = 0; @@ -786,27 +781,27 @@ QImage::QImage(const QSize &size, Format format) QImageData *QImageData::create(uchar *data, int width, int height, int bpl, QImage::Format format, bool readOnly, QImageCleanupFunction cleanupFunction, void *cleanupInfo) { - QImageData *d = 0; - - if (format == QImage::Format_Invalid) - return d; + if (width <= 0 || height <= 0 || !data || format == QImage::Format_Invalid) + return nullptr; const int depth = qt_depthForFormat(format); - const int calc_bytes_per_line = ((width * depth + 31)/32) * 4; - const int min_bytes_per_line = (width * depth + 7)/8; - - if (bpl <= 0) - bpl = calc_bytes_per_line; - - if (width <= 0 || height <= 0 || !data - || INT_MAX/sizeof(uchar *) < uint(height) - || INT_MAX/uint(depth) < uint(width) - || bpl <= 0 - || bpl < min_bytes_per_line - || INT_MAX/uint(bpl) < uint(height)) - return d; // invalid parameter(s) + auto params = calculateImageParameters(width, height, depth); + if (!params.isValid()) + return nullptr; + + if (bpl > 0) { + // can't overflow, because has calculateImageParameters already done this multiplication + const int min_bytes_per_line = (width * depth + 7)/8; + if (bpl < min_bytes_per_line) + return nullptr; + + // recalculate the total with this value + params.bytesPerLine = bpl; + if (mul_overflow<qsizetype>(bpl, height, ¶ms.totalSize)) + return nullptr; + } - d = new QImageData; + QImageData *d = new QImageData; d->ref.ref(); d->own_data = false; @@ -817,8 +812,8 @@ QImageData *QImageData::create(uchar *data, int width, int height, int bpl, QIm d->depth = depth; d->format = format; - d->bytes_per_line = bpl; - d->nbytes = d->bytes_per_line * height; + d->bytes_per_line = params.bytesPerLine; + d->nbytes = params.totalSize; d->cleanupFunction = cleanupFunction; d->cleanupInfo = cleanupInfo; @@ -1099,13 +1094,30 @@ void QImage::detach() } -static void copyMetadata(QImageData *dst, const QImageData *src) +static void copyPhysicalMetadata(QImageData *dst, const QImageData *src) { - // Doesn't copy colortable and alpha_clut, or offset. dst->dpmx = src->dpmx; dst->dpmy = src->dpmy; dst->devicePixelRatio = src->devicePixelRatio; +} + +static void copyMetadata(QImageData *dst, const QImageData *src) +{ + // Doesn't copy colortable and alpha_clut, or offset. + copyPhysicalMetadata(dst, src); dst->text = src->text; + dst->colorSpace = src->colorSpace; +} + +static void copyMetadata(QImage *dst, const QImage &src) +{ + dst->setDotsPerMeterX(src.dotsPerMeterX()); + dst->setDotsPerMeterY(src.dotsPerMeterY()); + dst->setDevicePixelRatio(src.devicePixelRatio()); + const auto textKeys = src.textKeys(); + for (const auto &key: textKeys) + dst->setText(key, src.text(key)); + } /*! @@ -1319,7 +1331,7 @@ QRect QImage::rect() const The image depth is the number of bits used to store a single pixel, also called bits per pixel (bpp). - The supported depths are 1, 8, 16, 24 and 32. + The supported depths are 1, 8, 16, 24, 32 and 64. \sa bitPlaneCount(), convertToFormat(), {QImage#Image Formats}{Image Formats}, {QImage#Image Information}{Image Information} @@ -1384,7 +1396,7 @@ void QImage::setColorTable(const QVector<QRgb> colors) #if QT_VERSION >= QT_VERSION_CHECK(6,0,0) d->colortable = colors; #else - d->colortable = qMove(const_cast<QVector<QRgb>&>(colors)); + d->colortable = std::move(const_cast<QVector<QRgb>&>(colors)); #endif d->has_alpha_clut = false; for (int i = 0; i < d->colortable.size(); ++i) { @@ -1458,6 +1470,7 @@ void QImage::setDevicePixelRatio(qreal scaleFactor) d->devicePixelRatio = scaleFactor; } +#if QT_DEPRECATED_SINCE(5, 10) /*! \since 4.6 \obsolete @@ -1474,6 +1487,7 @@ int QImage::byteCount() const Q_ASSERT(!d || d->nbytes < std::numeric_limits<int>::max()); return d ? int(d->nbytes) : 0; } +#endif /*! \since 5.10 @@ -1494,10 +1508,17 @@ qsizetype QImage::sizeInBytes() const \sa scanLine() */ +#if QT_VERSION >= QT_VERSION_CHECK(6,0,0) +qsizetype QImage::bytesPerLine() const +{ + return d ? d->bytes_per_line : 0; +} +#else int QImage::bytesPerLine() const { return d ? d->bytes_per_line : 0; } +#endif /*! @@ -1553,7 +1574,9 @@ void QImage::setColor(int i, QRgb c) Returns a pointer to the pixel data at the scanline with index \a i. The first scanline is at index 0. - The scanline data is aligned on a 32-bit boundary. + The scanline data is as minimum 32-bit aligned. For 64-bit formats + it follows the native alignment of 64-bit integers (64-bit for most + platforms, but notably 32-bit on i386). \warning If you are accessing 32-bpp image data, cast the returned pointer to \c{QRgb*} (QRgb has a 32-bit size) and use it to @@ -2048,6 +2071,7 @@ static bool highColorPrecision(QImage::Format format) case QImage::Format_RGBX64: case QImage::Format_RGBA64: case QImage::Format_RGBA64_Premultiplied: + case QImage::Format_Grayscale16: return true; default: break; @@ -2069,13 +2093,7 @@ QImage QImage::convertToFormat_helper(Format format, Qt::ImageConversionFlags fl Image_Converter converter = qimage_converter_map[d->format][format]; if (!converter && format > QImage::Format_Indexed8 && d->format > QImage::Format_Indexed8) { if (highColorPrecision(format) && highColorPrecision(d->format)) { - // Convert over RGBA64_Premultiplied - if (format == QImage::Format_RGBA64_Premultiplied) - converter = convert_generic_to_rgb64; - else { - Q_ASSERT(d->format != QImage::Format_RGBA64_Premultiplied); - return convertToFormat(Format_RGBA64_Premultiplied, flags).convertToFormat(format, flags); - } + converter = convert_generic_to_rgb64; } else converter = convert_generic; } @@ -2256,6 +2274,29 @@ bool QImage::reinterpretAsFormat(Format format) } /*! + \since 5.13 + + Detach and convert the image to the given \a format in place. + + The specified image conversion \a flags control how the image data + is handled during the conversion process. + + \sa convertToFormat() +*/ + +void QImage::convertTo(Format format, Qt::ImageConversionFlags flags) +{ + if (!d || format == QImage::Format_Invalid) + return; + + detach(); + if (convertToFormat_inplace(format, flags)) + return; + + *this = convertToFormat_helper(format, flags); +} + +/*! \fn bool QImage::valid(const QPoint &pos) const Returns \c true if \a pos is a valid coordinate pair within the @@ -2541,6 +2582,10 @@ QColor QImage::pixelColor(int x, int y) const case Format_RGBA64_Premultiplied: c = reinterpret_cast<const QRgba64 *>(s)[x]; break; + case Format_Grayscale16: { + quint16 v = reinterpret_cast<const quint16 *>(s)[x]; + return QColor(qRgba64(v, v, v, 0xffff)); + } default: c = QRgba64::fromArgb32(pixel(x, y)); break; @@ -2651,6 +2696,7 @@ bool QImage::allGray() const case Format_Alpha8: return false; case Format_Grayscale8: + case Format_Grayscale16: return true; case Format_RGB32: case Format_ARGB32: @@ -2717,7 +2763,7 @@ bool QImage::isGrayscale() const if (d->format == QImage::Format_Alpha8) return false; - if (d->format == QImage::Format_Grayscale8) + if (d->format == QImage::Format_Grayscale8 || d->format == QImage::Format_Grayscale16) return true; switch (depth()) { @@ -2927,8 +2973,10 @@ QImage QImage::createAlphaMask(Qt::ImageConversionFlags flags) const } QImage mask(d->width, d->height, Format_MonoLSB); - if (!mask.isNull()) + if (!mask.isNull()) { dither_to_Mono(mask.d, d, flags, true); + copyPhysicalMetadata(mask.d, d); + } return mask; } @@ -3046,6 +3094,7 @@ QImage QImage::createHeuristicMask(bool clipTight) const #undef PIX + copyPhysicalMetadata(m.d, d); return m; } #endif //QT_NO_IMAGE_HEURISTIC_MASK @@ -3089,6 +3138,8 @@ QImage QImage::createMaskFromColor(QRgb color, Qt::MaskMode mode) const } if (mode == Qt::MaskOutColor) maskImage.invertPixels(); + + copyPhysicalMetadata(maskImage.d, d); return maskImage; } @@ -3351,6 +3402,7 @@ QImage QImage::rgbSwapped_helper() const break; case Format_Alpha8: case Format_Grayscale8: + case Format_Grayscale16: return *this; case Format_Mono: case Format_MonoLSB: @@ -3462,6 +3514,7 @@ void QImage::rgbSwapped_inplace() break; case Format_Alpha8: case Format_Grayscale8: + case Format_Grayscale16: return; case Format_Mono: case Format_MonoLSB: @@ -3553,7 +3606,7 @@ void QImage::rgbSwapped_inplace() The loader attempts to read the image using the specified \a format, e.g., PNG or JPG. If \a format is not specified (which is the default), it is auto-detected based on the file's suffix and header. For details, see - {QImageReader::setAutoDetectImageFormat()}{QImageReader}. + QImageReader::setAutoDetectImageFormat(). The file name can either refer to an actual file on disk or to one of the application's embedded resources. See the @@ -3750,7 +3803,9 @@ QDataStream &operator>>(QDataStream &s, QImage &image) return s; } } - image = QImageReader(s.device(), 0).read(); + image = QImageReader(s.device(), s.version() == 1 ? "bmp" : "png").read(); + if (image.isNull() && s.version() >= 5) + s.setStatus(QDataStream::ReadPastEnd); return s; } #endif // QT_NO_DATASTREAM @@ -4635,12 +4690,14 @@ QImage QImage::smoothScaled(int w, int h) const { case QImage::Format_RGBX8888: #endif case QImage::Format_RGBA8888_Premultiplied: +#if QT_CONFIG(raster_64bit) case QImage::Format_RGBX64: case QImage::Format_RGBA64_Premultiplied: break; case QImage::Format_RGBA64: src = src.convertToFormat(QImage::Format_RGBA64_Premultiplied); break; +#endif default: if (src.hasAlphaChannel()) src = src.convertToFormat(QImage::Format_ARGB32_Premultiplied); @@ -4656,8 +4713,7 @@ QImage QImage::smoothScaled(int w, int h) const { static QImage rotated90(const QImage &image) { QImage out(image.height(), image.width(), image.format()); - out.setDotsPerMeterX(image.dotsPerMeterY()); - out.setDotsPerMeterY(image.dotsPerMeterX()); + copyMetadata(&out, image); if (image.colorCount() > 0) out.setColorTable(image.colorTable()); int w = image.width(); @@ -4685,8 +4741,7 @@ static QImage rotated180(const QImage &image) return image.mirrored(true, true); QImage out(image.width(), image.height(), image.format()); - out.setDotsPerMeterX(image.dotsPerMeterY()); - out.setDotsPerMeterY(image.dotsPerMeterX()); + copyMetadata(&out, image); if (image.colorCount() > 0) out.setColorTable(image.colorTable()); int w = image.width(); @@ -4698,8 +4753,7 @@ static QImage rotated180(const QImage &image) static QImage rotated270(const QImage &image) { QImage out(image.height(), image.width(), image.format()); - out.setDotsPerMeterX(image.dotsPerMeterY()); - out.setDotsPerMeterY(image.dotsPerMeterX()); + copyMetadata(&out, image); if (image.colorCount() > 0) out.setColorTable(image.colorTable()); int w = image.width(); @@ -4901,6 +4955,132 @@ QTransform QImage::trueMatrix(const QTransform &matrix, int w, int h) return matrix * QTransform().translate(-delta.x(), -delta.y()); } +/*! + \since 5.14 + + Sets the image color space to \a colorSpace without performing any conversions on image data. + + \sa colorSpace() +*/ +void QImage::setColorSpace(const QColorSpace &colorSpace) +{ + if (!d) + return; + if (d->colorSpace == colorSpace) + return; + if (!isDetached()) // Detach only if shared, not for read-only data. + detach(); + d->colorSpace = colorSpace; +} + +/*! + \since 5.14 + + Converts the image to \a colorSpace. + + If the image has no valid color space, the method does nothing. + + \sa convertedToColorSpace(), setColorSpace() +*/ +void QImage::convertToColorSpace(const QColorSpace &colorSpace) +{ + if (!d) + return; + if (!d->colorSpace.isValid()) + return; + if (!colorSpace.isValid()) { + qWarning() << "QImage::convertToColorSpace: Output colorspace is not valid"; + return; + } + detach(); + applyColorTransform(d->colorSpace.transformationToColorSpace(colorSpace)); + d->colorSpace = colorSpace; +} + +/*! + \since 5.14 + + Returns the image converted to \a colorSpace. + + If the image has no valid color space, a null QImage is returned. + + \sa convertToColorSpace() +*/ +QImage QImage::convertedToColorSpace(const QColorSpace &colorSpace) const +{ + if (!d || !d->colorSpace.isValid() || !colorSpace.isValid()) + return QImage(); + QImage image = copy(); + image.convertToColorSpace(colorSpace); + return image; +} + +/*! + \since 5.14 + + Returns the color space of the image if a color space is defined. +*/ +QColorSpace QImage::colorSpace() const +{ + if (!d) + return QColorSpace::Undefined; + return d->colorSpace; +} + +/*! + \since 5.14 + + Applies the color transformation \a transform to all pixels in the image. +*/ +void QImage::applyColorTransform(const QColorTransform &transform) +{ + QImage::Format oldFormat = format(); + if (depth() > 32) { + if (format() != QImage::Format_RGBX64 && format() != QImage::Format_RGBA64 + && format() != QImage::Format_RGBA64_Premultiplied) + *this = std::move(*this).convertToFormat(QImage::Format_RGBA64); + } else if (format() != QImage::Format_ARGB32 && format() != QImage::Format_RGB32 + && format() != QImage::Format_ARGB32_Premultiplied) { + if (hasAlphaChannel()) + *this = std::move(*this).convertToFormat(QImage::Format_ARGB32); + else + *this = std::move(*this).convertToFormat(QImage::Format_RGB32); + } + + QColorTransformPrivate::TransformFlags flags = QColorTransformPrivate::Unpremultiplied; + switch (format()) { + case Format_ARGB32_Premultiplied: + case Format_RGBA64_Premultiplied: + flags = QColorTransformPrivate::Premultiplied; + break; + case Format_RGB32: + case Format_RGBX64: + flags = QColorTransformPrivate::InputOpaque; + break; + case Format_ARGB32: + case Format_RGBA64: + break; + default: + Q_UNREACHABLE(); + } + + if (depth() > 32) { + for (int i = 0; i < height(); ++i) { + QRgba64 *scanline = reinterpret_cast<QRgba64 *>(scanLine(i)); + transform.d_func()->apply(scanline, scanline, width(), flags); + } + } else { + for (int i = 0; i < height(); ++i) { + QRgb *scanline = reinterpret_cast<QRgb *>(scanLine(i)); + transform.d_func()->apply(scanline, scanline, width(), flags); + } + } + + if (oldFormat != format()) + *this = std::move(*this).convertToFormat(oldFormat); +} + + bool QImageData::convertInPlace(QImage::Format newFormat, Qt::ImageConversionFlags flags) { if (format == newFormat) @@ -5357,13 +5537,26 @@ static Q_CONSTEXPR QPixelFormat pixelformats[] = { /*PREMULTIPLIED*/ QPixelFormat::Premultiplied, /*INTERPRETATION*/ QPixelFormat::UnsignedShort, /*BYTE ORDER*/ QPixelFormat::CurrentSystemEndian), + //QImage::Format_Grayscale16: + QPixelFormat(QPixelFormat::Grayscale, + /*GRAY*/ 16, + /*SECOND*/ 0, + /*THIRD*/ 0, + /*FOURTH*/ 0, + /*FIFTH*/ 0, + /*ALPHA*/ 0, + /*ALPHA USAGE*/ QPixelFormat::IgnoresAlpha, + /*ALPHA POSITION*/ QPixelFormat::AtBeginning, + /*PREMULTIPLIED*/ QPixelFormat::NotPremultiplied, + /*INTERPRETATION*/ QPixelFormat::UnsignedShort, + /*BYTE ORDER*/ QPixelFormat::CurrentSystemEndian), }; Q_STATIC_ASSERT(sizeof(pixelformats) / sizeof(*pixelformats) == QImage::NImageFormats); /*! Returns the QImage::Format as a QPixelFormat */ -QPixelFormat QImage::pixelFormat() const Q_DECL_NOTHROW +QPixelFormat QImage::pixelFormat() const noexcept { return toPixelFormat(format()); } @@ -5371,7 +5564,7 @@ QPixelFormat QImage::pixelFormat() const Q_DECL_NOTHROW /*! Converts \a format into a QPixelFormat */ -QPixelFormat QImage::toPixelFormat(QImage::Format format) Q_DECL_NOTHROW +QPixelFormat QImage::toPixelFormat(QImage::Format format) noexcept { Q_ASSERT(static_cast<int>(format) < NImageFormats); return pixelformats[format]; @@ -5380,7 +5573,7 @@ QPixelFormat QImage::toPixelFormat(QImage::Format format) Q_DECL_NOTHROW /*! Converts \a format into a QImage::Format */ -QImage::Format QImage::toImageFormat(QPixelFormat format) Q_DECL_NOTHROW +QImage::Format QImage::toImageFormat(QPixelFormat format) noexcept { for (int i = 0; i < NImageFormats; i++) { if (format == pixelformats[i]) @@ -5396,7 +5589,7 @@ Q_GUI_EXPORT void qt_imageTransform(QImage &src, QImageIOHandler::Transformation if (orient == QImageIOHandler::TransformationRotate270) { src = rotated270(src); } else { - src = qMove(src).mirrored(orient & QImageIOHandler::TransformationMirror, + src = std::move(src).mirrored(orient & QImageIOHandler::TransformationMirror, orient & QImageIOHandler::TransformationFlip); if (orient & QImageIOHandler::TransformationRotate90) src = rotated90(src); diff --git a/src/gui/image/qimage.h b/src/gui/image/qimage.h index 4b7a3b1ead..9d177142d9 100644 --- a/src/gui/image/qimage.h +++ b/src/gui/image/qimage.h @@ -61,9 +61,11 @@ Q_FORWARD_DECLARE_MUTABLE_CG_TYPE(CGImage); QT_BEGIN_NAMESPACE +class QColorSpace; +class QColorTransform; class QIODevice; -class QStringList; class QMatrix; +class QStringList; class QTransform; class QVariant; template <class T> class QList; @@ -128,17 +130,14 @@ public: Format_RGBX64, Format_RGBA64, Format_RGBA64_Premultiplied, -#if 0 - // reserved for future use Format_Grayscale16, -#endif #ifndef Q_QDOC NImageFormats #endif }; Q_ENUM(Format) - QImage() Q_DECL_NOEXCEPT; + QImage() noexcept; QImage(const QSize &size, Format format); QImage(int width, int height, Format format); QImage(uchar *data, int width, int height, Format format, QImageCleanupFunction cleanupFunction = nullptr, void *cleanupInfo = nullptr); @@ -153,7 +152,7 @@ public: QImage(const QImage &); #ifdef Q_COMPILER_RVALUE_REFS - inline QImage(QImage &&other) Q_DECL_NOEXCEPT + inline QImage(QImage &&other) noexcept : QPaintDevice(), d(nullptr) { qSwap(d, other.d); } #endif @@ -161,10 +160,10 @@ public: QImage &operator=(const QImage &); #ifdef Q_COMPILER_RVALUE_REFS - inline QImage &operator=(QImage &&other) Q_DECL_NOEXCEPT + inline QImage &operator=(QImage &&other) noexcept { qSwap(d, other.d); return *this; } #endif - inline void swap(QImage &other) Q_DECL_NOEXCEPT + inline void swap(QImage &other) noexcept { qSwap(d, other.d); } bool isNull() const; @@ -199,6 +198,8 @@ public: Q_REQUIRED_RESULT QImage convertToFormat(Format f, const QVector<QRgb> &colorTable, Qt::ImageConversionFlags flags = Qt::AutoColor) const; bool reinterpretAsFormat(Format f); + void convertTo(Format f, Qt::ImageConversionFlags flags = Qt::AutoColor); + int width() const; int height() const; QSize size() const; @@ -227,7 +228,11 @@ public: uchar *scanLine(int); const uchar *scanLine(int) const; const uchar *constScanLine(int) const; +#if QT_VERSION >= QT_VERSION_CHECK(6,0,0) + qsizetype bytesPerLine() const; +#else int bytesPerLine() const; +#endif bool valid(int x, int y) const; bool valid(const QPoint &pt) const; @@ -286,17 +291,23 @@ public: QImage mirrored(bool horizontally = false, bool vertically = true) const & { return mirrored_helper(horizontally, vertically); } QImage &&mirrored(bool horizontally = false, bool vertically = true) && - { mirrored_inplace(horizontally, vertically); return qMove(*this); } + { mirrored_inplace(horizontally, vertically); return std::move(*this); } QImage rgbSwapped() const & { return rgbSwapped_helper(); } QImage &&rgbSwapped() && - { rgbSwapped_inplace(); return qMove(*this); } + { rgbSwapped_inplace(); return std::move(*this); } #else QImage mirrored(bool horizontally = false, bool vertically = true) const; QImage rgbSwapped() const; #endif void invertPixels(InvertMode = InvertRgb); + QColorSpace colorSpace() const; + QImage convertedToColorSpace(const QColorSpace &) const; + void convertToColorSpace(const QColorSpace &); + void setColorSpace(const QColorSpace &); + + void applyColorTransform(const QColorTransform &transform); bool load(QIODevice *device, const char* format); bool load(const QString &fileName, const char *format = nullptr); @@ -330,9 +341,9 @@ public: QString text(const QString &key = QString()) const; void setText(const QString &key, const QString &value); - QPixelFormat pixelFormat() const Q_DECL_NOTHROW; - static QPixelFormat toPixelFormat(QImage::Format format) Q_DECL_NOTHROW; - static QImage::Format toImageFormat(QPixelFormat format) Q_DECL_NOTHROW; + QPixelFormat pixelFormat() const noexcept; + static QPixelFormat toPixelFormat(QImage::Format format) noexcept; + static QImage::Format toImageFormat(QPixelFormat format) noexcept; // Platform specific conversion functions #if defined(Q_OS_DARWIN) || defined(Q_QDOC) diff --git a/src/gui/image/qimage_conversions.cpp b/src/gui/image/qimage_conversions.cpp index 964dc0d5c6..837ac88470 100644 --- a/src/gui/image/qimage_conversions.cpp +++ b/src/gui/image/qimage_conversions.cpp @@ -39,7 +39,7 @@ #include <private/qdrawhelper_p.h> #include <private/qguiapplication_p.h> -#include <private/qcolorprofile_p.h> +#include <private/qcolortrclut_p.h> #include <private/qendian_p.h> #include <private/qsimd_p.h> #include <private/qimage_p.h> @@ -100,7 +100,7 @@ const uchar *qt_get_bitflip_array() void qGamma_correct_back_to_linear_cs(QImage *image) { - const QColorProfile *cp = QGuiApplicationPrivate::instance()->colorProfileForA32Text(); + const QColorTrcLut *cp = QGuiApplicationPrivate::instance()->colorProfileForA32Text(); if (!cp) return; // gamma correct the pixels back to linear color space... @@ -223,18 +223,29 @@ void convert_generic(QImageData *dest, const QImageData *src, Qt::ImageConversio void convert_generic_to_rgb64(QImageData *dest, const QImageData *src, Qt::ImageConversionFlags) { - Q_ASSERT(dest->format == QImage::Format_RGBA64_Premultiplied); + Q_ASSERT(dest->format > QImage::Format_Indexed8); Q_ASSERT(src->format > QImage::Format_Indexed8); + QRgba64 buf[BufferSize]; + QRgba64 *buffer = buf; const QPixelLayout *srcLayout = &qPixelLayouts[src->format]; + const QPixelLayout *destLayout = &qPixelLayouts[dest->format]; const uchar *srcData = src->data; uchar *destData = dest->data; const FetchAndConvertPixelsFunc64 fetch = srcLayout->fetchToRGBA64PM; + const ConvertAndStorePixelsFunc64 store = qStoreFromRGBA64PM[dest->format]; for (int y = 0; y < src->height; ++y) { - const QRgba64 *ptr = fetch((QRgba64*)destData, srcData, 0, src->width, nullptr, nullptr); - if (ptr != (const QRgba64*)destData) { - memcpy(destData, ptr, dest->bytes_per_line); + int x = 0; + while (x < src->width) { + int l = src->width - x; + if (destLayout->bpp == QPixelLayout::BPP64) + buffer = reinterpret_cast<QRgba64 *>(destData) + x; + else + l = qMin(l, BufferSize); + const QRgba64 *ptr = fetch(buffer, srcData, x, l, nullptr, nullptr); + store(destData, ptr, x, l, nullptr, nullptr); + x += l; } srcData += src->bytes_per_line; destData += dest->bytes_per_line; @@ -817,10 +828,10 @@ static bool convert_indexed8_to_ARGB_PM_inplace(QImageData *data, Qt::ImageConve Q_ASSERT(data->own_data); const int depth = 32; - - const qsizetype dst_bytes_per_line = ((data->width * depth + 31) >> 5) << 2; - const qsizetype nbytes = dst_bytes_per_line * data->height; - uchar *const newData = (uchar *)realloc(data->data, nbytes); + auto params = QImageData::calculateImageParameters(data->width, data->height, depth); + if (params.bytesPerLine < 0) + return false; + uchar *const newData = (uchar *)realloc(data->data, params.totalSize); if (!newData) return false; @@ -828,10 +839,10 @@ static bool convert_indexed8_to_ARGB_PM_inplace(QImageData *data, Qt::ImageConve // start converting from the end because the end image is bigger than the source uchar *src_data = newData + data->nbytes; // end of src - quint32 *dest_data = (quint32 *) (newData + nbytes); // end of dest > end of src + quint32 *dest_data = (quint32 *) (newData + params.totalSize); // end of dest > end of src const int width = data->width; const int src_pad = data->bytes_per_line - width; - const int dest_pad = (dst_bytes_per_line >> 2) - width; + const int dest_pad = (params.bytesPerLine >> 2) - width; if (data->colortable.size() == 0) { data->colortable.resize(256); for (int i = 0; i < 256; ++i) @@ -858,9 +869,9 @@ static bool convert_indexed8_to_ARGB_PM_inplace(QImageData *data, Qt::ImageConve data->colortable = QVector<QRgb>(); data->format = QImage::Format_ARGB32_Premultiplied; - data->bytes_per_line = dst_bytes_per_line; + data->bytes_per_line = params.bytesPerLine; data->depth = depth; - data->nbytes = nbytes; + data->nbytes = params.totalSize; return true; } @@ -871,10 +882,10 @@ static bool convert_indexed8_to_ARGB_inplace(QImageData *data, Qt::ImageConversi Q_ASSERT(data->own_data); const int depth = 32; - - const qsizetype dst_bytes_per_line = ((data->width * depth + 31) >> 5) << 2; - const qsizetype nbytes = dst_bytes_per_line * data->height; - uchar *const newData = (uchar *)realloc(data->data, nbytes); + auto params = QImageData::calculateImageParameters(data->width, data->height, depth); + if (params.bytesPerLine < 0) + return false; + uchar *const newData = (uchar *)realloc(data->data, params.totalSize); if (!newData) return false; @@ -882,10 +893,10 @@ static bool convert_indexed8_to_ARGB_inplace(QImageData *data, Qt::ImageConversi // start converting from the end because the end image is bigger than the source uchar *src_data = newData + data->nbytes; - quint32 *dest_data = (quint32 *) (newData + nbytes); + quint32 *dest_data = (quint32 *) (newData + params.totalSize); const int width = data->width; const int src_pad = data->bytes_per_line - width; - const int dest_pad = (dst_bytes_per_line >> 2) - width; + const int dest_pad = (params.bytesPerLine >> 2) - width; if (data->colortable.size() == 0) { data->colortable.resize(256); for (int i = 0; i < 256; ++i) @@ -909,9 +920,9 @@ static bool convert_indexed8_to_ARGB_inplace(QImageData *data, Qt::ImageConversi data->colortable = QVector<QRgb>(); data->format = QImage::Format_ARGB32; - data->bytes_per_line = dst_bytes_per_line; + data->bytes_per_line = params.bytesPerLine; data->depth = depth; - data->nbytes = nbytes; + data->nbytes = params.totalSize; return true; } @@ -939,10 +950,10 @@ static bool convert_indexed8_to_RGB16_inplace(QImageData *data, Qt::ImageConvers Q_ASSERT(data->own_data); const int depth = 16; - - const qsizetype dst_bytes_per_line = ((data->width * depth + 31) >> 5) << 2; - const qsizetype nbytes = dst_bytes_per_line * data->height; - uchar *const newData = (uchar *)realloc(data->data, nbytes); + auto params = QImageData::calculateImageParameters(data->width, data->height, depth); + if (params.bytesPerLine < 0) + return false; + uchar *const newData = (uchar *)realloc(data->data, params.totalSize); if (!newData) return false; @@ -950,10 +961,10 @@ static bool convert_indexed8_to_RGB16_inplace(QImageData *data, Qt::ImageConvers // start converting from the end because the end image is bigger than the source uchar *src_data = newData + data->nbytes; - quint16 *dest_data = (quint16 *) (newData + nbytes); + quint16 *dest_data = (quint16 *) (newData + params.totalSize); const int width = data->width; const int src_pad = data->bytes_per_line - width; - const int dest_pad = (dst_bytes_per_line >> 1) - width; + const int dest_pad = (params.bytesPerLine >> 1) - width; quint16 colorTableRGB16[256]; const int tableSize = data->colortable.size(); @@ -983,9 +994,9 @@ static bool convert_indexed8_to_RGB16_inplace(QImageData *data, Qt::ImageConvers } data->format = QImage::Format_RGB16; - data->bytes_per_line = dst_bytes_per_line; + data->bytes_per_line = params.bytesPerLine; data->depth = depth; - data->nbytes = nbytes; + data->nbytes = params.totalSize; return true; } @@ -997,6 +1008,7 @@ static bool convert_RGB_to_RGB16_inplace(QImageData *data, Qt::ImageConversionFl const int depth = 16; + // cannot overflow, since we're shrinking the buffer const qsizetype dst_bytes_per_line = ((data->width * depth + 31) >> 5) << 2; const qsizetype src_bytes_per_line = data->bytes_per_line; quint32 *src_data = (quint32 *) data->data; @@ -1013,12 +1025,11 @@ static bool convert_RGB_to_RGB16_inplace(QImageData *data, Qt::ImageConversionFl data->depth = depth; data->nbytes = dst_bytes_per_line * data->height; uchar *const newData = (uchar *)realloc(data->data, data->nbytes); - if (newData) { + if (newData) data->data = newData; - return true; - } else { - return false; - } + + // can't fail, since we're shrinking + return true; } static void convert_ARGB_PM_to_ARGB(QImageData *dest, const QImageData *src) @@ -1205,33 +1216,6 @@ static void convert_RGBA64_to_ARGB32(QImageData *dest, const QImageData *src, Qt } template<bool RGBA> -static void convert_RGBA64PM_to_ARGB32(QImageData *dest, const QImageData *src, Qt::ImageConversionFlags) -{ - Q_ASSERT(src->format == QImage::Format_RGBA64_Premultiplied); - Q_ASSERT(RGBA || dest->format == QImage::Format_ARGB32); - Q_ASSERT(!RGBA || dest->format == QImage::Format_RGBA8888); - Q_ASSERT(src->width == dest->width); - Q_ASSERT(src->height == dest->height); - - const int src_pad = (src->bytes_per_line >> 3) - src->width; - const int dest_pad = (dest->bytes_per_line >> 2) - dest->width; - const QRgba64 *src_data = reinterpret_cast<const QRgba64 *>(src->data); - uint *dest_data = reinterpret_cast<uint *>(dest->data); - - for (int i = 0; i < src->height; ++i) { - const QRgba64 *end = src_data + src->width; - while (src_data < end) { - QRgba64 s = src_data->unpremultiplied(); - *dest_data = RGBA ? ARGB2RGBA(s.toArgb32()) : s.toArgb32(); - ++src_data; - ++dest_data; - } - src_data += src_pad; - dest_data += dest_pad; - } -} - -template<bool RGBA> static void convert_ARGB32_to_RGBA64(QImageData *dest, const QImageData *src, Qt::ImageConversionFlags) { Q_ASSERT(RGBA || src->format == QImage::Format_ARGB32); @@ -1240,74 +1224,14 @@ static void convert_ARGB32_to_RGBA64(QImageData *dest, const QImageData *src, Qt Q_ASSERT(src->width == dest->width); Q_ASSERT(src->height == dest->height); - const int src_pad = (src->bytes_per_line >> 2) - src->width; - const int dest_pad = (dest->bytes_per_line >> 3) - dest->width; - const uint *src_data = reinterpret_cast<const uint *>(src->data); - QRgba64 *dest_data = reinterpret_cast<QRgba64 *>(dest->data); - - for (int i = 0; i < src->height; ++i) { - const uint *end = src_data + src->width; - while (src_data < end) { - if (RGBA) - *dest_data = QRgba64::fromArgb32(RGBA2ARGB(*src_data)); - else - *dest_data = QRgba64::fromArgb32(*src_data); - ++src_data; - ++dest_data; - } - src_data += src_pad; - dest_data += dest_pad; - } -} - -template<QtPixelOrder PixelOrder> -static void convert_RGBA64PM_to_RGB30(QImageData *dest, const QImageData *src, Qt::ImageConversionFlags) -{ - Q_ASSERT(src->format == QImage::Format_RGBA64_Premultiplied); - Q_ASSERT(dest->format == QImage::Format_RGB30 || dest->format == QImage::Format_BGR30); - Q_ASSERT(src->width == dest->width); - Q_ASSERT(src->height == dest->height); - - const int src_pad = (src->bytes_per_line >> 3) - src->width; - const int dest_pad = (dest->bytes_per_line >> 2) - dest->width; - const QRgba64 *src_data = reinterpret_cast<const QRgba64 *>(src->data); - uint *dest_data = reinterpret_cast<uint *>(dest->data); - - for (int i = 0; i < src->height; ++i) { - const QRgba64 *end = src_data + src->width; - while (src_data < end) { - *dest_data = 0xc0000000 | qConvertRgb64ToRgb30<PixelOrder>(src_data->unpremultiplied()); - ++src_data; - ++dest_data; - } - src_data += src_pad; - dest_data += dest_pad; - } -} - -template<QtPixelOrder PixelOrder> -static void convert_RGBA64PM_to_A2RGB30(QImageData *dest, const QImageData *src, Qt::ImageConversionFlags) -{ - Q_ASSERT(src->format == QImage::Format_RGBA64_Premultiplied); - Q_ASSERT(dest->format == QImage::Format_A2RGB30_Premultiplied - || dest->format == QImage::Format_A2BGR30_Premultiplied); - Q_ASSERT(src->width == dest->width); - Q_ASSERT(src->height == dest->height); - - const int src_pad = (src->bytes_per_line >> 3) - src->width; - const int dest_pad = (dest->bytes_per_line >> 2) - dest->width; - const QRgba64 *src_data = reinterpret_cast<const QRgba64 *>(src->data); - uint *dest_data = reinterpret_cast<uint *>(dest->data); + const uchar *src_data = src->data; + uchar *dest_data = dest->data; + const FetchAndConvertPixelsFunc64 fetch = qPixelLayouts[src->format + 1].fetchToRGBA64PM; for (int i = 0; i < src->height; ++i) { - const QRgba64 *end = src_data + src->width; - while (src_data < end) { - *dest_data = qConvertRgb64ToRgb30<PixelOrder>(*src_data); - ++src_data; - ++dest_data; - } - src_data += src_pad; - dest_data += dest_pad; + fetch(reinterpret_cast<QRgba64 *>(dest_data), src_data, 0, src->width, nullptr, nullptr); + src_data += src->bytes_per_line;; + dest_data += dest->bytes_per_line; } } @@ -1447,6 +1371,56 @@ static bool convert_RGBA64PM_to_RGBA64_inplace(QImageData *data, Qt::ImageConver return true; } +static void convert_gray16_to_RGBA64(QImageData *dest, const QImageData *src, Qt::ImageConversionFlags) +{ + Q_ASSERT(src->format == QImage::Format_Grayscale16); + Q_ASSERT(dest->format == QImage::Format_RGBA64 || dest->format == QImage::Format_RGBX64 || + dest->format == QImage::Format_RGBA64_Premultiplied); + Q_ASSERT(src->width == dest->width); + Q_ASSERT(src->height == dest->height); + + const qsizetype sbpl = src->bytes_per_line; + const qsizetype dbpl = dest->bytes_per_line; + const uchar *src_data = src->data; + uchar *dest_data = dest->data; + + for (int i = 0; i < src->height; ++i) { + const quint16 *src_line = reinterpret_cast<const quint16 *>(src_data); + QRgba64 *dest_line = reinterpret_cast<QRgba64 *>(dest_data); + for (int j = 0; j < src->width; ++j) { + quint16 s = src_line[j]; + dest_line[j] = qRgba64(s, s, s, 0xFFFF); + } + src_data += sbpl; + dest_data += dbpl; + } +} + +static void convert_RGBA64_to_gray16(QImageData *dest, const QImageData *src, Qt::ImageConversionFlags) +{ + Q_ASSERT(dest->format == QImage::Format_Grayscale16); + Q_ASSERT(src->format == QImage::Format_RGBX64 || + src->format == QImage::Format_RGBA64_Premultiplied); + Q_ASSERT(src->width == dest->width); + Q_ASSERT(src->height == dest->height); + + const qsizetype sbpl = src->bytes_per_line; + const qsizetype dbpl = dest->bytes_per_line; + const uchar *src_data = src->data; + uchar *dest_data = dest->data; + + for (int i = 0; i < src->height; ++i) { + const QRgba64 *src_line = reinterpret_cast<const QRgba64 *>(src_data); + quint16 *dest_line = reinterpret_cast<quint16 *>(dest_data); + for (int j = 0; j < src->width; ++j) { + QRgba64 s = src_line[j].unpremultiplied(); + dest_line[j] = qGray(s.red(), s.green(), s.blue()); + } + src_data += sbpl; + dest_data += dbpl; + } +} + static QVector<QRgb> fix_color_table(const QVector<QRgb> &ctbl, QImage::Format format) { QVector<QRgb> colorTable = ctbl; @@ -2291,7 +2265,7 @@ static bool convert_Grayscale8_to_Indexed8_inplace(QImageData *data, Qt::ImageCo Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormats] = { { - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, { 0, @@ -2312,7 +2286,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_Mono { @@ -2334,7 +2308,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_MonoLSB { @@ -2359,7 +2333,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, 0, 0, convert_Indexed8_to_Alpha8, convert_Indexed8_to_Grayscale8, - 0, 0, 0 + 0, 0, 0, 0 }, // Format_Indexed8 { @@ -2387,7 +2361,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat convert_RGB_to_RGB30<PixelOrderRGB, false>, 0, 0, 0, - 0, 0, 0 + 0, 0, 0, 0 }, // Format_RGB32 { @@ -2417,7 +2391,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, convert_ARGB32_to_RGBA64<false>, - 0 + 0, 0 }, // Format_ARGB32 { @@ -2442,7 +2416,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat convert_ARGB_to_RGBA, 0, 0, 0, 0, 0, 0, - 0, 0, 0 + 0, 0, 0, 0 }, // Format_ARGB32_Premultiplied { @@ -2464,7 +2438,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_RGB16 { @@ -2486,7 +2460,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_ARGB8565_Premultiplied { @@ -2508,7 +2482,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_RGB666 { @@ -2530,7 +2504,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_ARGB6666_Premultiplied { @@ -2552,7 +2526,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_RGB555 { @@ -2574,7 +2548,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_ARGB8555_Premultiplied { @@ -2597,7 +2571,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat convert_RGB888_to_RGB<true>, convert_RGB888_to_RGB<true>, convert_RGB888_to_RGB<true>, - 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_RGB888 { @@ -2619,7 +2593,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_RGB444 { @@ -2640,7 +2614,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_ARGB4444_Premultiplied { 0, @@ -2667,7 +2641,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat convert_RGB_to_RGB30<PixelOrderRGB, true>, 0, 0, 0, - 0, 0, 0 + 0, 0, 0, 0 }, // Format_RGBX8888 { 0, @@ -2696,7 +2670,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, convert_ARGB32_to_RGBA64<true>, - 0 + 0, 0 }, // Format_RGBA8888 { @@ -2718,7 +2692,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_RGBA8888_Premultiplied { @@ -2746,7 +2720,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat convert_BGR30_to_RGB30, convert_BGR30_to_RGB30, 0, 0, - 0, 0, 0 + 0, 0, 0, 0 }, // Format_BGR30 { 0, @@ -2773,8 +2747,8 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat convert_A2RGB30_PM_to_RGB30<true>, convert_BGR30_to_RGB30, 0, 0, - 0, 0, 0 - }, // Format_BGR30A2_Premultiplied + 0, 0, 0, 0 + }, // Format_A2BGR30_Premultiplied { 0, 0, @@ -2799,7 +2773,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat convert_BGR30_to_RGB30, 0, convert_passthrough, - 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0 }, // Format_RGB30 { 0, @@ -2826,8 +2800,8 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat convert_A2RGB30_PM_to_RGB30<false>, 0, 0, 0, - 0, 0, 0 - }, // Format_RGB30A2_Premultiplied + 0, 0, 0, 0 + }, // Format_A2RGB30_Premultiplied { 0, 0, @@ -2846,7 +2820,7 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_Alpha8 { 0, @@ -2872,7 +2846,8 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, // self convert_passthrough, - convert_passthrough + convert_passthrough, + convert_RGBA64_to_gray16 }, // Format_RGBX64 { 0, @@ -2898,7 +2873,8 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, convert_RGBA64_to_RGBx64, 0, // self - convert_RGBA64_to_RGBA64PM + convert_RGBA64_to_RGBA64PM, + 0 }, // Format_RGBA64 { 0, @@ -2906,7 +2882,6 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - convert_RGBA64PM_to_ARGB32<false>, 0, 0, 0, @@ -2918,29 +2893,58 @@ Image_Converter qimage_converter_map[QImage::NImageFormats][QImage::NImageFormat 0, 0, 0, - convert_RGBA64PM_to_ARGB32<true>, 0, - convert_RGBA64PM_to_RGB30<PixelOrderBGR>, - convert_RGBA64PM_to_A2RGB30<PixelOrderBGR>, - convert_RGBA64PM_to_RGB30<PixelOrderRGB>, - convert_RGBA64PM_to_A2RGB30<PixelOrderRGB>, + 0, + 0, + 0, 0, 0, 0, 0, 0, convert_RGBA64PM_to_RGBA64<true>, convert_RGBA64PM_to_RGBA64<false>, - 0 // self - } // Format_RGBA64_Premultiplied + 0, // self + convert_RGBA64_to_gray16 + }, // Format_RGBA64_Premultiplied + { + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, + 0, 0, + convert_gray16_to_RGBA64, + convert_gray16_to_RGBA64, + convert_gray16_to_RGBA64, + 0 // self + }, // Format_Grayscale16 }; InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QImage::NImageFormats] = { { - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, { - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_Mono { - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_MonoLSB { 0, @@ -2964,7 +2968,7 @@ InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QIma 0, 0, 0, 0, 0, convert_Indexed8_to_Alpha8_inplace, convert_Indexed8_to_Grayscale8_inplace, - 0, 0, 0 + 0, 0, 0, 0 }, // Format_Indexed8 { 0, @@ -2991,7 +2995,7 @@ InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QIma convert_RGB_to_RGB30_inplace<PixelOrderRGB, false>, 0, 0, 0, - 0, 0, 0 + 0, 0, 0, 0 }, // Format_RGB32 { 0, @@ -3018,7 +3022,7 @@ InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QIma convert_RGB_to_RGB30_inplace<PixelOrderRGB, false>, 0, 0, 0, - 0, 0, 0 + 0, 0, 0, 0 }, // Format_ARGB32 { 0, @@ -3042,34 +3046,34 @@ InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QIma convert_ARGB_to_RGBA_inplace<QImage::Format_RGBA8888_Premultiplied>, 0, 0, 0, 0, 0, 0, - 0, 0, 0 + 0, 0, 0, 0 }, // Format_ARGB32_Premultiplied { - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_RGB16 { - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_ARGB8565_Premultiplied { - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_RGB666 { - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_ARGB6666_Premultiplied { - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_RGB555 { - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_ARGB8555_Premultiplied { - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_RGB888 { - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_RGB444 { - 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_ARGB4444_Premultiplied { 0, @@ -3096,7 +3100,7 @@ InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QIma convert_RGB_to_RGB30_inplace<PixelOrderRGB, true>, 0, 0, 0, - 0, 0, 0 + 0, 0, 0, 0 }, // Format_RGBX8888 { 0, @@ -3123,7 +3127,7 @@ InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QIma convert_RGB_to_RGB30_inplace<PixelOrderRGB, true>, 0, 0, 0, - 0, 0, 0 + 0, 0, 0, 0 }, // Format_RGBA8888 { 0, @@ -3145,7 +3149,7 @@ InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QIma 0, 0, 0, - 0, 0, 0, 0, 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }, // Format_RGBA8888_Premultiplied { 0, @@ -3172,7 +3176,7 @@ InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QIma convert_BGR30_to_RGB30_inplace, convert_BGR30_to_A2RGB30_inplace, 0, 0, - 0, 0, 0 + 0, 0, 0, 0 }, // Format_BGR30 { 0, @@ -3198,8 +3202,8 @@ InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QIma 0, // self convert_A2RGB30_PM_to_RGB30_inplace<true>, convert_BGR30_to_RGB30_inplace, - 0, 0, 0, 0, 0 - }, // Format_BGR30A2_Premultiplied + 0, 0, 0, 0, 0, 0 + }, // Format_A2BGR30_Premultiplied { 0, 0, @@ -3224,7 +3228,7 @@ InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QIma convert_BGR30_to_A2RGB30_inplace, 0, // self convert_passthrough_inplace<QImage::Format_A2RGB30_Premultiplied>, - 0, 0, 0, 0, 0 + 0, 0, 0, 0, 0, 0 }, // Format_RGB30 { 0, @@ -3251,8 +3255,8 @@ InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QIma convert_A2RGB30_PM_to_RGB30_inplace<false>, 0, // self 0, 0, - 0, 0, 0 - }, // Format_RGB30A2_Premultiplied + 0, 0, 0, 0 + }, // Format_A2RGB30_Premultiplied { 0, 0, @@ -3276,7 +3280,7 @@ InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QIma 0, 0, 0, 0, 0, // self 0, - 0, 0, 0 + 0, 0, 0, 0 }, // Format_Alpha8 { 0, @@ -3301,26 +3305,32 @@ InPlace_Image_Converter qimage_inplace_converter_map[QImage::NImageFormats][QIma 0, 0, 0, 0, 0, 0, // self - 0, 0, 0 + 0, 0, 0, 0 }, // Format_Grayscale8 { 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, // self convert_passthrough_inplace<QImage::Format_RGBA64>, convert_passthrough_inplace<QImage::Format_RGBA64_Premultiplied>, + 0 }, // Format_RGBX64 { 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, convert_RGBA64_to_RGBx64_inplace, 0, // self - convert_RGBA64_to_RGBA64PM_inplace + convert_RGBA64_to_RGBA64PM_inplace, + 0 }, // Format_RGBA64 { 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, convert_RGBA64PM_to_RGBA64_inplace<true>, convert_RGBA64PM_to_RGBA64_inplace<false>, - 0 // self - } // Format_RGBA64_Premultiplied + 0, // self + 0 + }, // Format_RGBA64_Premultiplied + { + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 + }, // Format_Grayscale16 }; static void qInitImageConversions() diff --git a/src/gui/image/qimage_darwin.mm b/src/gui/image/qimage_darwin.mm index a5c391ad21..7ca1a0869a 100644 --- a/src/gui/image/qimage_darwin.mm +++ b/src/gui/image/qimage_darwin.mm @@ -40,6 +40,7 @@ #include "qimage.h" #include <private/qcore_mac_p.h> +#include <private/qcoregraphics_p.h> #import <Foundation/Foundation.h> #import <CoreGraphics/CoreGraphics.h> @@ -98,32 +99,10 @@ CGImageRef QImage::toCGImage() const if (isNull()) return nil; - // Determine the target native format - uint cgflags = kCGImageAlphaNone; - switch (format()) { - case QImage::Format_ARGB32: - cgflags = kCGImageAlphaFirst | kCGBitmapByteOrder32Host; - break; - case QImage::Format_RGB32: - cgflags = kCGImageAlphaNoneSkipFirst | kCGBitmapByteOrder32Host; - break; - case QImage::Format_RGBA8888_Premultiplied: - cgflags = kCGImageAlphaPremultipliedLast | kCGBitmapByteOrder32Big; - break; - case QImage::Format_RGBA8888: - cgflags = kCGImageAlphaLast | kCGBitmapByteOrder32Big; - break; - case QImage::Format_RGBX8888: - cgflags = kCGImageAlphaNoneSkipLast | kCGBitmapByteOrder32Big; - break; - case QImage::Format_ARGB32_Premultiplied: - cgflags = kCGImageAlphaPremultipliedFirst | kCGBitmapByteOrder32Host; - break; - default: break; - } + CGBitmapInfo bitmapInfo = qt_mac_bitmapInfoForImage(*this); // Format not supported: return nil CGImageRef - if (cgflags == kCGImageAlphaNone) + if (bitmapInfo == kCGImageAlphaNone) return nil; // Create a data provider that owns a copy of the QImage and references the image data. @@ -140,7 +119,7 @@ CGImageRef QImage::toCGImage() const const bool shouldInterpolate = false; return CGImageCreate(width(), height(), bitsPerComponent, bitsPerPixel, - this->bytesPerLine(), colorSpace, cgflags, dataProvider, + this->bytesPerLine(), colorSpace, bitmapInfo, dataProvider, decode, shouldInterpolate, kCGRenderingIntentDefault); } diff --git a/src/gui/image/qimage_neon.cpp b/src/gui/image/qimage_neon.cpp index 57a24edeca..9dbcb11db5 100644 --- a/src/gui/image/qimage_neon.cpp +++ b/src/gui/image/qimage_neon.cpp @@ -52,65 +52,41 @@ Q_GUI_EXPORT void QT_FASTCALL qt_convert_rgb888_to_rgb32_neon(quint32 *dst, cons const quint32 *const end = dst + len; - // align dst on 64 bits - const int offsetToAlignOn8Bytes = (reinterpret_cast<quintptr>(dst) >> 2) & 0x1; - for (int i = 0; i < offsetToAlignOn8Bytes; ++i) { + // align dst on 128 bits + const int offsetToAlignOn16Bytes = (reinterpret_cast<quintptr>(dst) >> 2) & 0x3; + for (int i = 0; i < offsetToAlignOn16Bytes; ++i) { *dst++ = qRgb(src[0], src[1], src[2]); src += 3; } - if ((len - offsetToAlignOn8Bytes) >= 8) { - const quint32 *const simdEnd = end - 7; -#if !defined(Q_PROCESSOR_ARM_64) - register uint8x8_t fullVector asm ("d3") = vdup_n_u8(0xff); - do { + if ((len - offsetToAlignOn16Bytes) >= 16) { + const quint32 *const simdEnd = end - 15; + uint8x16x4_t dstVector; #if Q_BYTE_ORDER == Q_BIG_ENDIAN - asm volatile ( - "vld3.8 { d4, d5, d6 }, [%[SRC]] !\n\t" - "vst4.8 { d3, d4, d5, d6 }, [%[DST],:64] !\n\t" - : [DST]"+r" (dst), [SRC]"+r" (src) - : "w"(fullVector) - : "memory", "d4", "d5", "d6" - ); + dstVector.val[0] = vdupq_n_u8(0xff); #else - asm volatile ( - "vld3.8 { d0, d1, d2 }, [%[SRC]] !\n\t" - "vswp d0, d2\n\t" - "vst4.8 { d0, d1, d2, d3 }, [%[DST],:64] !\n\t" - : [DST]"+r" (dst), [SRC]"+r" (src) - : "w"(fullVector) - : "memory", "d0", "d1", "d2" - ); + dstVector.val[3] = vdupq_n_u8(0xff); #endif - } while (dst < simdEnd); -#else - register uint8x8_t fullVector asm ("v3") = vdup_n_u8(0xff); do { + uint8x16x3_t srcVector = vld3q_u8(src); + src += 3 * 16; #if Q_BYTE_ORDER == Q_BIG_ENDIAN - asm volatile ( - "ld3 { v4.8b, v5.8b, v6.8b }, [%[SRC]], #24 \n\t" - "st4 { v3.8b, v4.8b, v5.8b, v6.8b }, [%[DST]], #32 \n\t" - : [DST]"+r" (dst), [SRC]"+r" (src) - : "w"(fullVector) - : "memory", "v4", "v5", "v6" - ); + dstVector.val[1] = srcVector.val[0]; + dstVector.val[2] = srcVector.val[1]; + dstVector.val[3] = srcVector.val[2]; #else - asm volatile ( - "ld3 { v0.8b, v1.8b, v2.8b }, [%[SRC]], #24 \n\t" - "mov v4.8b, v2.8b\n\t" - "mov v2.8b, v0.8b\n\t" - "mov v0.8b, v4.8b\n\t" - "st4 { v0.8b, v1.8b, v2.8b, v3.8b }, [%[DST]], #32 \n\t" - : [DST]"+r" (dst), [SRC]"+r" (src) - : "w"(fullVector) - : "memory", "v0", "v1", "v2", "v4" - ); + dstVector.val[0] = srcVector.val[2]; + dstVector.val[1] = srcVector.val[1]; + dstVector.val[2] = srcVector.val[0]; #endif + vst4q_u8(reinterpret_cast<uint8_t*>(dst), dstVector); + dst += 16; } while (dst < simdEnd); -#endif } - while (dst != end) { + int i = 0; + int length = end - dst; + SIMD_EPILOGUE(i, length, 15) { *dst++ = qRgb(src[0], src[1], src[2]); src += 3; } diff --git a/src/gui/image/qimage_p.h b/src/gui/image/qimage_p.h index 2fe29a88d3..9da6acd0a7 100644 --- a/src/gui/image/qimage_p.h +++ b/src/gui/image/qimage_p.h @@ -51,7 +51,10 @@ // We mean it. // +#include <QtGui/qcolorspace.h> #include <QtGui/private/qtguiglobal_p.h> +#include <QtGui/qimage.h> +#include <QtCore/private/qnumeric_p.h> #include <QMap> #include <QVector> @@ -64,7 +67,7 @@ struct Q_GUI_EXPORT QImageData { // internal image data QImageData(); ~QImageData(); static QImageData *create(const QSize &size, QImage::Format format); - static QImageData *create(uchar *data, int w, int h, int bpl, QImage::Format format, bool readOnly, QImageCleanupFunction cleanupFunction = 0, void *cleanupInfo = 0); + static QImageData *create(uchar *data, int w, int h, int bpl, QImage::Format format, bool readOnly, QImageCleanupFunction cleanupFunction = nullptr, void *cleanupInfo = nullptr); QAtomicInt ref; @@ -104,8 +107,48 @@ struct Q_GUI_EXPORT QImageData { // internal image data bool doImageIO(const QImage *image, QImageWriter* io, int quality) const; QPaintEngine *paintEngine; + + QColorSpace colorSpace; + + struct ImageSizeParameters { + qsizetype bytesPerLine; + qsizetype totalSize; + bool isValid() const { return bytesPerLine > 0 && totalSize > 0; } + }; + static ImageSizeParameters calculateImageParameters(qsizetype width, qsizetype height, qsizetype depth); }; +inline QImageData::ImageSizeParameters +QImageData::calculateImageParameters(qsizetype width, qsizetype height, qsizetype depth) +{ + ImageSizeParameters invalid = { -1, -1 }; + if (height <= 0) + return invalid; + + // calculate the size, taking care of overflows + qsizetype bytes_per_line; + if (mul_overflow(width, depth, &bytes_per_line)) + return invalid; + if (add_overflow(bytes_per_line, qsizetype(31), &bytes_per_line)) + return invalid; + // bytes per scanline (must be multiple of 4) + bytes_per_line = (bytes_per_line >> 5) << 2; // can't overflow + + qsizetype total_size; + if (mul_overflow(height, bytes_per_line, &total_size)) + return invalid; + qsizetype dummy; + if (mul_overflow(height, qsizetype(sizeof(uchar *)), &dummy)) + return invalid; // why is this here? +#if QT_VERSION < QT_VERSION_CHECK(6,0,0) + // Disallow images where width * depth calculations might overflow + if (width > (INT_MAX - 31) / depth) + return invalid; +#endif + + return { bytes_per_line, total_size }; +} + typedef void (*Image_Converter)(QImageData *dest, const QImageData *src, Qt::ImageConversionFlags); typedef bool (*InPlace_Image_Converter)(QImageData *data, Qt::ImageConversionFlags); @@ -156,6 +199,7 @@ inline int qt_depthForFormat(QImage::Format format) case QImage::Format_RGB16: case QImage::Format_RGB444: case QImage::Format_ARGB4444_Premultiplied: + case QImage::Format_Grayscale16: depth = 16; break; case QImage::Format_RGB666: diff --git a/src/gui/image/qimageiohandler.cpp b/src/gui/image/qimageiohandler.cpp index 5d1f8fa91f..0e7b541cf2 100644 --- a/src/gui/image/qimageiohandler.cpp +++ b/src/gui/image/qimageiohandler.cpp @@ -340,7 +340,7 @@ void QImageIOHandler::setDevice(QIODevice *device) /*! Returns the device currently assigned to the QImageIOHandler. If - not device has been assigned, 0 is returned. + not device has been assigned, \nullptr is returned. */ QIODevice *QImageIOHandler::device() const { @@ -416,6 +416,7 @@ QByteArray QImageIOHandler::format() const \sa read(), QIODevice::peek() */ +#if QT_DEPRECATED_SINCE(5, 13) /*! \obsolete @@ -426,6 +427,7 @@ QByteArray QImageIOHandler::name() const { return format(); } +#endif /*! Writes the image \a image to the assigned device. Returns \c true on diff --git a/src/gui/image/qimageiohandler.h b/src/gui/image/qimageiohandler.h index 990df96534..c20b84afbb 100644 --- a/src/gui/image/qimageiohandler.h +++ b/src/gui/image/qimageiohandler.h @@ -69,7 +69,10 @@ public: void setFormat(const QByteArray &format) const; QByteArray format() const; +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use QImageIOHandler::format() instead") virtual QByteArray name() const; +#endif virtual bool canRead() const = 0; virtual bool read(QImage *image) = 0; diff --git a/src/gui/image/qimagereader.cpp b/src/gui/image/qimagereader.cpp index 6d358984d6..61f20e0c65 100644 --- a/src/gui/image/qimagereader.cpp +++ b/src/gui/image/qimagereader.cpp @@ -165,6 +165,7 @@ #endif #include <private/qimagereaderwriterhelpers_p.h> +#include <qtgui_tracepoints_p.h> #include <algorithm> @@ -525,7 +526,7 @@ bool QImageReaderPrivate::initHandler() // Try the most probable extension first int currentFormatIndex = extensions.indexOf(format.toLower()); if (currentFormatIndex > 0) - extensions.swap(0, currentFormatIndex); + extensions.swapItemsAt(0, currentFormatIndex); } int currentExtension = 0; @@ -755,13 +756,13 @@ void QImageReader::setDevice(QIODevice *device) d->device = device; d->deleteDevice = false; delete d->handler; - d->handler = 0; + d->handler = nullptr; d->text.clear(); } /*! - Returns the device currently assigned to QImageReader, or 0 if no - device has been assigned. + Returns the device currently assigned to QImageReader, or \nullptr + if no device has been assigned. */ QIODevice *QImageReader::device() const { @@ -1250,7 +1251,18 @@ bool QImageReader::read(QImage *image) d->handler->setOption(QImageIOHandler::Quality, d->quality); // read the image - if (!d->handler->read(image)) { + if (Q_TRACE_ENABLED(QImageReader_read_before_reading)) { + QString fileName = QStringLiteral("unknown"); + if (QFile *file = qobject_cast<QFile *>(d->device)) + fileName = file->fileName(); + Q_TRACE(QImageReader_read_before_reading, this, fileName); + } + + const bool result = d->handler->read(image); + + Q_TRACE(QImageReader_read_after_reading, this, result); + + if (!result) { d->imageReaderError = InvalidDataError; d->errorString = QImageReader::tr("Unable to read image data"); return false; diff --git a/src/gui/image/qimagewriter.cpp b/src/gui/image/qimagewriter.cpp index 5ce7e309bb..ec66588ddf 100644 --- a/src/gui/image/qimagewriter.cpp +++ b/src/gui/image/qimagewriter.cpp @@ -71,6 +71,16 @@ formats, in addition to any image format plugins that support writing. + \note QImageWriter assumes exclusive control over the file or + device that is assigned. Any attempts to modify the assigned file + or device during the lifetime of the QImageWriter object will + yield undefined results. If immediate access to a resource is + desired, the use of a scope is the recommended method. + + For example: + + \snippet qimagewriter/main.cpp 0 + \sa QImageReader, QImageIOHandler, QImageIOPlugin */ @@ -397,8 +407,8 @@ void QImageWriter::setDevice(QIODevice *device) } /*! - Returns the device currently assigned to QImageWriter, or 0 if no - device has been assigned. + Returns the device currently assigned to QImageWriter, or \nullptr + if no device has been assigned. */ QIODevice *QImageWriter::device() const { @@ -638,6 +648,7 @@ QImageIOHandler::Transformations QImageWriter::transformation() const return d->transformation; } +#if QT_DEPRECATED_SINCE(5, 13) /*! \obsolete @@ -669,6 +680,7 @@ QString QImageWriter::description() const { return d->description; } +#endif /*! \since 4.1 diff --git a/src/gui/image/qimagewriter.h b/src/gui/image/qimagewriter.h index 29c06ccdd2..ef84a59b7c 100644 --- a/src/gui/image/qimagewriter.h +++ b/src/gui/image/qimagewriter.h @@ -100,9 +100,12 @@ public: QImageIOHandler::Transformations transformation() const; void setTransformation(QImageIOHandler::Transformations orientation); - // Obsolete as of 4.1 +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use QImageWriter::setText() instead") void setDescription(const QString &description); + QT_DEPRECATED_X("Use QImageReader::text() instead") QString description() const; +#endif void setText(const QString &key, const QString &text); diff --git a/src/gui/image/qmovie.cpp b/src/gui/image/qmovie.cpp index 010760de4c..79203c7b98 100644 --- a/src/gui/image/qmovie.cpp +++ b/src/gui/image/qmovie.cpp @@ -379,7 +379,7 @@ QFrameInfo QMoviePrivate::infoForFrame(int frameNumber) } if (frameNumber > greatestFrameNumber) greatestFrameNumber = frameNumber; - QPixmap aPixmap = QPixmap::fromImage(anImage); + QPixmap aPixmap = QPixmap::fromImage(std::move(anImage)); int aDelay = reader->nextImageDelay(); return QFrameInfo(aPixmap, aDelay); } else if (frameNumber != 0) { @@ -405,7 +405,7 @@ QFrameInfo QMoviePrivate::infoForFrame(int frameNumber) return QFrameInfo(); // Invalid } greatestFrameNumber = i; - QPixmap aPixmap = QPixmap::fromImage(anImage); + QPixmap aPixmap = QPixmap::fromImage(std::move(anImage)); int aDelay = reader->nextImageDelay(); QFrameInfo info(aPixmap, aDelay); // Cache it! @@ -659,7 +659,7 @@ void QMovie::setDevice(QIODevice *device) /*! Returns the device QMovie reads image data from. If no device has - currently been assigned, 0 is returned. + currently been assigned, \nullptr is returned. \sa setDevice(), fileName() */ diff --git a/src/gui/image/qpaintengine_pic_p.h b/src/gui/image/qpaintengine_pic_p.h index c3044796ad..c9e4b43197 100644 --- a/src/gui/image/qpaintengine_pic_p.h +++ b/src/gui/image/qpaintengine_pic_p.h @@ -103,7 +103,7 @@ protected: QPicturePaintEngine(QPaintEnginePrivate &dptr); private: - Q_DISABLE_COPY(QPicturePaintEngine) + Q_DISABLE_COPY_MOVE(QPicturePaintEngine) void writeCmdLength(int pos, const QRectF &r, bool corr); }; diff --git a/src/gui/image/qpicture.cpp b/src/gui/image/qpicture.cpp index 7aa221948e..56b82abcfa 100644 --- a/src/gui/image/qpicture.cpp +++ b/src/gui/image/qpicture.cpp @@ -636,7 +636,7 @@ bool QPicture::exec(QPainter *painter, QDataStream &s, int nrecords) if (d->formatMajor <= 5) { s >> ia >> i_8; painter->drawPolygon(ia, i_8 ? Qt::WindingFill : Qt::OddEvenFill); - a.clear(); + ia.clear(); } else { s >> a >> i_8; painter->drawPolygon(a, i_8 ? Qt::WindingFill : Qt::OddEvenFill); @@ -647,10 +647,10 @@ bool QPicture::exec(QPainter *painter, QDataStream &s, int nrecords) s >> ia; QPainterPath path; Q_ASSERT(ia.size() == 4); - path.moveTo(ia.at(0)); - path.cubicTo(ia.at(1), ia.at(2), ia.at(3)); + path.moveTo(ia.value(0)); + path.cubicTo(ia.value(1), ia.value(2), ia.value(3)); painter->strokePath(path, painter->pen()); - a.clear(); + ia.clear(); } break; case QPicturePrivate::PdcDrawText: @@ -730,7 +730,7 @@ bool QPicture::exec(QPainter *painter, QDataStream &s, int nrecords) int index; s >> r >> index >> sr; Q_ASSERT(index < d->pixmap_list.size()); - pixmap = d->pixmap_list.at(index); + pixmap = d->pixmap_list.value(index); } else { s >> r >> pixmap >> sr; } @@ -744,7 +744,7 @@ bool QPicture::exec(QPainter *painter, QDataStream &s, int nrecords) int index; s >> r >> index >> p; Q_ASSERT(index < d->pixmap_list.size()); - pixmap = d->pixmap_list.at(index); + pixmap = d->pixmap_list.value(index); } else { s >> r >> pixmap >> p; } @@ -765,7 +765,7 @@ bool QPicture::exec(QPainter *painter, QDataStream &s, int nrecords) int index; s >> r >> index >> sr >> ul; Q_ASSERT(index < d->image_list.size()); - image = d->image_list.at(index); + image = d->image_list.value(index); } else { s >> r >> image >> sr >> ul; } @@ -817,7 +817,7 @@ bool QPicture::exec(QPainter *painter, QDataStream &s, int nrecords) int index; s >> index; Q_ASSERT(index < d->pen_list.size()); - pen = d->pen_list.at(index); + pen = d->pen_list.value(index); } else { s >> pen; } @@ -828,7 +828,7 @@ bool QPicture::exec(QPainter *painter, QDataStream &s, int nrecords) int index; s >> index; Q_ASSERT(index < d->brush_list.size()); - brush = d->brush_list.at(index); + brush = d->brush_list.value(index); } else { s >> brush; } @@ -858,7 +858,7 @@ bool QPicture::exec(QPainter *painter, QDataStream &s, int nrecords) break; case QPicturePrivate::PdcSetWXform: s >> i_8; - painter->setMatrixEnabled(i_8); + painter->setWorldMatrixEnabled(i_8); break; case QPicturePrivate::PdcSetWMatrix: if (d->formatMajor >= 8) { @@ -910,7 +910,7 @@ bool QPicture::exec(QPainter *painter, QDataStream &s, int nrecords) break; default: qWarning("QPicture::play: Invalid command %d", c); - if (len) // skip unknown command + if (len > 0) // skip unknown command s.device()->seek(s.device()->pos()+len); } #if defined(QT_DEBUG) @@ -1075,7 +1075,8 @@ bool QPicturePrivate::checkFormat() char mf_id[4]; // picture header tag s.readRawData(mf_id, 4); // read actual tag - if (memcmp(mf_id, qt_mfhdr_tag, 4) != 0) { // wrong header id + int bufSize = pictb.buffer().size(); + if (memcmp(mf_id, qt_mfhdr_tag, 4) != 0 || bufSize < 12) { // wrong header id or size qWarning("QPicturePaintEngine::checkFormat: Incorrect header"); pictb.close(); return false; @@ -1199,8 +1200,8 @@ QT_END_INCLUDE_NAMESPACE \obsolete Returns a string that specifies the picture format of the file \a - fileName, or 0 if the file cannot be read or if the format is not - recognized. + fileName, or \nullptr if the file cannot be read or if the format + is not recognized. \sa load(), save() */ @@ -1542,7 +1543,7 @@ const QPicture &QPictureIO::picture() const { return d->pi; } int QPictureIO::status() const { return d->iostat; } /*! - Returns the picture format string or 0 if no format has been + Returns the picture format string or \nullptr if no format has been explicitly set. */ const char *QPictureIO::format() const { return d->frmt; } @@ -1865,7 +1866,7 @@ QList<QByteArray> QPictureIO::outputFormats() bool QPictureIO::read() { QFile file; - const char *picture_format; + QByteArray picture_format; QPictureHandler *h; if (d->iodev) { // read from io device @@ -1881,7 +1882,7 @@ bool QPictureIO::read() if (d->frmt.isEmpty()) { // Try to guess format picture_format = pictureFormat(d->iodev); // get picture format - if (!picture_format) { + if (picture_format.isEmpty()) { if (file.isOpen()) { // unknown format file.close(); d->iodev = 0; diff --git a/src/gui/image/qpicture.h b/src/gui/image/qpicture.h index ec7b4bd7e3..cac2ef5dfc 100644 --- a/src/gui/image/qpicture.h +++ b/src/gui/image/qpicture.h @@ -79,10 +79,10 @@ public: QPicture& operator=(const QPicture &p); #ifdef Q_COMPILER_RVALUE_REFS - inline QPicture &operator=(QPicture &&other) Q_DECL_NOEXCEPT + inline QPicture &operator=(QPicture &&other) noexcept { qSwap(d_ptr, other.d_ptr); return *this; } #endif - inline void swap(QPicture &other) Q_DECL_NOEXCEPT + inline void swap(QPicture &other) noexcept { d_ptr.swap(other.d_ptr); } void detach(); bool isDetached() const; diff --git a/src/gui/image/qpixmap.cpp b/src/gui/image/qpixmap.cpp index 4b2334ae52..5b4d218603 100644 --- a/src/gui/image/qpixmap.cpp +++ b/src/gui/image/qpixmap.cpp @@ -714,8 +714,8 @@ QBitmap QPixmap::createMaskFromColor(const QColor &maskColor, Qt::MaskMode mode) control the conversion. Note that QPixmaps are automatically added to the QPixmapCache - when loaded from a file; the key used is internal and can not - be acquired. + when loaded from a file in main thread; the key used is internal + and cannot be acquired. \sa loadFromData(), {QPixmap#Reading and Writing Image Files}{Reading and Writing Image Files} @@ -729,6 +729,7 @@ bool QPixmap::load(const QString &fileName, const char *format, Qt::ImageConvers // Note: If no extension is provided, we try to match the // file against known plugin extensions if (info.completeSuffix().isEmpty() || info.exists()) { + const bool inGuiThread = qApp->thread() == QThread::currentThread(); QString key = QLatin1String("qt_pixmap") % info.absoluteFilePath() @@ -736,13 +737,14 @@ bool QPixmap::load(const QString &fileName, const char *format, Qt::ImageConvers % HexString<quint64>(info.size()) % HexString<uint>(data ? data->pixelType() : QPlatformPixmap::PixmapType); - if (QPixmapCache::find(key, this)) + if (inGuiThread && QPixmapCache::find(key, this)) return true; data = QPlatformPixmap::create(0, 0, data ? data->pixelType() : QPlatformPixmap::PixmapType); if (data->fromFile(fileName, format, flags)) { - QPixmapCache::insert(key, *this); + if (inGuiThread) + QPixmapCache::insert(key, *this); return true; } } @@ -856,6 +858,7 @@ bool QPixmap::doImageIO(QImageWriter *writer, int quality) const } +#if QT_DEPRECATED_SINCE(5, 13) /*! \obsolete @@ -876,6 +879,14 @@ void QPixmap::fill(const QPaintDevice *device, const QPoint &p) Use QPainter or the fill(QColor) overload instead. */ +void QPixmap::fill(const QPaintDevice *device, int xofs, int yofs) +{ + Q_UNUSED(device) + Q_UNUSED(xofs) + Q_UNUSED(yofs) + qWarning("this function is deprecated, ignored"); +} +#endif /*! @@ -959,6 +970,7 @@ static void sendResizeEvents(QWidget *target) } #endif +#if QT_DEPRECATED_SINCE(5, 13) /*! \obsolete @@ -982,6 +994,14 @@ QPixmap QPixmap::grabWidget(QObject *widget, const QRect &rectangle) Use QWidget::grab() instead. */ +QPixmap QPixmap::grabWidget(QObject *widget, int x, int y, int w, int h) +{ +QT_WARNING_PUSH +QT_WARNING_DISABLE_DEPRECATED + return grabWidget(widget, QRect(x, y, w, h)); +QT_WARNING_POP +} +#endif /***************************************************************************** QPixmap stream functions @@ -1356,12 +1376,6 @@ QPixmap QPixmap::transformed(const QMatrix &matrix, Qt::TransformationMode mode) The cacheKey() function returns a number that uniquely identifies the contents of the QPixmap object. - The x11Info() function returns information about the configuration - of the X display used by the screen to which the pixmap currently - belongs. The x11PictureHandle() function returns the X11 Picture - handle of the pixmap for XRender support. Note that the two latter - functions are only available on x11. - \endtable \section1 Pixmap Conversion @@ -1392,9 +1406,6 @@ QPixmap QPixmap::transformed(const QMatrix &matrix, Qt::TransformationMode mode) function returns the actual matrix used for transforming the pixmap. - \note When using the native X11 graphics system, the pixmap - becomes invalid when the QApplication instance is destroyed. - \sa QBitmap, QImage, QImageReader, QImageWriter */ @@ -1541,6 +1552,11 @@ QPixmap QPixmap::fromImage(const QImage &image, Qt::ImageConversionFlags flags) if (image.isNull()) return QPixmap(); + if (Q_UNLIKELY(!qobject_cast<QGuiApplication *>(QCoreApplication::instance()))) { + qWarning("QPixmap::fromImage: QPixmap cannot be created without a QGuiApplication"); + return QPixmap(); + } + QScopedPointer<QPlatformPixmap> data(QGuiApplicationPrivate::platformIntegration()->createPlatformPixmap(QPlatformPixmap::PixmapType)); data->fromImage(image, flags); return QPixmap(data.take()); @@ -1563,6 +1579,11 @@ QPixmap QPixmap::fromImageInPlace(QImage &image, Qt::ImageConversionFlags flags) if (image.isNull()) return QPixmap(); + if (Q_UNLIKELY(!qobject_cast<QGuiApplication *>(QCoreApplication::instance()))) { + qWarning("QPixmap::fromImageInPlace: QPixmap cannot be created without a QGuiApplication"); + return QPixmap(); + } + QScopedPointer<QPlatformPixmap> data(QGuiApplicationPrivate::platformIntegration()->createPlatformPixmap(QPlatformPixmap::PixmapType)); data->fromImageInPlace(image, flags); return QPixmap(data.take()); @@ -1582,11 +1603,17 @@ QPixmap QPixmap::fromImageInPlace(QImage &image, Qt::ImageConversionFlags flags) */ QPixmap QPixmap::fromImageReader(QImageReader *imageReader, Qt::ImageConversionFlags flags) { + if (Q_UNLIKELY(!qobject_cast<QGuiApplication *>(QCoreApplication::instance()))) { + qWarning("QPixmap::fromImageReader: QPixmap cannot be created without a QGuiApplication"); + return QPixmap(); + } + QScopedPointer<QPlatformPixmap> data(QGuiApplicationPrivate::platformIntegration()->createPlatformPixmap(QPlatformPixmap::PixmapType)); data->fromImageReader(imageReader, flags); return QPixmap(data.take()); } +#if QT_DEPRECATED_SINCE(5, 13) /*! \fn QPixmap QPixmap::grabWindow(WId window, int x, int y, int width, int height) @@ -1640,6 +1667,7 @@ QPixmap QPixmap::grabWindow(WId window, int x, int y, int w, int h) " Defaulting to primary screen."); return QGuiApplication::primaryScreen()->grabWindow(window, x, y, w, h); } +#endif /*! \internal diff --git a/src/gui/image/qpixmap.h b/src/gui/image/qpixmap.h index 55cca7a766..2103fcc58c 100644 --- a/src/gui/image/qpixmap.h +++ b/src/gui/image/qpixmap.h @@ -74,10 +74,10 @@ public: QPixmap &operator=(const QPixmap &); #ifdef Q_COMPILER_RVALUE_REFS - inline QPixmap &operator=(QPixmap &&other) Q_DECL_NOEXCEPT + inline QPixmap &operator=(QPixmap &&other) noexcept { qSwap(data, other.data); return *this; } #endif - inline void swap(QPixmap &other) Q_DECL_NOEXCEPT + inline void swap(QPixmap &other) noexcept { qSwap(data, other.data); } operator QVariant() const; @@ -94,8 +94,12 @@ public: static int defaultDepth(); void fill(const QColor &fillColor = Qt::white); +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use QPainter or fill(QColor)") void fill(const QPaintDevice *device, const QPoint &ofs); - inline void fill(const QPaintDevice *device, int xofs, int yofs) { fill(device, QPoint(xofs, yofs)); } + QT_DEPRECATED_X("Use QPainter or fill(QColor)") + void fill(const QPaintDevice *device, int xofs, int yofs); +#endif QBitmap mask() const; void setMask(const QBitmap &); @@ -111,10 +115,14 @@ public: #endif QBitmap createMaskFromColor(const QColor &maskColor, Qt::MaskMode mode = Qt::MaskInColor) const; - static QPixmap grabWindow(WId, int x=0, int y=0, int w=-1, int h=-1); +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use QScreen::grabWindow() instead") + static QPixmap grabWindow(WId, int x = 0, int y = 0, int w = -1, int h = -1); + QT_DEPRECATED_X("Use QWidget::grab() instead") static QPixmap grabWidget(QObject *widget, const QRect &rect); - static inline QPixmap grabWidget(QObject *widget, int x=0, int y=0, int w=-1, int h=-1) - { return grabWidget(widget, QRect(x, y, w, h)); } + QT_DEPRECATED_X("Use QWidget::grab() instead") + static QPixmap grabWidget(QObject *widget, int x = 0, int y = 0, int w = -1, int h = -1); +#endif inline QPixmap scaled(int w, int h, Qt::AspectRatioMode aspectMode = Qt::IgnoreAspectRatio, Qt::TransformationMode mode = Qt::FastTransformation) const diff --git a/src/gui/image/qpixmap_raster.cpp b/src/gui/image/qpixmap_raster.cpp index 13c1c29d5b..2732bbd197 100644 --- a/src/gui/image/qpixmap_raster.cpp +++ b/src/gui/image/qpixmap_raster.cpp @@ -203,6 +203,9 @@ void QRasterPlatformPixmap::fill(const QColor &color) pixel = qAlpha(color.rgba()); } else if (image.format() == QImage::Format_Grayscale8) { pixel = qGray(color.rgba()); + } else if (image.format() == QImage::Format_Grayscale16) { + QRgba64 c = color.rgba64(); + pixel = qGray(c.red(), c.green(), c.blue()); } else { pixel = 0; diff --git a/src/gui/image/qpixmap_win.cpp b/src/gui/image/qpixmap_win.cpp index b8d13ac092..3a2db74098 100644 --- a/src/gui/image/qpixmap_win.cpp +++ b/src/gui/image/qpixmap_win.cpp @@ -210,7 +210,7 @@ static QImage copyImageData(const BITMAPINFOHEADER &header, const RGBQUAD *color class DisplayHdc { - Q_DISABLE_COPY(DisplayHdc) + Q_DISABLE_COPY_MOVE(DisplayHdc) public: DisplayHdc() : m_displayDc(GetDC(nullptr)) {} ~DisplayHdc() { ReleaseDC(nullptr, m_displayDc); } @@ -422,8 +422,11 @@ static QImage imageFromWinHBITMAP_GetDiBits(HBITMAP bitmap, bool forceQuads, int if (info.bmiHeader.biHeight > 0) // Force top-down info.bmiHeader.biHeight = -info.bmiHeader.biHeight; info.bmiHeader.biCompression = BI_RGB; // Extract using no compression (can be BI_BITFIELD) - if (forceQuads) + size_t allocSize = info.bmiHeader.biSizeImage; + if (forceQuads) { info.bmiHeader.biBitCount = 32; + allocSize = info.bmiHeader.biWidth * qAbs(info.bmiHeader.biHeight) * 4; + } const QImage::Format imageFormat = imageFromWinHBITMAP_Format(info.bmiHeader, hbitmapFormat); if (imageFormat == QImage::Format_Invalid) { @@ -431,7 +434,7 @@ static QImage imageFromWinHBITMAP_GetDiBits(HBITMAP bitmap, bool forceQuads, int return QImage(); } - QScopedPointer<uchar> data(new uchar[info.bmiHeader.biSizeImage]); + QScopedArrayPointer<uchar> data(new uchar[allocSize]); if (!GetDIBits(displayDc, bitmap, 0, qAbs(info.bmiHeader.biHeight), data.data(), &info, DIB_RGB_COLORS)) { qErrnoWarning("%s: GetDIBits() failed to get data.", __FUNCTION__); return QImage(); diff --git a/src/gui/image/qpixmapcache.cpp b/src/gui/image/qpixmapcache.cpp index 3d1652f68b..a41ec8f35c 100644 --- a/src/gui/image/qpixmapcache.cpp +++ b/src/gui/image/qpixmapcache.cpp @@ -176,7 +176,7 @@ bool QPixmapCache::Key::operator ==(const Key &key) const Otherwise, if pixmap was flushed, the key is no longer valid. \since 5.7 */ -bool QPixmapCache::Key::isValid() const Q_DECL_NOTHROW +bool QPixmapCache::Key::isValid() const noexcept { return d && d->isValid; } @@ -469,10 +469,13 @@ QPixmapCacheEntry::~QPixmapCacheEntry() pm_cache()->releaseKey(key); } +#if QT_DEPRECATED_SINCE(5, 13) /*! \obsolete \overload + Use bool find(const QString &, QPixmap *) instead. + Returns the pixmap associated with the \a key in the cache, or null if there is no such pixmap. @@ -494,13 +497,14 @@ QPixmap *QPixmapCache::find(const QString &key) /*! \obsolete - Use bool find(const QString&, QPixmap*) instead. + Use bool find(const QString &, QPixmap *) instead. */ -bool QPixmapCache::find(const QString &key, QPixmap& pixmap) +bool QPixmapCache::find(const QString &key, QPixmap &pixmap) { return find(key, &pixmap); } +#endif /*! Looks for a cached pixmap associated with the given \a key in the cache. @@ -513,7 +517,7 @@ bool QPixmapCache::find(const QString &key, QPixmap& pixmap) \snippet code/src_gui_image_qpixmapcache.cpp 1 */ -bool QPixmapCache::find(const QString &key, QPixmap* pixmap) +bool QPixmapCache::find(const QString &key, QPixmap *pixmap) { QPixmap *ptr = pm_cache()->object(key); if (ptr && pixmap) @@ -530,7 +534,7 @@ bool QPixmapCache::find(const QString &key, QPixmap* pixmap) \since 4.6 */ -bool QPixmapCache::find(const Key &key, QPixmap* pixmap) +bool QPixmapCache::find(const Key &key, QPixmap *pixmap) { //The key is not valid anymore, a flush happened before probably if (!key.d || !key.d->isValid) diff --git a/src/gui/image/qpixmapcache.h b/src/gui/image/qpixmapcache.h index ea10ab1b76..c5bedb27ab 100644 --- a/src/gui/image/qpixmapcache.h +++ b/src/gui/image/qpixmapcache.h @@ -56,8 +56,8 @@ public: Key(); Key(const Key &other); #ifdef Q_COMPILER_RVALUE_REFS - Key(Key &&other) Q_DECL_NOTHROW : d(other.d) { other.d = nullptr; } - Key &operator =(Key &&other) Q_DECL_NOTHROW { swap(other); return *this; } + Key(Key &&other) noexcept : d(other.d) { other.d = nullptr; } + Key &operator =(Key &&other) noexcept { swap(other); return *this; } #endif ~Key(); bool operator ==(const Key &key) const; @@ -65,8 +65,8 @@ public: { return !operator==(key); } Key &operator =(const Key &other); - void swap(Key &other) Q_DECL_NOTHROW { qSwap(d, other.d); } - bool isValid() const Q_DECL_NOTHROW; + void swap(Key &other) noexcept { qSwap(d, other.d); } + bool isValid() const noexcept; private: KeyData *d; @@ -76,8 +76,12 @@ public: static int cacheLimit(); static void setCacheLimit(int); +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use bool find(const QString &, QPixmap *) instead") static QPixmap *find(const QString &key); + QT_DEPRECATED_X("Use bool find(const QString &, QPixmap *) instead") static bool find(const QString &key, QPixmap &pixmap); +#endif static bool find(const QString &key, QPixmap *pixmap); static bool find(const Key &key, QPixmap *pixmap); static bool insert(const QString &key, const QPixmap &pixmap); diff --git a/src/gui/image/qpixmapcache_p.h b/src/gui/image/qpixmapcache_p.h index 3c57367514..ab8e2b7558 100644 --- a/src/gui/image/qpixmapcache_p.h +++ b/src/gui/image/qpixmapcache_p.h @@ -87,7 +87,7 @@ public: && !d->image.d->paintEngine->isActive()) { delete d->image.d->paintEngine; - d->image.d->paintEngine = 0; + d->image.d->paintEngine = nullptr; } } } diff --git a/src/gui/image/qplatformpixmap.cpp b/src/gui/image/qplatformpixmap.cpp index 2209c3de4d..a2e01147c4 100644 --- a/src/gui/image/qplatformpixmap.cpp +++ b/src/gui/image/qplatformpixmap.cpp @@ -178,6 +178,7 @@ QBitmap QPlatformPixmap::mask() const if (mask.isNull()) // allocation failed return QBitmap(); + mask.setDevicePixelRatio(devicePixelRatio()); mask.setColorCount(2); mask.setColor(0, QColor(Qt::color0).rgba()); mask.setColor(1, QColor(Qt::color1).rgba()); diff --git a/src/gui/image/qpnghandler.cpp b/src/gui/image/qpnghandler.cpp index 242d8cd63b..39d0807606 100644 --- a/src/gui/image/qpnghandler.cpp +++ b/src/gui/image/qpnghandler.cpp @@ -42,15 +42,19 @@ #ifndef QT_NO_IMAGEFORMAT_PNG #include <qcoreapplication.h> +#include <qdebug.h> #include <qiodevice.h> #include <qimage.h> #include <qlist.h> -#include <qtextcodec.h> #include <qvariant.h> #include <qvector.h> #include <private/qimage_p.h> // for qt_getImageText +#include <qcolorspace.h> +#include <private/qcolorspace_p.h> +#include <private/qicc_p.h> + #include <png.h> #include <pngconf.h> @@ -97,17 +101,27 @@ public: ReadingEnd, Error }; + // Defines the order of how the various ways of setting colorspace overrides eachother: + enum ColorSpaceState { + Undefined = 0, + GammaChrm = 1, // gAMA+cHRM chunks + Srgb = 2, // sRGB chunk + Icc = 3 // iCCP chunk + }; QPngHandlerPrivate(QPngHandler *qq) - : gamma(0.0), fileGamma(0.0), quality(2), png_ptr(0), info_ptr(0), end_info(0), state(Ready), q(qq) + : gamma(0.0), fileGamma(0.0), quality(50), compression(50), colorSpaceState(Undefined), png_ptr(0), info_ptr(0), end_info(0), state(Ready), q(qq) { } float gamma; float fileGamma; - int quality; + int quality; // quality is used for backward compatibility, maps to compression + int compression; QString description; QSize scaledSize; QStringList readTexts; + QColorSpace colorSpace; + ColorSpaceState colorSpaceState; png_struct *png_ptr; png_info *info_ptr; @@ -161,11 +175,11 @@ public: void setGamma(float); bool writeImage(const QImage& img, int x, int y); - bool writeImage(const QImage& img, volatile int quality, const QString &description, int x, int y); + bool writeImage(const QImage& img, volatile int compression_in, const QString &description, int x, int y); bool writeImage(const QImage& img) { return writeImage(img, 0, 0); } - bool writeImage(const QImage& img, int quality, const QString &description) - { return writeImage(img, quality, description, 0, 0); } + bool writeImage(const QImage& img, int compression, const QString &description) + { return writeImage(img, compression, description, 0, 0); } QIODevice* device() { return dev; } @@ -226,21 +240,18 @@ void qpiw_flush_fn(png_structp /* png_ptr */) } static -void setup_qt(QImage& image, png_structp png_ptr, png_infop info_ptr, QSize scaledSize, bool *doScaledRead, float screen_gamma=0.0, float file_gamma=0.0) +void setup_qt(QImage& image, png_structp png_ptr, png_infop info_ptr, QSize scaledSize, bool *doScaledRead) { - if (screen_gamma != 0.0 && file_gamma != 0.0) - png_set_gamma(png_ptr, 1.0f / screen_gamma, file_gamma); - - png_uint_32 width; - png_uint_32 height; - int bit_depth; - int color_type; + png_uint_32 width = 0; + png_uint_32 height = 0; + int bit_depth = 0; + int color_type = 0; png_bytep trans_alpha = 0; png_color_16p trans_color_p = 0; int num_trans; png_colorp palette = 0; int num_palette; - int interlace_method; + int interlace_method = PNG_INTERLACE_LAST; png_get_IHDR(png_ptr, info_ptr, &width, &height, &bit_depth, &color_type, &interlace_method, 0, 0); png_set_interlace_handling(png_ptr); @@ -266,6 +277,18 @@ void setup_qt(QImage& image, png_structp png_ptr, png_infop info_ptr, QSize scal else if (g == 1) image.setColor(0, qRgba(255, 255, 255, 0)); } + } else if (bit_depth == 16 + && png_get_channels(png_ptr, info_ptr) == 1 + && !png_get_valid(png_ptr, info_ptr, PNG_INFO_tRNS)) { + if (image.size() != QSize(width, height) || image.format() != QImage::Format_Grayscale16) { + image = QImage(width, height, QImage::Format_Grayscale16); + if (image.isNull()) + return; + } + + png_read_update_info(png_ptr, info_ptr); + if (QSysInfo::ByteOrder == QSysInfo::LittleEndian) + png_set_swap(png_ptr); } else if (bit_depth == 16) { bool hasMask = png_get_valid(png_ptr, info_ptr, PNG_INFO_tRNS); if (!hasMask) @@ -573,10 +596,45 @@ bool QPngHandlerPrivate::readPngHeader() readPngTexts(info_ptr); +#ifdef PNG_iCCP_SUPPORTED + if (png_get_valid(png_ptr, info_ptr, PNG_INFO_iCCP)) { + png_charp name = nullptr; + int compressionType = 0; +#if (PNG_LIBPNG_VER < 10500) + png_charp profileData = nullptr; +#else + png_bytep profileData = nullptr; +#endif + png_uint_32 profLen; + png_get_iCCP(png_ptr, info_ptr, &name, &compressionType, &profileData, &profLen); + if (!QIcc::fromIccProfile(QByteArray::fromRawData((const char *)profileData, profLen), &colorSpace)) { + qWarning() << "QPngHandler: Failed to parse ICC profile"; + } else { + colorSpaceState = Icc; + } + } +#endif + if (png_get_valid(png_ptr, info_ptr, PNG_INFO_sRGB)) { + int rendering_intent = -1; + png_get_sRGB(png_ptr, info_ptr, &rendering_intent); + // We don't actually care about the rendering_intent, just that it is valid + if (rendering_intent >= 0 && rendering_intent <= 3 && colorSpaceState <= Srgb) { + colorSpace = QColorSpace::SRgb; + colorSpaceState = Srgb; + } + } if (png_get_valid(png_ptr, info_ptr, PNG_INFO_gAMA)) { double file_gamma = 0.0; png_get_gAMA(png_ptr, info_ptr, &file_gamma); fileGamma = file_gamma; + if (fileGamma > 0.0f && colorSpaceState <= GammaChrm) { + QColorSpacePrivate *csPrivate = colorSpace.d_func(); + csPrivate->gamut = QColorSpace::Gamut::SRgb; + csPrivate->transferFunction = QColorSpace::TransferFunction::Gamma; + csPrivate->gamma = fileGamma; + csPrivate->initialize(); + colorSpaceState = GammaChrm; + } } state = ReadHeader; @@ -601,8 +659,19 @@ bool QPngHandlerPrivate::readPngImage(QImage *outImage) return false; } + if (gamma != 0.0 && fileGamma != 0.0) { + // This configuration forces gamma correction and + // thus changes the output colorspace + png_set_gamma(png_ptr, 1.0f / gamma, fileGamma); + QColorSpacePrivate *csPrivate = colorSpace.d_func(); + csPrivate->transferFunction = QColorSpace::TransferFunction::Gamma; + csPrivate->gamma = gamma; + csPrivate->initialize(); + colorSpaceState = GammaChrm; + } + bool doScaledRead = false; - setup_qt(*outImage, png_ptr, info_ptr, scaledSize, &doScaledRead, gamma, fileGamma); + setup_qt(*outImage, png_ptr, info_ptr, scaledSize, &doScaledRead); if (outImage->isNull()) { png_destroy_read_struct(&png_ptr, &info_ptr, &end_info); @@ -671,14 +740,17 @@ bool QPngHandlerPrivate::readPngImage(QImage *outImage) if (scaledSize.isValid() && outImage->size() != scaledSize) *outImage = outImage->scaled(scaledSize, Qt::IgnoreAspectRatio, Qt::SmoothTransformation); + if (colorSpaceState > Undefined && colorSpace.isValid()) + outImage->setColorSpace(colorSpace); + return true; } QImage::Format QPngHandlerPrivate::readImageFormat() { QImage::Format format = QImage::Format_Invalid; - png_uint_32 width, height; - int bit_depth, color_type; + png_uint_32 width = 0, height = 0; + int bit_depth = 0, color_type = 0; png_colorp palette; int num_palette; png_get_IHDR(png_ptr, info_ptr, &width, &height, &bit_depth, &color_type, 0, 0, 0); @@ -687,7 +759,7 @@ QImage::Format QPngHandlerPrivate::readImageFormat() if (bit_depth == 1 && png_get_channels(png_ptr, info_ptr) == 1) { format = QImage::Format_Mono; } else if (bit_depth == 16) { - format = png_get_valid(png_ptr, info_ptr, PNG_INFO_tRNS) ? QImage::Format_RGBA64 : QImage::Format_RGBX64; + format = png_get_valid(png_ptr, info_ptr, PNG_INFO_tRNS) ? QImage::Format_RGBA64 : QImage::Format_Grayscale16; } else if (bit_depth == 8 && !png_get_valid(png_ptr, info_ptr, PNG_INFO_tRNS)) { format = QImage::Format_Grayscale8; } else { @@ -814,7 +886,7 @@ bool QPNGImageWriter::writeImage(const QImage& image, int off_x, int off_y) return writeImage(image, -1, QString(), off_x, off_y); } -bool QPNGImageWriter::writeImage(const QImage& image, volatile int quality_in, const QString &description, +bool QPNGImageWriter::writeImage(const QImage& image, volatile int compression_in, const QString &description, int off_x_in, int off_y_in) { QPoint offset = image.offset(); @@ -842,13 +914,13 @@ bool QPNGImageWriter::writeImage(const QImage& image, volatile int quality_in, c return false; } - int quality = quality_in; - if (quality >= 0) { - if (quality > 9) { - qWarning("PNG: Quality %d out of range", quality); - quality = 9; + int compression = compression_in; + if (compression >= 0) { + if (compression > 9) { + qWarning("PNG: Compression %d out of range", compression); + compression = 9; } - png_set_compression_level(png_ptr, quality); + png_set_compression_level(png_ptr, compression); } png_set_write_fn(png_ptr, (void*)this, qpiw_write_fn, qpiw_flush_fn); @@ -861,7 +933,8 @@ bool QPNGImageWriter::writeImage(const QImage& image, volatile int quality_in, c else color_type = PNG_COLOR_TYPE_PALETTE; } - else if (image.format() == QImage::Format_Grayscale8) + else if (image.format() == QImage::Format_Grayscale8 + || image.format() == QImage::Format_Grayscale16) color_type = PNG_COLOR_TYPE_GRAY; else if (image.hasAlphaChannel()) color_type = PNG_COLOR_TYPE_RGB_ALPHA; @@ -877,6 +950,7 @@ bool QPNGImageWriter::writeImage(const QImage& image, volatile int quality_in, c case QImage::Format_RGBX64: case QImage::Format_RGBA64: case QImage::Format_RGBA64_Premultiplied: + case QImage::Format_Grayscale16: bpc = 16; break; default: @@ -988,6 +1062,7 @@ bool QPNGImageWriter::writeImage(const QImage& image, volatile int quality_in, c case QImage::Format_RGBX64: case QImage::Format_RGBA64: case QImage::Format_RGBA64_Premultiplied: + case QImage::Format_Grayscale16: png_set_swap(png_ptr); break; default: @@ -1018,6 +1093,7 @@ bool QPNGImageWriter::writeImage(const QImage& image, volatile int quality_in, c case QImage::Format_MonoLSB: case QImage::Format_Indexed8: case QImage::Format_Grayscale8: + case QImage::Format_Grayscale16: case QImage::Format_RGB32: case QImage::Format_ARGB32: case QImage::Format_RGB888: @@ -1067,15 +1143,21 @@ bool QPNGImageWriter::writeImage(const QImage& image, volatile int quality_in, c } static bool write_png_image(const QImage &image, QIODevice *device, - int quality, float gamma, const QString &description) + int compression, int quality, float gamma, const QString &description) { + // quality is used for backward compatibility, maps to compression + QPNGImageWriter writer(device); - if (quality >= 0) { - quality = qMin(quality, 100); - quality = (100-quality) * 9 / 91; // map [0,100] -> [9,0] - } + if (compression >= 0) + compression = qMin(compression, 100); + else if (quality >= 0) + compression = 100 - qMin(quality, 100); + + if (compression >= 0) + compression = (compression * 9) / 91; // map [0,100] -> [0,9] + writer.setGamma(gamma); - return writer.writeImage(image, quality, description); + return writer.writeImage(image, compression, description); } QPngHandler::QPngHandler() @@ -1122,7 +1204,7 @@ bool QPngHandler::read(QImage *image) bool QPngHandler::write(const QImage &image) { - return write_png_image(image, device(), d->quality, d->gamma, d->description); + return write_png_image(image, device(), d->compression, d->quality, d->gamma, d->description); } bool QPngHandler::supportsOption(ImageOption option) const @@ -1131,6 +1213,7 @@ bool QPngHandler::supportsOption(ImageOption option) const || option == Description || option == ImageFormat || option == Quality + || option == CompressionRatio || option == Size || option == ScaledSize; } @@ -1146,6 +1229,8 @@ QVariant QPngHandler::option(ImageOption option) const return d->gamma == 0.0 ? d->fileGamma : d->gamma; else if (option == Quality) return d->quality; + else if (option == CompressionRatio) + return d->compression; else if (option == Description) return d->description; else if (option == Size) @@ -1164,16 +1249,20 @@ void QPngHandler::setOption(ImageOption option, const QVariant &value) d->gamma = value.toFloat(); else if (option == Quality) d->quality = value.toInt(); + else if (option == CompressionRatio) + d->compression = value.toInt(); else if (option == Description) d->description = value.toString(); else if (option == ScaledSize) d->scaledSize = value.toSize(); } +#if QT_DEPRECATED_SINCE(5, 13) QByteArray QPngHandler::name() const { return "png"; } +#endif QT_END_NAMESPACE diff --git a/src/gui/image/qpnghandler_p.h b/src/gui/image/qpnghandler_p.h index 4ca716e7c2..5d4da97395 100644 --- a/src/gui/image/qpnghandler_p.h +++ b/src/gui/image/qpnghandler_p.h @@ -69,7 +69,9 @@ public: bool read(QImage *image) override; bool write(const QImage &image) override; +#if QT_DEPRECATED_SINCE(5, 13) QByteArray name() const override; +#endif QVariant option(ImageOption option) const override; void setOption(ImageOption option, const QVariant &value) override; diff --git a/src/gui/image/qppmhandler.cpp b/src/gui/image/qppmhandler.cpp index bfde0aa76e..13ee2eadd2 100644 --- a/src/gui/image/qppmhandler.cpp +++ b/src/gui/image/qppmhandler.cpp @@ -576,10 +576,12 @@ void QPpmHandler::setOption(ImageOption option, const QVariant &value) subType = value.toByteArray().toLower(); } +#if QT_DEPRECATED_SINCE(5, 13) QByteArray QPpmHandler::name() const { return subType.isEmpty() ? QByteArray("ppm") : subType; } +#endif QT_END_NAMESPACE diff --git a/src/gui/image/qppmhandler_p.h b/src/gui/image/qppmhandler_p.h index 1c6fbd6869..2f3811b759 100644 --- a/src/gui/image/qppmhandler_p.h +++ b/src/gui/image/qppmhandler_p.h @@ -67,9 +67,11 @@ public: bool read(QImage *image) override; bool write(const QImage &image) override; +#if QT_DEPRECATED_SINCE(5, 13) QByteArray name() const override; +#endif - static bool canRead(QIODevice *device, QByteArray *subType = 0); + static bool canRead(QIODevice *device, QByteArray *subType = nullptr); QVariant option(ImageOption option) const override; void setOption(ImageOption option, const QVariant &value) override; diff --git a/src/gui/image/qxbmhandler.cpp b/src/gui/image/qxbmhandler.cpp index 24d86e116d..65a5b63bc7 100644 --- a/src/gui/image/qxbmhandler.cpp +++ b/src/gui/image/qxbmhandler.cpp @@ -97,6 +97,8 @@ static bool read_xbm_header(QIODevice *device, int& w, int& h) if (r1.indexIn(sbuf) == 0 && r2.indexIn(sbuf, r1.matchedLength()) == r1.matchedLength()) w = QByteArray(&buf[r1.matchedLength()]).trimmed().toInt(); + else + return false; // "#define .._height <num>" readBytes = device->readLine(buf, buflen); @@ -109,6 +111,8 @@ static bool read_xbm_header(QIODevice *device, int& w, int& h) if (r1.indexIn(sbuf) == 0 && r2.indexIn(sbuf, r1.matchedLength()) == r1.matchedLength()) h = QByteArray(&buf[r1.matchedLength()]).trimmed().toInt(); + else + return false; // format error if (w <= 0 || w > 32767 || h <= 0 || h > 32767) @@ -352,10 +356,12 @@ void QXbmHandler::setOption(ImageOption option, const QVariant &value) fileName = value.toString(); } +#if QT_DEPRECATED_SINCE(5, 13) QByteArray QXbmHandler::name() const { return "xbm"; } +#endif QT_END_NAMESPACE diff --git a/src/gui/image/qxbmhandler_p.h b/src/gui/image/qxbmhandler_p.h index 26439af527..ae590a1944 100644 --- a/src/gui/image/qxbmhandler_p.h +++ b/src/gui/image/qxbmhandler_p.h @@ -66,7 +66,9 @@ public: bool read(QImage *image) override; bool write(const QImage &image) override; +#if QT_DEPRECATED_SINCE(5, 13) QByteArray name() const override; +#endif static bool canRead(QIODevice *device); diff --git a/src/gui/image/qxpmhandler.cpp b/src/gui/image/qxpmhandler.cpp index 17272ffe69..a32dfda96d 100644 --- a/src/gui/image/qxpmhandler.cpp +++ b/src/gui/image/qxpmhandler.cpp @@ -1287,10 +1287,12 @@ void QXpmHandler::setOption(ImageOption option, const QVariant &value) fileName = value.toString(); } +#if QT_DEPRECATED_SINCE(5, 13) QByteArray QXpmHandler::name() const { return "xpm"; } +#endif QT_END_NAMESPACE diff --git a/src/gui/image/qxpmhandler_p.h b/src/gui/image/qxpmhandler_p.h index f118bf2309..a4dd88cd17 100644 --- a/src/gui/image/qxpmhandler_p.h +++ b/src/gui/image/qxpmhandler_p.h @@ -68,7 +68,9 @@ public: static bool canRead(QIODevice *device); +#if QT_DEPRECATED_SINCE(5, 13) QByteArray name() const override; +#endif QVariant option(ImageOption option) const override; void setOption(ImageOption option, const QVariant &value) override; diff --git a/src/gui/itemmodels/qstandarditemmodel.cpp b/src/gui/itemmodels/qstandarditemmodel.cpp index aa640f4d7e..3e3c7a6211 100644 --- a/src/gui/itemmodels/qstandarditemmodel.cpp +++ b/src/gui/itemmodels/qstandarditemmodel.cpp @@ -879,8 +879,8 @@ QStandardItem::~QStandardItem() } /*! - Returns the item's parent item, or 0 if the item has no parent. - \note For toplevel items parent() returns 0. To receive toplevel + Returns the item's parent item, or \nullptr if the item has no parent. + \note For toplevel items parent() returns \nullptr. To receive toplevel item's parent use QStandardItemModel::invisibleRootItem() instead. \sa child(), QStandardItemModel::invisibleRootItem() @@ -1548,7 +1548,7 @@ QModelIndex QStandardItem::index() const Returns the QStandardItemModel that this item belongs to. If the item is not a child of another item that belongs to the model, this - function returns 0. + function returns \nullptr. \sa index() */ @@ -1865,7 +1865,7 @@ void QStandardItem::setChild(int row, int column, QStandardItem *item) /*! Returns the child item at (\a row, \a column) if one has been set; otherwise - returns 0. + returns \nullptr. \sa setChild(), takeChild(), parent() */ @@ -1881,7 +1881,7 @@ QStandardItem *QStandardItem::child(int row, int column) const /*! Removes the child item at (\a row, \a column) without deleting it, and returns a pointer to the item. If there was no child at the given location, then - this function returns 0. + this function returns \nullptr. Note that this function, unlike takeRow() and takeColumn(), does not affect the dimensions of the child table. @@ -1905,7 +1905,7 @@ QStandardItem *QStandardItem::takeChild(int row, int column) /*! Removes \a row without deleting the row items, and returns a list of pointers to the removed items. For items in the row that have not been - set, the corresponding pointers in the list will be 0. + set, the corresponding pointers in the list will be \nullptr. \sa removeRow(), insertRow(), takeColumn() */ @@ -1939,7 +1939,7 @@ QList<QStandardItem*> QStandardItem::takeRow(int row) /*! Removes \a column without deleting the column items, and returns a list of pointers to the removed items. For items in the column that have not been - set, the corresponding pointers in the list will be 0. + set, the corresponding pointers in the list will be \nullptr. \sa removeColumn(), insertColumn(), takeRow() */ @@ -2283,7 +2283,7 @@ void QStandardItemModel::clear() itemPrototype()), and set it in the parent item's child table, if no item already exists at that index. - If \a index is an invalid index, this function returns 0. + If \a index is an invalid index, this function returns \nullptr. \sa indexFromItem() */ @@ -2380,7 +2380,7 @@ void QStandardItemModel::setItem(int row, int column, QStandardItem *item) \since 4.2 Returns the item for the given \a row and \a column if one has been set; - otherwise returns 0. + otherwise returns \nullptr. \sa setItem(), takeItem(), itemFromIndex() */ @@ -2453,7 +2453,7 @@ void QStandardItemModel::setHorizontalHeaderItem(int column, QStandardItem *item \since 4.2 Returns the horizontal header item for \a column if one has been set; - otherwise returns 0. + otherwise returns \nullptr. \sa setHorizontalHeaderItem(), verticalHeaderItem() */ @@ -2509,7 +2509,7 @@ void QStandardItemModel::setVerticalHeaderItem(int row, QStandardItem *item) \since 4.2 Returns the vertical header item for row \a row if one has been set; - otherwise returns 0. + otherwise returns \nullptr. \sa setVerticalHeaderItem(), horizontalHeaderItem() */ @@ -2718,7 +2718,7 @@ QStandardItem *QStandardItemModel::takeItem(int row, int column) Removes the given \a row without deleting the row items, and returns a list of pointers to the removed items. The model releases ownership of the items. For items in the row that have not been set, the corresponding - pointers in the list will be 0. + pointers in the list will be \nullptr. \sa takeColumn() */ @@ -2734,7 +2734,7 @@ QList<QStandardItem*> QStandardItemModel::takeRow(int row) Removes the given \a column without deleting the column items, and returns a list of pointers to the removed items. The model releases ownership of the items. For items in the column that have not been set, the - corresponding pointers in the list will be 0. + corresponding pointers in the list will be \nullptr. \sa takeRow() */ @@ -3018,6 +3018,9 @@ bool QStandardItemModel::setData(const QModelIndex &index, const QVariant &value /*! \since 5.12 Removes the data stored in all the roles for the given \a index. + Returns \c true if \a index is valid and data was cleared, \c false + otherwise. + \sa setData(), data() */ #endif diff --git a/src/gui/itemmodels/qstandarditemmodel_p.h b/src/gui/itemmodels/qstandarditemmodel_p.h index 23d2938bc4..97c2e6f01b 100644 --- a/src/gui/itemmodels/qstandarditemmodel_p.h +++ b/src/gui/itemmodels/qstandarditemmodel_p.h @@ -109,11 +109,11 @@ class QStandardItemPrivate Q_DECLARE_PUBLIC(QStandardItem) public: inline QStandardItemPrivate() - : model(0), - parent(0), + : model(nullptr), + parent(nullptr), rows(0), columns(0), - q_ptr(0), + q_ptr(nullptr), lastKnownIndex(-1) { } @@ -220,10 +220,10 @@ public: if (!index.isValid()) return root.data(); if (index.model() != q) - return 0; + return nullptr; QStandardItem *parent = static_cast<QStandardItem*>(index.internalPointer()); - if (parent == 0) - return 0; + if (parent == nullptr) + return nullptr; return parent->child(index.row(), index.column()); } diff --git a/src/gui/kernel/kernel.pri b/src/gui/kernel/kernel.pri index 1f137fc46f..9c80f1e2cc 100644 --- a/src/gui/kernel/kernel.pri +++ b/src/gui/kernel/kernel.pri @@ -21,7 +21,7 @@ HEADERS += \ kernel/qplatforminputcontextplugin_p.h \ kernel/qplatformintegrationfactory_p.h \ kernel/qplatformintegrationplugin.h \ - kernel/qplatformtheme.h\ + kernel/qplatformtheme.h \ kernel/qplatformtheme_p.h \ kernel/qplatformthemefactory_p.h \ kernel/qplatformthemeplugin.h \ diff --git a/src/gui/kernel/qclipboard.cpp b/src/gui/kernel/qclipboard.cpp index 771f0fe93d..267c079ad9 100644 --- a/src/gui/kernel/qclipboard.cpp +++ b/src/gui/kernel/qclipboard.cpp @@ -46,7 +46,9 @@ #include "qvariant.h" #include "qbuffer.h" #include "qimage.h" +#if QT_CONFIG(textcodec) #include "qtextcodec.h" +#endif #include "private/qguiapplication_p.h" #include <qpa/qplatformintegration.h> @@ -298,16 +300,16 @@ QString QClipboard::text(QString &subtype, Mode mode) const const QByteArray rawData = data->data(QLatin1String("text/") + subtype); -#ifndef QT_NO_TEXTCODEC +#if QT_CONFIG(textcodec) QTextCodec* codec = QTextCodec::codecForMib(106); // utf-8 is default if (subtype == QLatin1String("html")) codec = QTextCodec::codecForHtml(rawData, codec); else codec = QTextCodec::codecForUtfText(rawData, codec); return codec->toUnicode(rawData); -#else //QT_NO_TEXTCODEC +#else // textcodec return rawData; -#endif //QT_NO_TEXTCODEC +#endif // textcodec } /*! @@ -437,7 +439,7 @@ void QClipboard::setPixmap(const QPixmap &pixmap, Mode mode) \fn QMimeData *QClipboard::mimeData(Mode mode) const Returns a pointer to a QMimeData representation of the current - clipboard data (can be NULL if the given \a mode is not + clipboard data (can be \nullptr if the given \a mode is not supported by the platform). The \a mode argument is used to control which part of the system diff --git a/src/gui/kernel/qcursor.cpp b/src/gui/kernel/qcursor.cpp index bb81ca109a..1ba8760a9d 100644 --- a/src/gui/kernel/qcursor.cpp +++ b/src/gui/kernel/qcursor.cpp @@ -494,7 +494,7 @@ QCursor::QCursor(Qt::CursorShape shape) \sa operator!=(const QCursor &lhs, const QCursor &rhs) */ -bool operator==(const QCursor &lhs, const QCursor &rhs) Q_DECL_NOTHROW +bool operator==(const QCursor &lhs, const QCursor &rhs) noexcept { if (lhs.d == rhs.d) return true; // Copy or same shape @@ -564,8 +564,8 @@ void QCursor::setShape(Qt::CursorShape shape) } /*! - Returns the cursor bitmap, or 0 if it is one of the standard - cursors. + Returns the cursor bitmap, or \nullptr if it is one of the + standard cursors. */ const QBitmap *QCursor::bitmap() const { @@ -575,8 +575,8 @@ const QBitmap *QCursor::bitmap() const } /*! - Returns the cursor bitmap mask, or 0 if it is one of the standard - cursors. + Returns the cursor bitmap mask, or \nullptr if it is one of the + standard cursors. */ const QBitmap *QCursor::mask() const diff --git a/src/gui/kernel/qcursor.h b/src/gui/kernel/qcursor.h index d62ee7a053..ced166dc29 100644 --- a/src/gui/kernel/qcursor.h +++ b/src/gui/kernel/qcursor.h @@ -87,12 +87,12 @@ public: ~QCursor(); QCursor &operator=(const QCursor &cursor); #ifdef Q_COMPILER_RVALUE_REFS - QCursor(QCursor &&other) Q_DECL_NOTHROW : d(other.d) { other.d = nullptr; } - inline QCursor &operator=(QCursor &&other) Q_DECL_NOTHROW + QCursor(QCursor &&other) noexcept : d(other.d) { other.d = nullptr; } + inline QCursor &operator=(QCursor &&other) noexcept { swap(other); return *this; } #endif - void swap(QCursor &other) Q_DECL_NOTHROW { qSwap(d, other.d); } + void swap(QCursor &other) noexcept { qSwap(d, other.d); } operator QVariant() const; @@ -112,13 +112,13 @@ public: inline static void setPos(QScreen *screen, const QPoint &p) { setPos(screen, p.x(), p.y()); } private: - friend Q_GUI_EXPORT bool operator==(const QCursor &lhs, const QCursor &rhs) Q_DECL_NOTHROW; + friend Q_GUI_EXPORT bool operator==(const QCursor &lhs, const QCursor &rhs) noexcept; QCursorData *d; }; Q_DECLARE_SHARED_NOT_MOVABLE_UNTIL_QT6(QCursor) -Q_GUI_EXPORT bool operator==(const QCursor &lhs, const QCursor &rhs) Q_DECL_NOTHROW; -inline bool operator!=(const QCursor &lhs, const QCursor &rhs) Q_DECL_NOTHROW { return !(lhs == rhs); } +Q_GUI_EXPORT bool operator==(const QCursor &lhs, const QCursor &rhs) noexcept; +inline bool operator!=(const QCursor &lhs, const QCursor &rhs) noexcept { return !(lhs == rhs); } /***************************************************************************** QCursor stream functions diff --git a/src/gui/kernel/qdnd_p.h b/src/gui/kernel/qdnd_p.h index 5f6db07987..b1219c8658 100644 --- a/src/gui/kernel/qdnd_p.h +++ b/src/gui/kernel/qdnd_p.h @@ -73,9 +73,9 @@ class QDragPrivate : public QObjectPrivate { public: QDragPrivate() - : source(0) - , target(0) - , data(0) + : source(nullptr) + , target(nullptr) + , data(nullptr) { } QObject *source; QObject *target; @@ -110,7 +110,7 @@ private: QDrag *m_object; static QDragManager *m_instance; - Q_DISABLE_COPY(QDragManager) + Q_DISABLE_COPY_MOVE(QDragManager) }; QT_END_NAMESPACE diff --git a/src/gui/kernel/qdrag.cpp b/src/gui/kernel/qdrag.cpp index bb0e490aa0..dcd0d13d5c 100644 --- a/src/gui/kernel/qdrag.cpp +++ b/src/gui/kernel/qdrag.cpp @@ -284,6 +284,7 @@ Qt::DropAction QDrag::exec(Qt::DropActions supportedActions, Qt::DropAction defa return d->executed_action; } +#if QT_DEPRECATED_SINCE(5, 13) /*! \obsolete @@ -311,6 +312,7 @@ Qt::DropAction QDrag::start(Qt::DropActions request) d->executed_action = QDragManager::self()->drag(this); return d->executed_action; } +#endif /*! Sets the drag \a cursor for the \a action. This allows you diff --git a/src/gui/kernel/qdrag.h b/src/gui/kernel/qdrag.h index 27b9c2c88f..7acd5088bd 100644 --- a/src/gui/kernel/qdrag.h +++ b/src/gui/kernel/qdrag.h @@ -74,7 +74,10 @@ public: QObject *source() const; QObject *target() const; +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use QDrag::exec() instead") Qt::DropAction start(Qt::DropActions supportedActions = Qt::CopyAction); +#endif Qt::DropAction exec(Qt::DropActions supportedActions = Qt::MoveAction); Qt::DropAction exec(Qt::DropActions supportedActions, Qt::DropAction defaultAction); diff --git a/src/gui/kernel/qevent.cpp b/src/gui/kernel/qevent.cpp index 0e35fb7d7b..f6d1da45e3 100644 --- a/src/gui/kernel/qevent.cpp +++ b/src/gui/kernel/qevent.cpp @@ -2533,6 +2533,7 @@ QTabletEvent::QTabletEvent(Type type, const QPointF &pos, const QPointF &globalP */ QTabletEvent::~QTabletEvent() { + delete static_cast<QTabletEventPrivate *>(mExtra); } /*! @@ -3071,7 +3072,7 @@ QDropEvent::~QDropEvent() /*! If the source of the drag operation is a widget in this application, this function returns that source; otherwise it - returns 0. The source of the operation is the first parameter to + returns \nullptr. The source of the operation is the first parameter to the QDrag object used instantiate the drag. This is useful if your widget needs special behavior when dragging @@ -3513,7 +3514,7 @@ QActionEvent::~QActionEvent() \fn QAction *QActionEvent::before() const If type() is \l ActionAdded, returns the action that should - appear before action(). If this function returns 0, the action + appear before action(). If this function returns \nullptr, the action should be appended to already existing actions on the same widget. @@ -5425,7 +5426,7 @@ QPointingDeviceUniqueId QPointingDeviceUniqueId::fromNumericId(qint64 id) \sa isValid() */ -qint64 QPointingDeviceUniqueId::numericId() const Q_DECL_NOTHROW +qint64 QPointingDeviceUniqueId::numericId() const noexcept { return m_numericId; } @@ -5437,7 +5438,7 @@ qint64 QPointingDeviceUniqueId::numericId() const Q_DECL_NOTHROW Returns whether the two unique pointer IDs \a lhs and \a rhs identify the same pointer (\c true) or not (\c false). */ -bool operator==(QPointingDeviceUniqueId lhs, QPointingDeviceUniqueId rhs) Q_DECL_NOTHROW +bool operator==(QPointingDeviceUniqueId lhs, QPointingDeviceUniqueId rhs) noexcept { return lhs.numericId() == rhs.numericId(); } @@ -5457,7 +5458,7 @@ bool operator==(QPointingDeviceUniqueId lhs, QPointingDeviceUniqueId rhs) Q_DECL Returns the hash value for \a key, using \a seed to seed the calculation. */ -uint qHash(QPointingDeviceUniqueId key, uint seed) Q_DECL_NOTHROW +uint qHash(QPointingDeviceUniqueId key, uint seed) noexcept { return qHash(key.numericId(), seed); } diff --git a/src/gui/kernel/qevent.h b/src/gui/kernel/qevent.h index 2b1c6a6e31..aeefb53819 100644 --- a/src/gui/kernel/qevent.h +++ b/src/gui/kernel/qevent.h @@ -549,7 +549,7 @@ public: }; class Attribute { public: - Attribute(AttributeType typ, int s, int l, QVariant val) : type(typ), start(s), length(l), value(qMove(val)) {} + Attribute(AttributeType typ, int s, int l, QVariant val) : type(typ), start(s), length(l), value(std::move(val)) {} Attribute(AttributeType typ, int s, int l) : type(typ), start(s), length(l), value() {} AttributeType type; @@ -811,14 +811,14 @@ class Q_GUI_EXPORT QPointingDeviceUniqueId Q_PROPERTY(qint64 numericId READ numericId CONSTANT) public: Q_ALWAYS_INLINE - Q_DECL_CONSTEXPR QPointingDeviceUniqueId() Q_DECL_NOTHROW : m_numericId(-1) {} + Q_DECL_CONSTEXPR QPointingDeviceUniqueId() noexcept : m_numericId(-1) {} // compiler-generated copy/move ctor/assignment operators are ok! // compiler-generated dtor is ok! static QPointingDeviceUniqueId fromNumericId(qint64 id); - Q_ALWAYS_INLINE Q_DECL_CONSTEXPR bool isValid() const Q_DECL_NOTHROW { return m_numericId != -1; } - qint64 numericId() const Q_DECL_NOTHROW; + Q_ALWAYS_INLINE Q_DECL_CONSTEXPR bool isValid() const noexcept { return m_numericId != -1; } + qint64 numericId() const noexcept; private: // TODO: for TUIO 2, or any other type of complex token ID, an internal @@ -829,10 +829,10 @@ private: Q_DECLARE_TYPEINFO(QPointingDeviceUniqueId, Q_MOVABLE_TYPE); template <> class QList<QPointingDeviceUniqueId> {}; // to prevent instantiation: use QVector instead -Q_GUI_EXPORT bool operator==(QPointingDeviceUniqueId lhs, QPointingDeviceUniqueId rhs) Q_DECL_NOTHROW; -inline bool operator!=(QPointingDeviceUniqueId lhs, QPointingDeviceUniqueId rhs) Q_DECL_NOTHROW +Q_GUI_EXPORT bool operator==(QPointingDeviceUniqueId lhs, QPointingDeviceUniqueId rhs) noexcept; +inline bool operator!=(QPointingDeviceUniqueId lhs, QPointingDeviceUniqueId rhs) noexcept { return !operator==(lhs, rhs); } -Q_GUI_EXPORT uint qHash(QPointingDeviceUniqueId key, uint seed = 0) Q_DECL_NOTHROW; +Q_GUI_EXPORT uint qHash(QPointingDeviceUniqueId key, uint seed = 0) noexcept; @@ -856,10 +856,10 @@ public: explicit TouchPoint(int id = -1); TouchPoint(const TouchPoint &other); #ifdef Q_COMPILER_RVALUE_REFS - TouchPoint(TouchPoint &&other) Q_DECL_NOEXCEPT + TouchPoint(TouchPoint &&other) noexcept : d(nullptr) { qSwap(d, other.d); } - TouchPoint &operator=(TouchPoint &&other) Q_DECL_NOEXCEPT + TouchPoint &operator=(TouchPoint &&other) noexcept { qSwap(d, other.d); return *this; } #endif ~TouchPoint(); @@ -867,7 +867,7 @@ public: TouchPoint &operator=(const TouchPoint &other) { if ( d != other.d ) { TouchPoint copy(other); swap(copy); } return *this; } - void swap(TouchPoint &other) Q_DECL_NOEXCEPT + void swap(TouchPoint &other) noexcept { qSwap(d, other.d); } int id() const; diff --git a/src/gui/kernel/qguiapplication.cpp b/src/gui/kernel/qguiapplication.cpp index 34f453341f..429446829e 100644 --- a/src/gui/kernel/qguiapplication.cpp +++ b/src/gui/kernel/qguiapplication.cpp @@ -68,7 +68,7 @@ #include <qpalette.h> #include <qscreen.h> #include "qsessionmanager.h" -#include <private/qcolorprofile_p.h> +#include <private/qcolortrclut_p.h> #include <private/qscreen_p.h> #include <QtGui/qgenericpluginfactory.h> @@ -208,10 +208,12 @@ bool QGuiApplicationPrivate::obey_desktop_settings = true; QInputDeviceManager *QGuiApplicationPrivate::m_inputDeviceManager = 0; +qreal QGuiApplicationPrivate::m_maxDevicePixelRatio = 0.0; + static qreal fontSmoothingGamma = 1.7; extern void qRegisterGuiVariant(); -#ifndef QT_NO_ANIMATION +#if QT_CONFIG(animation) extern void qRegisterGuiGetInterpolator(); #endif @@ -803,7 +805,8 @@ static void updateBlockedStatusRecursion(QWindow *window, bool shouldBeBlocked) void QGuiApplicationPrivate::updateBlockedStatus(QWindow *window) { bool shouldBeBlocked = false; - if (!QWindowPrivate::get(window)->isPopup() && !self->modalWindowList.isEmpty()) + const bool popupType = (window->type() == Qt::ToolTip) || (window->type() == Qt::Popup); + if (!popupType && !self->modalWindowList.isEmpty()) shouldBeBlocked = self->isWindowBlocked(window); updateBlockedStatusRecursion(window, shouldBeBlocked); } @@ -1020,7 +1023,7 @@ QList<QScreen *> QGuiApplication::screens() } /*! - Returns the screen at \a point, or \c nullptr if outside of any screen. + Returns the screen at \a point, or \nullptr if outside of any screen. The \a point is in relation to the virtualGeometry() of each set of virtual siblings. If the point maps to more than one set of virtual siblings the first @@ -1092,17 +1095,19 @@ QScreen *QGuiApplication::screenAt(const QPoint &point) */ qreal QGuiApplication::devicePixelRatio() const { - // Cache topDevicePixelRatio, iterate through the screen list once only. - static qreal topDevicePixelRatio = 0.0; - if (!qFuzzyIsNull(topDevicePixelRatio)) { - return topDevicePixelRatio; - } + if (!qFuzzyIsNull(QGuiApplicationPrivate::m_maxDevicePixelRatio)) + return QGuiApplicationPrivate::m_maxDevicePixelRatio; - topDevicePixelRatio = 1.0; // make sure we never return 0. + QGuiApplicationPrivate::m_maxDevicePixelRatio = 1.0; // make sure we never return 0. for (QScreen *screen : qAsConst(QGuiApplicationPrivate::screen_list)) - topDevicePixelRatio = qMax(topDevicePixelRatio, screen->devicePixelRatio()); + QGuiApplicationPrivate::m_maxDevicePixelRatio = qMax(QGuiApplicationPrivate::m_maxDevicePixelRatio, screen->devicePixelRatio()); - return topDevicePixelRatio; + return QGuiApplicationPrivate::m_maxDevicePixelRatio; +} + +void QGuiApplicationPrivate::resetCachedDevicePixelRatio() +{ + m_maxDevicePixelRatio = 0.0; } /*! @@ -1167,7 +1172,7 @@ static void init_platform(const QString &pluginNamesWithArguments, const QString QStringList plugins = pluginNamesWithArguments.split(QLatin1Char(';')); QStringList platformArguments; QStringList availablePlugins = QPlatformIntegrationFactory::keys(platformPluginPath); - for (auto pluginArgument : plugins) { + for (const auto &pluginArgument : plugins) { // Split into platform name and arguments QStringList arguments = pluginArgument.split(QLatin1Char(':')); const QString name = arguments.takeFirst().toLower(); @@ -1420,7 +1425,7 @@ void QGuiApplicationPrivate::eventDispatcherReady() void QGuiApplicationPrivate::init() { - Q_TRACE(QGuiApplicationPrivate_init_entry); + Q_TRACE_SCOPE(QGuiApplicationPrivate_init); #if defined(Q_OS_MACOS) QMacAutoReleasePool pool; @@ -1528,7 +1533,7 @@ void QGuiApplicationPrivate::init() // trigger registering of QVariant's GUI types qRegisterGuiVariant(); -#ifndef QT_NO_ANIMATION +#if QT_CONFIG(animation) // trigger registering of animation interpolators qRegisterGuiGetInterpolator(); #endif @@ -1584,8 +1589,6 @@ void QGuiApplicationPrivate::init() if (!QGuiApplicationPrivate::displayName) QObject::connect(q, &QGuiApplication::applicationNameChanged, q, &QGuiApplication::applicationDisplayNameChanged); - - Q_TRACE(QGuiApplicationPrivate_init_exit); } extern void qt_cleanupFontDatabase(); @@ -1638,8 +1641,6 @@ QGuiApplicationPrivate::~QGuiApplicationPrivate() platform_theme = 0; delete platform_integration; platform_integration = 0; - delete m_a8ColorProfile.load(); - delete m_a32ColorProfile.load(); window_list.clear(); screen_list.clear(); @@ -1822,14 +1823,18 @@ bool QGuiApplicationPrivate::sendQWindowEventToQPlatformWindow(QWindow *window, return platformWindow->windowEvent(event); } +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QGuiApplicationPrivate::processNativeEvent(QWindow *window, const QByteArray &eventType, void *message, qintptr *result) +#else bool QGuiApplicationPrivate::processNativeEvent(QWindow *window, const QByteArray &eventType, void *message, long *result) +#endif { return window->nativeEvent(eventType, message, result); } void QGuiApplicationPrivate::processWindowSystemEvent(QWindowSystemInterfacePrivate::WindowSystemEvent *e) { - Q_TRACE(QGuiApplicationPrivate_processWindowSystemEvent_entry, e->type); + Q_TRACE_SCOPE(QGuiApplicationPrivate_processWindowSystemEvent, e->type); switch(e->type) { case QWindowSystemInterfacePrivate::Mouse: @@ -1939,8 +1944,6 @@ void QGuiApplicationPrivate::processWindowSystemEvent(QWindowSystemInterfacePriv qWarning() << "Unknown user input event type:" << e->type; break; } - - Q_TRACE(QGuiApplicationPrivate_processWindowSystemEvent_exit, e->type); } /*! \internal @@ -2182,8 +2185,6 @@ void QGuiApplicationPrivate::processWheelEvent(QWindowSystemInterfacePrivate::Wh #endif // QT_CONFIG(wheelevent) } -// Remember, Qt convention is: keyboard state is state *before* - void QGuiApplicationPrivate::processKeyEvent(QWindowSystemInterfacePrivate::KeyEvent *e) { QWindow *window = e->window.data(); @@ -2422,9 +2423,9 @@ void QGuiApplicationPrivate::processGeometryChangeEvent(QWindowSystemInterfacePr window->d_func()->resizeEventPending = false; if (actualGeometry.width() != lastReportedGeometry.width()) - window->widthChanged(actualGeometry.width()); + emit window->widthChanged(actualGeometry.width()); if (actualGeometry.height() != lastReportedGeometry.height()) - window->heightChanged(actualGeometry.height()); + emit window->heightChanged(actualGeometry.height()); } if (isMove) { @@ -2433,9 +2434,9 @@ void QGuiApplicationPrivate::processGeometryChangeEvent(QWindowSystemInterfacePr QGuiApplication::sendSpontaneousEvent(window, &e); if (actualGeometry.x() != lastReportedGeometry.x()) - window->xChanged(actualGeometry.x()); + emit window->xChanged(actualGeometry.x()); if (actualGeometry.y() != lastReportedGeometry.y()) - window->yChanged(actualGeometry.y()); + emit window->yChanged(actualGeometry.y()); } } @@ -2999,6 +3000,8 @@ void QGuiApplicationPrivate::processScreenGeometryChange(QWindowSystemInterfaceP for (QScreen* sibling : siblings) emit sibling->virtualGeometryChanged(sibling->virtualGeometry()); } + + resetCachedDevicePixelRatio(); } void QGuiApplicationPrivate::processScreenLogicalDotsPerInchChange(QWindowSystemInterfacePrivate::ScreenLogicalDotsPerInchEvent *e) @@ -3014,6 +3017,8 @@ void QGuiApplicationPrivate::processScreenLogicalDotsPerInchChange(QWindowSystem s->d_func()->logicalDpi = QDpi(e->dpiX, e->dpiY); emit s->logicalDotsPerInchChanged(s->logicalDotsPerInch()); + + resetCachedDevicePixelRatio(); } void QGuiApplicationPrivate::processScreenRefreshRateChange(QWindowSystemInterfacePrivate::ScreenRefreshRateEvent *e) @@ -3069,41 +3074,8 @@ void QGuiApplicationPrivate::processExposeEvent(QWindowSystemInterfacePrivate::E /*! \internal - This function updates an internal state to keep the source compatibility. Documentation of - QGuiApplication::mouseButtons() states - "The current state is updated synchronously as - the event queue is emptied of events that will spontaneously change the mouse state - (QEvent::MouseButtonPress and QEvent::MouseButtonRelease events)". But internally we have - been updating these state variables from various places to keep buttons returned by - mouseButtons() in sync with the systems state. This is not the documented behavior. - - ### Qt6 - Remove QGuiApplication::mouseButtons()/keyboardModifiers() API? And here - are the reasons: - - - It is an easy to misuse API by: - - a) Application developers: The only place where the values of this API can be trusted is - when using within mouse handling callbacks. In these callbacks we work with the state - that was provided directly by the windowing system. Anywhere else it might not reflect what - user wrongly expects. We might not always receive a matching mouse release for a press event - (e.g. When dismissing a popup window on X11. Or when dnd enter Qt application with mouse - button down, we update mouse_buttons and then dnd leaves Qt application and does a drop - somewhere else) and hence mouseButtons() will be out-of-sync from users perspective, see - for example QTBUG-33161. BUT THIS IS NOT HOW THE API IS SUPPOSED TO BE USED. Since the only - safe place to use this API is from mouse event handlers, we might as well deprecate it and - pass down the button state if we are not already doing that everywhere where it matters. - - b) Qt framework developers: - - We see users complaining, we start adding hacks everywhere just to keep buttons in sync ;) - There are corner cases that can not be solved and adding this kind of hacks is never ending - task. - - - Real mouse events, tablet mouse events, etc: all go through QGuiApplication::processMouseEvent, - and all share mouse_buttons. What if we want to support multiple mice in future? The API must - go. - - - Motivation why this API is public is not clear. Could the same be achieved by a user by - installing an event filter? + This function updates an internal state to keep the source compatibility. + ### Qt 6 - Won't need after QTBUG-73829 */ static void updateMouseAndModifierButtonState(Qt::MouseButtons buttons, Qt::KeyboardModifiers modifiers) { @@ -3746,7 +3718,7 @@ Qt::LayoutDirection QGuiApplication::layoutDirection() Returns the active application override cursor. - This function returns 0 if no application cursor has been defined (i.e. the + This function returns \nullptr if no application cursor has been defined (i.e. the internal cursor stack is empty). \sa setOverrideCursor(), restoreOverrideCursor() @@ -3982,6 +3954,9 @@ void QGuiApplicationPrivate::notifyThemeChanged() !QCoreApplication::testAttribute(Qt::AA_SetPalette)) { clearPalette(); initPalette(); + emit qGuiApp->paletteChanged(*app_pal); + if (is_app_running && !is_app_closing) + sendApplicationPaletteChange(); } if (!(applicationResourceFlags & ApplicationFontExplicitlySet)) { QMutexLocker locker(&applicationFontMutex); @@ -3990,6 +3965,15 @@ void QGuiApplicationPrivate::notifyThemeChanged() } } +void QGuiApplicationPrivate::sendApplicationPaletteChange(bool toAllWidgets, const char *className) +{ + Q_UNUSED(toAllWidgets) + Q_UNUSED(className) + + QEvent event(QEvent::ApplicationPaletteChange); + QGuiApplication::sendEvent(QGuiApplication::instance(), &event); +} + #if QT_CONFIG(draganddrop) void QGuiApplicationPrivate::notifyDragStarted(const QDrag *drag) { @@ -3998,32 +3982,26 @@ void QGuiApplicationPrivate::notifyDragStarted(const QDrag *drag) } #endif -const QColorProfile *QGuiApplicationPrivate::colorProfileForA8Text() +const QColorTrcLut *QGuiApplicationPrivate::colorProfileForA8Text() { #ifdef Q_OS_WIN - QColorProfile *result = m_a8ColorProfile.load(); - if (!result){ - QColorProfile *cs = QColorProfile::fromGamma(2.31); // This is a hard-coded thing for Windows text rendering - if (!m_a8ColorProfile.testAndSetRelease(0, cs)) - delete cs; - result = m_a8ColorProfile.load(); + if (!m_a8ColorProfile){ + QColorTrcLut *cs = QColorTrcLut::fromGamma(2.31); // This is a hard-coded thing for Windows text rendering + m_a8ColorProfile.reset(cs); } - return result; + return m_a8ColorProfile.get(); #else return colorProfileForA32Text(); #endif } -const QColorProfile *QGuiApplicationPrivate::colorProfileForA32Text() +const QColorTrcLut *QGuiApplicationPrivate::colorProfileForA32Text() { - QColorProfile *result = m_a32ColorProfile.load(); - if (!result){ - QColorProfile *cs = QColorProfile::fromGamma(fontSmoothingGamma); - if (!m_a32ColorProfile.testAndSetRelease(0, cs)) - delete cs; - result = m_a32ColorProfile.load(); + if (!m_a32ColorProfile) { + QColorTrcLut *cs = QColorTrcLut::fromGamma(fontSmoothingGamma); + m_a32ColorProfile.reset(cs); } - return result; + return m_a32ColorProfile.get(); } void QGuiApplicationPrivate::_q_updateFocusObject(QObject *object) diff --git a/src/gui/kernel/qguiapplication_p.h b/src/gui/kernel/qguiapplication_p.h index 79c1a1c820..c9619daa3d 100644 --- a/src/gui/kernel/qguiapplication_p.h +++ b/src/gui/kernel/qguiapplication_p.h @@ -55,6 +55,7 @@ #include <QtGui/qguiapplication.h> #include <QtCore/QPointF> +#include <QtCore/QSharedPointer> #include <QtCore/private/qcoreapplication_p.h> #include <QtCore/private/qthread_p.h> @@ -66,7 +67,7 @@ QT_BEGIN_NAMESPACE -class QColorProfile; +class QColorTrcLut; class QPlatformIntegration; class QPlatformTheme; class QPlatformDragQtResponse; @@ -114,7 +115,7 @@ public: if (QCoreApplication::instance()) return QCoreApplication::instance()->d_func()->threadData->eventDispatcher.load(); else - return 0; + return nullptr; } static void processMouseEvent(QWindowSystemInterfacePrivate::MouseEvent *e); @@ -171,7 +172,11 @@ public: Qt::MouseButtons buttons, Qt::KeyboardModifiers modifiers); #endif +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + static bool processNativeEvent(QWindow *window, const QByteArray &eventType, void *message, qintptr *result); +#else static bool processNativeEvent(QWindow *window, const QByteArray &eventType, void *message, long *result); +#endif static bool sendQWindowEventToQPlatformWindow(QWindow *window, QEvent *event); @@ -204,7 +209,7 @@ public: static void showModalWindow(QWindow *window); static void hideModalWindow(QWindow *window); static void updateBlockedStatus(QWindow *window); - virtual bool isWindowBlocked(QWindow *window, QWindow **blockingWindow = 0) const; + virtual bool isWindowBlocked(QWindow *window, QWindow **blockingWindow = nullptr) const; virtual bool popupActive() { return false; } static ulong mousePressTime; @@ -299,8 +304,8 @@ public: static QInputDeviceManager *inputDeviceManager(); - const QColorProfile *colorProfileForA8Text(); - const QColorProfile *colorProfileForA32Text(); + const QColorTrcLut *colorProfileForA8Text(); + const QColorTrcLut *colorProfileForA32Text(); // hook reimplemented in QApplication to apply the QStyle function on the QIcon virtual QPixmap applyQIconStyleHelper(QIcon::Mode, const QPixmap &basePixmap) const { return basePixmap; } @@ -311,8 +316,11 @@ public: static void setApplicationState(Qt::ApplicationState state, bool forcePropagate = false); + static void resetCachedDevicePixelRatio(); + protected: virtual void notifyThemeChanged(); + virtual void sendApplicationPaletteChange(bool toAllWidgets = false, const char *className = nullptr); bool tryCloseRemainingWindows(QWindowList processedWindows); #if QT_CONFIG(draganddrop) virtual void notifyDragStarted(const QDrag *); @@ -324,12 +332,16 @@ private: static QGuiApplicationPrivate *self; static QTouchDevice *m_fakeTouchDevice; static int m_fakeMouseSourcePointId; - QAtomicPointer<QColorProfile> m_a8ColorProfile; - QAtomicPointer<QColorProfile> m_a32ColorProfile; + QSharedPointer<QColorTrcLut> m_a8ColorProfile; + QSharedPointer<QColorTrcLut> m_a32ColorProfile; bool ownGlobalShareContext; static QInputDeviceManager *m_inputDeviceManager; + + // Cache the maximum device pixel ratio, to iterate through the screen list + // only the first time it's required, or when devices are added or removed. + static qreal m_maxDevicePixelRatio; }; Q_GUI_EXPORT uint qHash(const QGuiApplicationPrivate::ActiveTouchPointsKey &k); diff --git a/src/gui/kernel/qhighdpiscaling.cpp b/src/gui/kernel/qhighdpiscaling.cpp index a455aa639d..22e46e0851 100644 --- a/src/gui/kernel/qhighdpiscaling.cpp +++ b/src/gui/kernel/qhighdpiscaling.cpp @@ -313,9 +313,12 @@ void QHighDpiScaling::updateHighDpiScaling() } m_active = m_globalScalingActive || m_screenFactorSet || m_pixelDensityScalingActive; - QPlatformScreen *primaryScreen = QGuiApplication::primaryScreen()->handle(); - qreal sf = screenSubfactor(primaryScreen); - QDpi primaryDpi = primaryScreen->logicalDpi(); + QScreen *primaryScreen = QGuiApplication::primaryScreen(); + if (!primaryScreen) + return; + QPlatformScreen *platformScreen = primaryScreen->handle(); + qreal sf = screenSubfactor(platformScreen); + QDpi primaryDpi = platformScreen->logicalDpi(); m_logicalDpi = QDpi(primaryDpi.first / sf, primaryDpi.second / sf); } diff --git a/src/gui/kernel/qinputmethod_p.h b/src/gui/kernel/qinputmethod_p.h index 0c2b739d92..5657edeb4e 100644 --- a/src/gui/kernel/qinputmethod_p.h +++ b/src/gui/kernel/qinputmethod_p.h @@ -67,7 +67,7 @@ class QInputMethodPrivate : public QObjectPrivate Q_DECLARE_PUBLIC(QInputMethod) public: - inline QInputMethodPrivate() : testContext(0) + inline QInputMethodPrivate() : testContext(nullptr) {} QPlatformInputContext *platformInputContext() const { diff --git a/src/gui/kernel/qkeymapper_p.h b/src/gui/kernel/qkeymapper_p.h index aeec7b7414..8364557020 100644 --- a/src/gui/kernel/qkeymapper_p.h +++ b/src/gui/kernel/qkeymapper_p.h @@ -76,7 +76,7 @@ public: private: friend QKeyMapperPrivate *qt_keymapper_private(); Q_DECLARE_PRIVATE(QKeyMapper) - Q_DISABLE_COPY(QKeyMapper) + Q_DISABLE_COPY_MOVE(QKeyMapper) }; struct KeyboardLayoutItem; diff --git a/src/gui/kernel/qkeysequence.cpp b/src/gui/kernel/qkeysequence.cpp index a428da8ca4..0fa3dcfbdb 100644 --- a/src/gui/kernel/qkeysequence.cpp +++ b/src/gui/kernel/qkeysequence.cpp @@ -1221,10 +1221,12 @@ QString QKeySequence::encodeString(int key) static inline void addKey(QString &str, const QString &theKey, QKeySequence::SequenceFormat format) { if (!str.isEmpty()) { - if (format == QKeySequence::NativeText) + if (format == QKeySequence::NativeText) { + //: Key separator in shortcut string str += QCoreApplication::translate("QShortcut", "+"); - else + } else { str += QLatin1Char('+'); + } } str += theKey; @@ -1464,7 +1466,7 @@ bool QKeySequence::operator==(const QKeySequence &other) const Calculates the hash value of \a key, using \a seed to seed the calculation. */ -uint qHash(const QKeySequence &key, uint seed) Q_DECL_NOTHROW +uint qHash(const QKeySequence &key, uint seed) noexcept { return qHashRange(key.d->key, key.d->key + QKeySequencePrivate::MaxKeyCount, seed); } diff --git a/src/gui/kernel/qkeysequence.h b/src/gui/kernel/qkeysequence.h index 65f3a93d9c..5630bdda58 100644 --- a/src/gui/kernel/qkeysequence.h +++ b/src/gui/kernel/qkeysequence.h @@ -66,7 +66,7 @@ void qt_set_sequence_auto_mnemonic(bool b); class QVariant; class QKeySequencePrivate; -Q_GUI_EXPORT Q_DECL_PURE_FUNCTION uint qHash(const QKeySequence &key, uint seed = 0) Q_DECL_NOTHROW; +Q_GUI_EXPORT Q_DECL_PURE_FUNCTION uint qHash(const QKeySequence &key, uint seed = 0) noexcept; class Q_GUI_EXPORT QKeySequence { @@ -187,9 +187,9 @@ public: int operator[](uint i) const; QKeySequence &operator=(const QKeySequence &other); #ifdef Q_COMPILER_RVALUE_REFS - QKeySequence &operator=(QKeySequence &&other) Q_DECL_NOTHROW { swap(other); return *this; } + QKeySequence &operator=(QKeySequence &&other) noexcept { swap(other); return *this; } #endif - void swap(QKeySequence &other) Q_DECL_NOTHROW { qSwap(d, other.d); } + void swap(QKeySequence &other) noexcept { qSwap(d, other.d); } bool operator==(const QKeySequence &other) const; inline bool operator!= (const QKeySequence &other) const @@ -214,7 +214,7 @@ private: friend Q_GUI_EXPORT QDataStream &operator<<(QDataStream &in, const QKeySequence &ks); friend Q_GUI_EXPORT QDataStream &operator>>(QDataStream &in, QKeySequence &ks); - friend Q_GUI_EXPORT uint qHash(const QKeySequence &key, uint seed) Q_DECL_NOTHROW; + friend Q_GUI_EXPORT uint qHash(const QKeySequence &key, uint seed) noexcept; friend class QShortcutMap; friend class QShortcut; diff --git a/src/gui/kernel/qopenglcontext.cpp b/src/gui/kernel/qopenglcontext.cpp index c5d5490ea0..bf3403f2e4 100644 --- a/src/gui/kernel/qopenglcontext.cpp +++ b/src/gui/kernel/qopenglcontext.cpp @@ -313,7 +313,7 @@ QOpenGLContext *qt_gl_global_share_context() \section1 Context Resource Sharing - Resources, such as framebuffer objects, textures, and vertex buffer objects + Resources such as textures and vertex buffer objects can be shared between contexts. Use setShareContext() before calling create() to specify that the contexts should share these resources. QOpenGLContext internally keeps track of a QOpenGLContextGroup object which @@ -414,15 +414,14 @@ int QOpenGLContextPrivate::maxTextureSize() /*! Returns the last context which called makeCurrent in the current thread, - or 0, if no context is current. + or \nullptr, if no context is current. */ QOpenGLContext* QOpenGLContext::currentContext() { QGuiGLThreadContext *threadContext = qwindow_context_storage()->localData(); - if (threadContext) { + if (threadContext) return threadContext->context; - } - return 0; + return nullptr; } /*! @@ -1118,7 +1117,7 @@ void QOpenGLContext::swapBuffers(QSurface *surface) /*! Resolves the function pointer to an OpenGL extension function, identified by \a procName - Returns 0 if no such function can be found. + Returns \nullptr if no such function can be found. */ QFunctionPointer QOpenGLContext::getProcAddress(const QByteArray &procName) const { @@ -1236,7 +1235,8 @@ void QOpenGLContext::deleteQGLContext() Returns the platform-specific handle for the OpenGL implementation that is currently in use. (for example, a HMODULE on Windows) - On platforms that do not use dynamic GL switch the return value is null. + On platforms that do not use dynamic GL switching, the return value + is \nullptr. The library might be GL-only, meaning that windowing system interface functions (for example EGL) may live in another, separate library. diff --git a/src/gui/kernel/qopenglcontext_p.h b/src/gui/kernel/qopenglcontext_p.h index 1cb7390687..c6ad893ee6 100644 --- a/src/gui/kernel/qopenglcontext_p.h +++ b/src/gui/kernel/qopenglcontext_p.h @@ -97,7 +97,7 @@ private: friend class QOpenGLContextGroupPrivate; friend class QOpenGLMultiGroupSharedResource; - Q_DISABLE_COPY(QOpenGLSharedResource) + Q_DISABLE_COPY_MOVE(QOpenGLSharedResource) }; class Q_GUI_EXPORT QOpenGLSharedResourceGuard : public QOpenGLSharedResource @@ -131,7 +131,7 @@ class Q_GUI_EXPORT QOpenGLContextGroupPrivate : public QObjectPrivate Q_DECLARE_PUBLIC(QOpenGLContextGroup) public: QOpenGLContextGroupPrivate() - : m_context(0) + : m_context(nullptr) , m_mutex(QMutex::Recursive) , m_refs(0) { @@ -198,20 +198,20 @@ class Q_GUI_EXPORT QOpenGLContextPrivate : public QObjectPrivate Q_DECLARE_PUBLIC(QOpenGLContext) public: QOpenGLContextPrivate() - : qGLContextHandle(0) - , qGLContextDeleteFunction(0) - , platformGLContext(0) - , shareContext(0) - , shareGroup(0) - , screen(0) - , surface(0) - , functions(0) - , textureFunctions(0) + : qGLContextHandle(nullptr) + , qGLContextDeleteFunction(nullptr) + , platformGLContext(nullptr) + , shareContext(nullptr) + , shareGroup(nullptr) + , screen(nullptr) + , surface(nullptr) + , functions(nullptr) + , textureFunctions(nullptr) , max_texture_size(-1) , workaround_brokenFBOReadBack(false) , workaround_brokenTexSubImage(false) , workaround_missingPrecisionQualifiers(false) - , active_engine(0) + , active_engine(nullptr) , qgl_current_fbo_invalid(false) , qgl_current_fbo(nullptr) , defaultFboRedirect(0) diff --git a/src/gui/kernel/qpalette.cpp b/src/gui/kernel/qpalette.cpp index 9ccfb9b819..b4383c5bfc 100644 --- a/src/gui/kernel/qpalette.cpp +++ b/src/gui/kernel/qpalette.cpp @@ -941,7 +941,8 @@ qint64 QPalette::cacheKey() const } /*! - Returns a new QPalette that has attributes copied from \a other. + Returns a new QPalette that is a union of this instance and \a other. + Color roles set in this instance take precedence. */ QPalette QPalette::resolve(const QPalette &other) const { @@ -959,6 +960,7 @@ QPalette QPalette::resolve(const QPalette &other) const if (!(data.resolve_mask & (1<<role))) for(int grp = 0; grp < (int)NColorGroups; grp++) palette.d->br[grp][role] = other.d->br[grp][role]; + palette.data.resolve_mask |= other.data.resolve_mask; return palette; } @@ -981,7 +983,7 @@ QPalette QPalette::resolve(const QPalette &other) const #ifndef QT_NO_DATASTREAM static const int NumOldRoles = 7; -static const int oldRoles[7] = { QPalette::Foreground, QPalette::Background, QPalette::Light, +static const int oldRoles[7] = { QPalette::WindowText, QPalette::Window, QPalette::Light, QPalette::Dark, QPalette::Mid, QPalette::Text, QPalette::Base }; /*! diff --git a/src/gui/kernel/qpalette.h b/src/gui/kernel/qpalette.h index 071eddbc4d..a463245d4d 100644 --- a/src/gui/kernel/qpalette.h +++ b/src/gui/kernel/qpalette.h @@ -68,17 +68,17 @@ public: ~QPalette(); QPalette &operator=(const QPalette &palette); #ifdef Q_COMPILER_RVALUE_REFS - QPalette(QPalette &&other) Q_DECL_NOTHROW + QPalette(QPalette &&other) noexcept : d(other.d), data(other.data) { other.d = nullptr; } - inline QPalette &operator=(QPalette &&other) Q_DECL_NOEXCEPT + inline QPalette &operator=(QPalette &&other) noexcept { for_faster_swapping_dont_use = other.for_faster_swapping_dont_use; qSwap(d, other.d); return *this; } #endif - void swap(QPalette &other) Q_DECL_NOEXCEPT + void swap(QPalette &other) noexcept { qSwap(d, other.d); qSwap(for_faster_swapping_dont_use, other.for_faster_swapping_dont_use); @@ -98,7 +98,10 @@ public: ToolTipBase, ToolTipText, PlaceholderText, NColorRoles = PlaceholderText + 1, - Foreground = WindowText, Background = Window +#if QT_DEPRECATED_SINCE(5, 13) + Foreground Q_DECL_ENUMERATOR_DEPRECATED_X("Use QPalette::WindowText instead") = WindowText, + Background Q_DECL_ENUMERATOR_DEPRECATED_X("Use QPalette::Window instead") = Window +#endif }; Q_ENUM(ColorRole) @@ -121,7 +124,6 @@ public: inline const QColor &color(ColorRole cr) const { return color(Current, cr); } inline const QBrush &brush(ColorRole cr) const { return brush(Current, cr); } - inline const QBrush &foreground() const { return brush(WindowText); } inline const QBrush &windowText() const { return brush(WindowText); } inline const QBrush &button() const { return brush(Button); } inline const QBrush &light() const { return brush(Light); } @@ -132,7 +134,6 @@ public: inline const QBrush &alternateBase() const { return brush(AlternateBase); } inline const QBrush &toolTipBase() const { return brush(ToolTipBase); } inline const QBrush &toolTipText() const { return brush(ToolTipText); } - inline const QBrush &background() const { return brush(Window); } inline const QBrush &window() const { return brush(Window); } inline const QBrush &midlight() const { return brush(Midlight); } inline const QBrush &brightText() const { return brush(BrightText); } @@ -143,6 +144,12 @@ public: inline const QBrush &link() const { return brush(Link); } inline const QBrush &linkVisited() const { return brush(LinkVisited); } inline const QBrush &placeholderText() const { return brush(PlaceholderText); } +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use QPalette::windowText() instead") + inline const QBrush &foreground() const { return windowText(); } + QT_DEPRECATED_X("Use QPalette::window() instead") + inline const QBrush &background() const { return window(); } +#endif bool operator==(const QPalette &p) const; inline bool operator!=(const QPalette &p) const { return !(operator==(p)); } diff --git a/src/gui/kernel/qpixelformat.h b/src/gui/kernel/qpixelformat.h index 6b2d6a6ac7..a041a39fc1 100644 --- a/src/gui/kernel/qpixelformat.h +++ b/src/gui/kernel/qpixelformat.h @@ -95,7 +95,7 @@ class QPixelFormat Q_STATIC_ASSERT(uint(TotalFieldWidthByWidths) == uint(TotalFieldWidthByOffsets)); Q_STATIC_ASSERT(uint(TotalFieldWidthByWidths) == 8 * sizeof(quint64)); - Q_DECL_CONSTEXPR inline uchar get(Field offset, FieldWidth width) const Q_DECL_NOTHROW + Q_DECL_CONSTEXPR inline uchar get(Field offset, FieldWidth width) const noexcept { return uchar((data >> uint(offset)) & ((Q_UINT64_C(1) << uint(width)) - Q_UINT64_C(1))); } Q_DECL_CONSTEXPR static inline quint64 set(Field offset, FieldWidth width, uchar value) { return (quint64(value) & ((Q_UINT64_C(1) << uint(width)) - Q_UINT64_C(1))) << uint(offset); } @@ -160,7 +160,7 @@ public: CurrentSystemEndian }; - Q_DECL_CONSTEXPR inline QPixelFormat() Q_DECL_NOTHROW : data(0) {} + Q_DECL_CONSTEXPR inline QPixelFormat() noexcept : data(0) {} Q_DECL_CONSTEXPR inline QPixelFormat(ColorModel colorModel, uchar firstSize, uchar secondSize, @@ -173,47 +173,47 @@ public: AlphaPremultiplied premultiplied, TypeInterpretation typeInterpretation, ByteOrder byteOrder = CurrentSystemEndian, - uchar subEnum = 0) Q_DECL_NOTHROW; + uchar subEnum = 0) noexcept; - Q_DECL_CONSTEXPR inline ColorModel colorModel() const Q_DECL_NOTHROW { return ColorModel(get(ModelField, ModelFieldWidth)); } - Q_DECL_CONSTEXPR inline uchar channelCount() const Q_DECL_NOTHROW { return (get(FirstField, FirstFieldWidth) > 0) + + Q_DECL_CONSTEXPR inline ColorModel colorModel() const noexcept { return ColorModel(get(ModelField, ModelFieldWidth)); } + Q_DECL_CONSTEXPR inline uchar channelCount() const noexcept { return (get(FirstField, FirstFieldWidth) > 0) + (get(SecondField, SecondFieldWidth) > 0) + (get(ThirdField, ThirdFieldWidth) > 0) + (get(FourthField, FourthFieldWidth) > 0) + (get(FifthField, FifthFieldWidth) > 0) + (get(AlphaField, AlphaFieldWidth) > 0); } - Q_DECL_CONSTEXPR inline uchar redSize() const Q_DECL_NOTHROW { return get(FirstField, FirstFieldWidth); } - Q_DECL_CONSTEXPR inline uchar greenSize() const Q_DECL_NOTHROW { return get(SecondField, SecondFieldWidth); } - Q_DECL_CONSTEXPR inline uchar blueSize() const Q_DECL_NOTHROW { return get(ThirdField, ThirdFieldWidth); } + Q_DECL_CONSTEXPR inline uchar redSize() const noexcept { return get(FirstField, FirstFieldWidth); } + Q_DECL_CONSTEXPR inline uchar greenSize() const noexcept { return get(SecondField, SecondFieldWidth); } + Q_DECL_CONSTEXPR inline uchar blueSize() const noexcept { return get(ThirdField, ThirdFieldWidth); } - Q_DECL_CONSTEXPR inline uchar cyanSize() const Q_DECL_NOTHROW { return get(FirstField, FirstFieldWidth); } - Q_DECL_CONSTEXPR inline uchar magentaSize() const Q_DECL_NOTHROW { return get(SecondField, SecondFieldWidth); } - Q_DECL_CONSTEXPR inline uchar yellowSize() const Q_DECL_NOTHROW { return get(ThirdField, ThirdFieldWidth); } - Q_DECL_CONSTEXPR inline uchar blackSize() const Q_DECL_NOTHROW { return get(FourthField, FourthFieldWidth); } + Q_DECL_CONSTEXPR inline uchar cyanSize() const noexcept { return get(FirstField, FirstFieldWidth); } + Q_DECL_CONSTEXPR inline uchar magentaSize() const noexcept { return get(SecondField, SecondFieldWidth); } + Q_DECL_CONSTEXPR inline uchar yellowSize() const noexcept { return get(ThirdField, ThirdFieldWidth); } + Q_DECL_CONSTEXPR inline uchar blackSize() const noexcept { return get(FourthField, FourthFieldWidth); } - Q_DECL_CONSTEXPR inline uchar hueSize() const Q_DECL_NOTHROW { return get(FirstField, FirstFieldWidth); } - Q_DECL_CONSTEXPR inline uchar saturationSize() const Q_DECL_NOTHROW { return get(SecondField, SecondFieldWidth); } - Q_DECL_CONSTEXPR inline uchar lightnessSize() const Q_DECL_NOTHROW { return get(ThirdField, ThirdFieldWidth); } - Q_DECL_CONSTEXPR inline uchar brightnessSize() const Q_DECL_NOTHROW { return get(ThirdField, ThirdFieldWidth); } + Q_DECL_CONSTEXPR inline uchar hueSize() const noexcept { return get(FirstField, FirstFieldWidth); } + Q_DECL_CONSTEXPR inline uchar saturationSize() const noexcept { return get(SecondField, SecondFieldWidth); } + Q_DECL_CONSTEXPR inline uchar lightnessSize() const noexcept { return get(ThirdField, ThirdFieldWidth); } + Q_DECL_CONSTEXPR inline uchar brightnessSize() const noexcept { return get(ThirdField, ThirdFieldWidth); } - Q_DECL_CONSTEXPR inline uchar alphaSize() const Q_DECL_NOTHROW { return get(AlphaField, AlphaFieldWidth); } + Q_DECL_CONSTEXPR inline uchar alphaSize() const noexcept { return get(AlphaField, AlphaFieldWidth); } - Q_DECL_CONSTEXPR inline uchar bitsPerPixel() const Q_DECL_NOTHROW { return get(FirstField, FirstFieldWidth) + + Q_DECL_CONSTEXPR inline uchar bitsPerPixel() const noexcept { return get(FirstField, FirstFieldWidth) + get(SecondField, SecondFieldWidth) + get(ThirdField, ThirdFieldWidth) + get(FourthField, FourthFieldWidth) + get(FifthField, FifthFieldWidth) + get(AlphaField, AlphaFieldWidth); } - Q_DECL_CONSTEXPR inline AlphaUsage alphaUsage() const Q_DECL_NOTHROW { return AlphaUsage(get(AlphaUsageField, AlphaUsageFieldWidth)); } - Q_DECL_CONSTEXPR inline AlphaPosition alphaPosition() const Q_DECL_NOTHROW { return AlphaPosition(get(AlphaPositionField, AlphaPositionFieldWidth)); } - Q_DECL_CONSTEXPR inline AlphaPremultiplied premultiplied() const Q_DECL_NOTHROW { return AlphaPremultiplied(get(PremulField, PremulFieldWidth)); } - Q_DECL_CONSTEXPR inline TypeInterpretation typeInterpretation() const Q_DECL_NOTHROW { return TypeInterpretation(get(TypeInterpretationField, TypeInterpretationFieldWidth)); } - Q_DECL_CONSTEXPR inline ByteOrder byteOrder() const Q_DECL_NOTHROW { return ByteOrder(get(ByteOrderField, ByteOrderFieldWidth)); } + Q_DECL_CONSTEXPR inline AlphaUsage alphaUsage() const noexcept { return AlphaUsage(get(AlphaUsageField, AlphaUsageFieldWidth)); } + Q_DECL_CONSTEXPR inline AlphaPosition alphaPosition() const noexcept { return AlphaPosition(get(AlphaPositionField, AlphaPositionFieldWidth)); } + Q_DECL_CONSTEXPR inline AlphaPremultiplied premultiplied() const noexcept { return AlphaPremultiplied(get(PremulField, PremulFieldWidth)); } + Q_DECL_CONSTEXPR inline TypeInterpretation typeInterpretation() const noexcept { return TypeInterpretation(get(TypeInterpretationField, TypeInterpretationFieldWidth)); } + Q_DECL_CONSTEXPR inline ByteOrder byteOrder() const noexcept { return ByteOrder(get(ByteOrderField, ByteOrderFieldWidth)); } - Q_DECL_CONSTEXPR inline YUVLayout yuvLayout() const Q_DECL_NOTHROW { return YUVLayout(get(SubEnumField, SubEnumFieldWidth)); } - Q_DECL_CONSTEXPR inline uchar subEnum() const Q_DECL_NOTHROW { return get(SubEnumField, SubEnumFieldWidth); } + Q_DECL_CONSTEXPR inline YUVLayout yuvLayout() const noexcept { return YUVLayout(get(SubEnumField, SubEnumFieldWidth)); } + Q_DECL_CONSTEXPR inline uchar subEnum() const noexcept { return get(SubEnumField, SubEnumFieldWidth); } private: Q_DECL_CONSTEXPR static inline ByteOrder resolveByteOrder(ByteOrder bo) @@ -255,7 +255,7 @@ QPixelFormat::QPixelFormat(ColorModel mdl, AlphaPremultiplied premult, TypeInterpretation typeInterp, ByteOrder b_order, - uchar s_enum) Q_DECL_NOTHROW + uchar s_enum) noexcept : data(set(ModelField, ModelFieldWidth, uchar(mdl)) | set(FirstField, FirstFieldWidth, firstSize) | set(SecondField, SecondFieldWidth, secondSize) | @@ -280,7 +280,7 @@ Q_DECL_CONSTEXPR inline QPixelFormat qPixelFormatRgba(uchar red, QPixelFormat::AlphaUsage usage, QPixelFormat::AlphaPosition position, QPixelFormat::AlphaPremultiplied pmul=QPixelFormat::NotPremultiplied, - QPixelFormat::TypeInterpretation typeInt=QPixelFormat::UnsignedInteger) Q_DECL_NOTHROW + QPixelFormat::TypeInterpretation typeInt=QPixelFormat::UnsignedInteger) noexcept { return QPixelFormat(QPixelFormat::RGB, red, @@ -296,7 +296,7 @@ Q_DECL_CONSTEXPR inline QPixelFormat qPixelFormatRgba(uchar red, } Q_DECL_CONSTEXPR inline QPixelFormat qPixelFormatGrayscale(uchar channelSize, - QPixelFormat::TypeInterpretation typeInt=QPixelFormat::UnsignedInteger) Q_DECL_NOTHROW + QPixelFormat::TypeInterpretation typeInt=QPixelFormat::UnsignedInteger) noexcept { return QPixelFormat(QPixelFormat::Grayscale, channelSize, @@ -312,7 +312,7 @@ Q_DECL_CONSTEXPR inline QPixelFormat qPixelFormatGrayscale(uchar channelSize, } Q_DECL_CONSTEXPR inline QPixelFormat qPixelFormatAlpha(uchar channelSize, - QPixelFormat::TypeInterpretation typeInt=QPixelFormat::UnsignedInteger) Q_DECL_NOTHROW + QPixelFormat::TypeInterpretation typeInt=QPixelFormat::UnsignedInteger) noexcept { return QPixelFormat(QPixelFormat::Alpha, 0, @@ -331,7 +331,7 @@ Q_DECL_CONSTEXPR inline QPixelFormat qPixelFormatCmyk(uchar channelSize, uchar alfa=0, QPixelFormat::AlphaUsage usage=QPixelFormat::IgnoresAlpha, QPixelFormat::AlphaPosition position=QPixelFormat::AtBeginning, - QPixelFormat::TypeInterpretation typeInt=QPixelFormat::UnsignedInteger) Q_DECL_NOTHROW + QPixelFormat::TypeInterpretation typeInt=QPixelFormat::UnsignedInteger) noexcept { return QPixelFormat(QPixelFormat::CMYK, channelSize, @@ -350,7 +350,7 @@ Q_DECL_CONSTEXPR inline QPixelFormat qPixelFormatHsl(uchar channelSize, uchar alfa=0, QPixelFormat::AlphaUsage usage=QPixelFormat::IgnoresAlpha, QPixelFormat::AlphaPosition position=QPixelFormat::AtBeginning, - QPixelFormat::TypeInterpretation typeInt=QPixelFormat::FloatingPoint) Q_DECL_NOTHROW + QPixelFormat::TypeInterpretation typeInt=QPixelFormat::FloatingPoint) noexcept { return QPixelFormat(QPixelFormat::HSL, channelSize, @@ -369,7 +369,7 @@ Q_DECL_CONSTEXPR inline QPixelFormat qPixelFormatHsv(uchar channelSize, uchar alfa=0, QPixelFormat::AlphaUsage usage=QPixelFormat::IgnoresAlpha, QPixelFormat::AlphaPosition position=QPixelFormat::AtBeginning, - QPixelFormat::TypeInterpretation typeInt=QPixelFormat::FloatingPoint) Q_DECL_NOTHROW + QPixelFormat::TypeInterpretation typeInt=QPixelFormat::FloatingPoint) noexcept { return QPixelFormat(QPixelFormat::HSV, channelSize, diff --git a/src/gui/kernel/qplatformclipboard.h b/src/gui/kernel/qplatformclipboard.h index 60733b0a9f..3220201720 100644 --- a/src/gui/kernel/qplatformclipboard.h +++ b/src/gui/kernel/qplatformclipboard.h @@ -61,6 +61,9 @@ QT_BEGIN_NAMESPACE class Q_GUI_EXPORT QPlatformClipboard { public: + Q_DISABLE_COPY_MOVE(QPlatformClipboard) + + QPlatformClipboard() = default; virtual ~QPlatformClipboard(); virtual QMimeData *mimeData(QClipboard::Mode mode = QClipboard::Clipboard); diff --git a/src/gui/kernel/qplatformcursor.cpp b/src/gui/kernel/qplatformcursor.cpp index bab26f6028..49eff2ad23 100644 --- a/src/gui/kernel/qplatformcursor.cpp +++ b/src/gui/kernel/qplatformcursor.cpp @@ -84,12 +84,12 @@ QT_BEGIN_NAMESPACE \a windowCursor is a pointer to the QCursor that should be displayed. - To unset the cursor of \a window, 0 is passed. This means \a window does not have + To unset the cursor of \a window, \nullptr is passed. This means \a window does not have a cursor set and the cursor of a the first parent window which has a cursor explicitly set or the system default cursor should take effect. \a window is a pointer to the window currently displayed at QCursor::pos(). Note - that this may be 0 if the current position is not occupied by a displayed widget. + that this may be \nullptr if the current position is not occupied by a displayed widget. \sa QCursor::pos() */ diff --git a/src/gui/kernel/qplatformcursor.h b/src/gui/kernel/qplatformcursor.h index 40e8a562f8..f36a73c861 100644 --- a/src/gui/kernel/qplatformcursor.h +++ b/src/gui/kernel/qplatformcursor.h @@ -78,6 +78,8 @@ private: class Q_GUI_EXPORT QPlatformCursor : public QObject { public: + Q_DISABLE_COPY_MOVE(QPlatformCursor) + enum Capability { OverrideCursor = 0x1 }; diff --git a/src/gui/kernel/qplatformdialoghelper.cpp b/src/gui/kernel/qplatformdialoghelper.cpp index 6a0adca9ca..d14d575056 100644 --- a/src/gui/kernel/qplatformdialoghelper.cpp +++ b/src/gui/kernel/qplatformdialoghelper.cpp @@ -41,8 +41,11 @@ #include <QtCore/QCoreApplication> #include <QtCore/QVariant> +#include <QtCore/QRegularExpression> #include <QtCore/QSharedData> +#if QT_CONFIG(settings) #include <QtCore/QSettings> +#endif #include <QtCore/QUrl> #include <QtCore/QVector> #include <QtGui/QColor> @@ -296,7 +299,7 @@ QColorDialogStaticData::QColorDialogStaticData() : customSet(false) void QColorDialogStaticData::readSettings() { -#ifndef QT_NO_SETTINGS +#if QT_CONFIG(settings) const QSettings settings(QSettings::UserScope, QStringLiteral("QtProject")); for (int i = 0; i < int(CustomColorCount); ++i) { const QVariant v = settings.value(QLatin1String("Qt/customColors/") + QString::number(i)); @@ -308,7 +311,7 @@ void QColorDialogStaticData::readSettings() void QColorDialogStaticData::writeSettings() const { -#ifndef QT_NO_SETTINGS +#if QT_CONFIG(settings) if (customSet) { const_cast<QColorDialogStaticData*>(this)->customSet = false; QSettings settings(QSettings::UserScope, QStringLiteral("QtProject")); @@ -777,18 +780,19 @@ void QPlatformFileDialogHelper::setOptions(const QSharedPointer<QFileDialogOptio m_options = options; } -const char *QPlatformFileDialogHelper::filterRegExp = +const char QPlatformFileDialogHelper::filterRegExp[] = "^(.*)\\(([a-zA-Z0-9_.,*? +;#\\-\\[\\]@\\{\\}/!<>\\$%&=^~:\\|]*)\\)$"; // Makes a list of filters from a normal filter string "Image Files (*.png *.jpg)" QStringList QPlatformFileDialogHelper::cleanFilterList(const QString &filter) { - QRegExp regexp(QString::fromLatin1(filterRegExp)); + QRegularExpression regexp(QString::fromLatin1(filterRegExp)); Q_ASSERT(regexp.isValid()); QString f = filter; - int i = regexp.indexIn(f); - if (i >= 0) - f = regexp.cap(2); + QRegularExpressionMatch match; + filter.indexOf(regexp, 0, &match); + if (match.hasMatch()) + f = match.captured(2); return f.split(QLatin1Char(' '), QString::SkipEmptyParts); } diff --git a/src/gui/kernel/qplatformdialoghelper.h b/src/gui/kernel/qplatformdialoghelper.h index 0832e19dc3..f09bec12da 100644 --- a/src/gui/kernel/qplatformdialoghelper.h +++ b/src/gui/kernel/qplatformdialoghelper.h @@ -414,7 +414,7 @@ public: void setOptions(const QSharedPointer<QFileDialogOptions> &options); static QStringList cleanFilterList(const QString &filter); - static const char *filterRegExp; + static const char filterRegExp[]; Q_SIGNALS: void fileSelected(const QUrl &file); diff --git a/src/gui/kernel/qplatformdrag.h b/src/gui/kernel/qplatformdrag.h index 9d4e352b4b..0c99539357 100644 --- a/src/gui/kernel/qplatformdrag.h +++ b/src/gui/kernel/qplatformdrag.h @@ -91,6 +91,8 @@ class Q_GUI_EXPORT QPlatformDrag { Q_DECLARE_PRIVATE(QPlatformDrag) public: + Q_DISABLE_COPY_MOVE(QPlatformDrag) + QPlatformDrag(); virtual ~QPlatformDrag(); @@ -108,8 +110,6 @@ public: private: QPlatformDragPrivate *d_ptr; - - Q_DISABLE_COPY(QPlatformDrag) }; QT_END_NAMESPACE diff --git a/src/gui/kernel/qplatformgraphicsbuffer.cpp b/src/gui/kernel/qplatformgraphicsbuffer.cpp index cc01efd6db..73ec033e19 100644 --- a/src/gui/kernel/qplatformgraphicsbuffer.cpp +++ b/src/gui/kernel/qplatformgraphicsbuffer.cpp @@ -184,7 +184,7 @@ void QPlatformGraphicsBuffer::unlock() \fn QPlatformGraphicsBuffer::doLock(AccessTypes access, const QRect &rect = QRect()) This function should be reimplemented by subclasses. If one of the \a - access types specified can not be locked, then all should fail and this + access types specified cannot be locked, then all should fail and this function should return false. \a rect is the subrect which is desired to be locked. This @@ -237,7 +237,6 @@ uchar *QPlatformGraphicsBuffer::data() */ int QPlatformGraphicsBuffer::byteCount() const { - Q_ASSERT(isLocked() & SWReadAccess); return size().height() * bytesPerLine(); } diff --git a/src/gui/kernel/qplatformgraphicsbuffer.h b/src/gui/kernel/qplatformgraphicsbuffer.h index 65c24bebc9..9004116ea4 100644 --- a/src/gui/kernel/qplatformgraphicsbuffer.h +++ b/src/gui/kernel/qplatformgraphicsbuffer.h @@ -71,12 +71,14 @@ public: TextureAccess = 0x04, HWCompositor = 0x08 }; + Q_ENUM(AccessType); Q_DECLARE_FLAGS(AccessTypes, AccessType); enum Origin { OriginBottomLeft, OriginTopLeft }; + Q_ENUM(Origin); ~QPlatformGraphicsBuffer(); diff --git a/src/gui/kernel/qplatformgraphicsbufferhelper.cpp b/src/gui/kernel/qplatformgraphicsbufferhelper.cpp index 924266997d..c67e6d15cb 100644 --- a/src/gui/kernel/qplatformgraphicsbufferhelper.cpp +++ b/src/gui/kernel/qplatformgraphicsbufferhelper.cpp @@ -3,7 +3,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtPlatformSupport module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage @@ -57,6 +57,12 @@ QT_BEGIN_NAMESPACE /*! + \namespace QPlatformGraphicsBufferHelper + \inmodule QtGui + \internal +*/ + +/*! Convenience function to both lock and bind the \a graphicsBuffer to a texture. This function will first try to lock with texture read and texture write access. If this succeeds it will use the bindToTexture function to bind the diff --git a/src/gui/kernel/qplatformgraphicsbufferhelper.h b/src/gui/kernel/qplatformgraphicsbufferhelper.h index 6307f54a3e..bfe61713d4 100644 --- a/src/gui/kernel/qplatformgraphicsbufferhelper.h +++ b/src/gui/kernel/qplatformgraphicsbufferhelper.h @@ -3,7 +3,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtPlatformSupport module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/kernel/qplatforminputcontextfactory.cpp b/src/gui/kernel/qplatforminputcontextfactory.cpp index c59d89fabe..df7b95d8df 100644 --- a/src/gui/kernel/qplatforminputcontextfactory.cpp +++ b/src/gui/kernel/qplatforminputcontextfactory.cpp @@ -48,14 +48,14 @@ QT_BEGIN_NAMESPACE -#ifndef QT_NO_SETTINGS +#if QT_CONFIG(settings) Q_GLOBAL_STATIC_WITH_ARGS(QFactoryLoader, loader, (QPlatformInputContextFactoryInterface_iid, QLatin1String("/platforminputcontexts"), Qt::CaseInsensitive)) #endif QStringList QPlatformInputContextFactory::keys() { -#ifndef QT_NO_SETTINGS +#if QT_CONFIG(settings) return loader()->keyMap().values(); #else return QStringList(); @@ -70,7 +70,7 @@ QString QPlatformInputContextFactory::requested() QPlatformInputContext *QPlatformInputContextFactory::create(const QString& key) { -#ifndef QT_NO_SETTINGS +#if QT_CONFIG(settings) if (!key.isEmpty()) { QStringList paramList = key.split(QLatin1Char(':')); const QString platform = paramList.takeFirst().toLower(); diff --git a/src/gui/kernel/qplatformintegration.cpp b/src/gui/kernel/qplatformintegration.cpp index 6e285a8fa5..490cfc6178 100644 --- a/src/gui/kernel/qplatformintegration.cpp +++ b/src/gui/kernel/qplatformintegration.cpp @@ -291,7 +291,7 @@ QPlatformPixmap *QPlatformIntegration::createPlatformPixmap(QPlatformPixmap::Pix platform implementation is responsible for querying the configuriation from the provided native context. - Returns a pointer to a QPlatformOpenGLContext instance or \c NULL if the context could + Returns a pointer to a QPlatformOpenGLContext instance or \nullptr if the context could not be created. \sa QOpenGLContext @@ -350,7 +350,7 @@ void QPlatformIntegration::destroy() /*! Returns the platforms input context. - The default implementation returns 0, implying no input method support. + The default implementation returns \nullptr, implying no input method support. */ QPlatformInputContext *QPlatformIntegration::inputContext() const { @@ -462,82 +462,6 @@ QList<int> QPlatformIntegration::possibleKeys(const QKeyEvent *) const return QList<int>(); } -/*! - Should be called by the implementation whenever a new screen is added. - - The first screen added will be the primary screen, used for default-created - windows, GL contexts, and other resources unless otherwise specified. - - This adds the screen to QGuiApplication::screens(), and emits the - QGuiApplication::screenAdded() signal. - - The screen should be deleted by calling QPlatformIntegration::destroyScreen(). -*/ -void QPlatformIntegration::screenAdded(QPlatformScreen *ps, bool isPrimary) -{ - QScreen *screen = new QScreen(ps); - - if (isPrimary) { - QGuiApplicationPrivate::screen_list.prepend(screen); - } else { - QGuiApplicationPrivate::screen_list.append(screen); - } - emit qGuiApp->screenAdded(screen); - - if (isPrimary) - emit qGuiApp->primaryScreenChanged(screen); -} - -/*! - Just removes the screen, call destroyScreen instead. - - \sa destroyScreen() -*/ - -void QPlatformIntegration::removeScreen(QScreen *screen) -{ - const bool wasPrimary = (!QGuiApplicationPrivate::screen_list.isEmpty() && QGuiApplicationPrivate::screen_list.at(0) == screen); - QGuiApplicationPrivate::screen_list.removeOne(screen); - - if (wasPrimary && qGuiApp && !QGuiApplicationPrivate::screen_list.isEmpty()) - emit qGuiApp->primaryScreenChanged(QGuiApplicationPrivate::screen_list.at(0)); -} - -/*! - Should be called by the implementation whenever a screen is removed. - - This removes the screen from QGuiApplication::screens(), and deletes it. - - Failing to call this and manually deleting the QPlatformScreen instead may - lead to a crash due to a pure virtual call. -*/ -void QPlatformIntegration::destroyScreen(QPlatformScreen *screen) -{ - QScreen *qScreen = screen->screen(); - removeScreen(qScreen); - delete qScreen; - delete screen; -} - -/*! - Should be called whenever the primary screen changes. - - When the screen specified as primary changes, this method will notify - QGuiApplication and emit the QGuiApplication::primaryScreenChanged signal. - */ - -void QPlatformIntegration::setPrimaryScreen(QPlatformScreen *newPrimary) -{ - QScreen* newPrimaryScreen = newPrimary->screen(); - int idx = QGuiApplicationPrivate::screen_list.indexOf(newPrimaryScreen); - Q_ASSERT(idx >= 0); - if (idx == 0) - return; - - QGuiApplicationPrivate::screen_list.swap(0, idx); - emit qGuiApp->primaryScreenChanged(newPrimaryScreen); -} - QStringList QPlatformIntegration::themeNames() const { return QStringList(); @@ -642,7 +566,7 @@ void QPlatformIntegration::setApplicationIcon(const QIcon &icon) const pointer to the instance for which a platform-specific backend needs to be created. - Returns a pointer to a QPlatformOpenGLContext instance or \c NULL if the context could + Returns a pointer to a QPlatformOpenGLContext instance or \nullptr if the context could not be created. \sa QVulkanInstance diff --git a/src/gui/kernel/qplatformintegration.h b/src/gui/kernel/qplatformintegration.h index efb1481f6d..b764bd2617 100644 --- a/src/gui/kernel/qplatformintegration.h +++ b/src/gui/kernel/qplatformintegration.h @@ -84,6 +84,8 @@ class QVulkanInstance; class Q_GUI_EXPORT QPlatformIntegration { public: + Q_DISABLE_COPY_MOVE(QPlatformIntegration) + enum Capability { ThreadedPixmaps = 1, OpenGL, @@ -112,7 +114,7 @@ public: virtual QPlatformPixmap *createPlatformPixmap(QPlatformPixmap::PixelType type) const; virtual QPlatformWindow *createPlatformWindow(QWindow *window) const = 0; - virtual QPlatformWindow *createForeignWindow(QWindow *, WId) const { return 0; } + virtual QPlatformWindow *createForeignWindow(QWindow *, WId) const { return nullptr; } virtual QPlatformBackingStore *createPlatformBackingStore(QWindow *window) const = 0; #ifndef QT_NO_OPENGL virtual QPlatformOpenGLContext *createPlatformOpenGLContext(QOpenGLContext *context) const; @@ -190,8 +192,6 @@ public: #endif virtual void setApplicationIcon(const QIcon &icon) const; - void removeScreen(QScreen *screen); - virtual void beep() const; #if QT_CONFIG(vulkan) || defined(Q_CLANG_QDOC) @@ -199,9 +199,7 @@ public: #endif protected: - void screenAdded(QPlatformScreen *screen, bool isPrimary = false); - void destroyScreen(QPlatformScreen *screen); - void setPrimaryScreen(QPlatformScreen *newPrimary); + QPlatformIntegration() = default; }; QT_END_NAMESPACE diff --git a/src/gui/kernel/qplatformscreen.cpp b/src/gui/kernel/qplatformscreen.cpp index 9614be7f3e..9c5876550a 100644 --- a/src/gui/kernel/qplatformscreen.cpp +++ b/src/gui/kernel/qplatformscreen.cpp @@ -61,8 +61,7 @@ QPlatformScreen::~QPlatformScreen() { Q_D(QPlatformScreen); if (d->screen) { - qWarning("Manually deleting a QPlatformScreen. Call QPlatformIntegration::destroyScreen instead."); - QGuiApplicationPrivate::platformIntegration()->removeScreen(d->screen); + qWarning("Manually deleting a QPlatformScreen. Call QWindowSystemInterface::handleScreenRemoved instead."); delete d->screen; } } @@ -370,7 +369,7 @@ QString QPlatformScreen::serialNumber() const /*! Reimplement this function in subclass to return the cursor of the screen. - The default implementation returns 0. + The default implementation returns \nullptr. */ QPlatformCursor *QPlatformScreen::cursor() const { diff --git a/src/gui/kernel/qplatformscreen.h b/src/gui/kernel/qplatformscreen.h index e9d64c8a29..b9ecc80320 100644 --- a/src/gui/kernel/qplatformscreen.h +++ b/src/gui/kernel/qplatformscreen.h @@ -80,6 +80,8 @@ class Q_GUI_EXPORT QPlatformScreen Q_DECLARE_PRIVATE(QPlatformScreen) public: + Q_DISABLE_COPY_MOVE(QPlatformScreen) + enum SubpixelAntialiasingType { // copied from qfontengine_p.h since we can't include private headers Subpixel_None, Subpixel_RGB, @@ -164,8 +166,6 @@ protected: QScopedPointer<QPlatformScreenPrivate> d_ptr; private: - Q_DISABLE_COPY(QPlatformScreen) - friend class QScreenPrivate; }; diff --git a/src/gui/kernel/qplatformservices.h b/src/gui/kernel/qplatformservices.h index 339bbfde3f..5de96cfa7d 100644 --- a/src/gui/kernel/qplatformservices.h +++ b/src/gui/kernel/qplatformservices.h @@ -58,6 +58,8 @@ class QUrl; class Q_GUI_EXPORT QPlatformServices { public: + Q_DISABLE_COPY_MOVE(QPlatformServices) + QPlatformServices(); virtual ~QPlatformServices() { } diff --git a/src/gui/kernel/qplatformsessionmanager.h b/src/gui/kernel/qplatformsessionmanager.h index ca7cab389b..c6c3984816 100644 --- a/src/gui/kernel/qplatformsessionmanager.h +++ b/src/gui/kernel/qplatformsessionmanager.h @@ -64,6 +64,8 @@ QT_BEGIN_NAMESPACE class Q_GUI_EXPORT QPlatformSessionManager { public: + Q_DISABLE_COPY_MOVE(QPlatformSessionManager) + explicit QPlatformSessionManager(const QString &id, const QString &key); virtual ~QPlatformSessionManager(); @@ -101,8 +103,6 @@ private: QStringList m_restartCommand; QStringList m_discardCommand; QSessionManager::RestartHint m_restartHint; - - Q_DISABLE_COPY(QPlatformSessionManager) }; QT_END_NAMESPACE diff --git a/src/gui/kernel/qplatformsurface.h b/src/gui/kernel/qplatformsurface.h index 4d8854fb40..475f3ef330 100644 --- a/src/gui/kernel/qplatformsurface.h +++ b/src/gui/kernel/qplatformsurface.h @@ -65,6 +65,8 @@ class QDebug; class Q_GUI_EXPORT QPlatformSurface { public: + Q_DISABLE_COPY_MOVE(QPlatformSurface) + virtual ~QPlatformSurface(); virtual QSurfaceFormat format() const = 0; diff --git a/src/gui/kernel/qplatformtheme.h b/src/gui/kernel/qplatformtheme.h index 1d6049a98d..356c4ea3ea 100644 --- a/src/gui/kernel/qplatformtheme.h +++ b/src/gui/kernel/qplatformtheme.h @@ -76,6 +76,8 @@ class Q_GUI_EXPORT QPlatformTheme { Q_DECLARE_PRIVATE(QPlatformTheme) public: + Q_DISABLE_COPY_MOVE(QPlatformTheme) + enum ThemeHint { CursorFlashTime, KeyboardInputInterval, @@ -307,7 +309,7 @@ public: virtual QPixmap standardPixmap(StandardPixmap sp, const QSizeF &size) const; virtual QIcon fileIcon(const QFileInfo &fileInfo, - QPlatformTheme::IconOptions iconOptions = 0) const; + QPlatformTheme::IconOptions iconOptions = nullptr) const; virtual QIconEngine *createIconEngine(const QString &iconName) const; #ifndef QT_NO_SHORTCUT @@ -324,8 +326,6 @@ public: protected: explicit QPlatformTheme(QPlatformThemePrivate *priv); QScopedPointer<QPlatformThemePrivate> d_ptr; -private: - Q_DISABLE_COPY(QPlatformTheme) }; QT_END_NAMESPACE diff --git a/src/gui/kernel/qplatformwindow.cpp b/src/gui/kernel/qplatformwindow.cpp index 50f05721f7..562289a8c9 100644 --- a/src/gui/kernel/qplatformwindow.cpp +++ b/src/gui/kernel/qplatformwindow.cpp @@ -90,11 +90,11 @@ QWindow *QPlatformWindow::window() const } /*! - Returns the parent platform window (or 0 if orphan). + Returns the parent platform window (or \nullptr if orphan). */ QPlatformWindow *QPlatformWindow::parent() const { - return window()->parent() ? window()->parent()->handle() : 0; + return window()->parent() ? window()->parent()->handle() : nullptr; } /*! @@ -708,10 +708,11 @@ QRect QPlatformWindow::initialGeometry(const QWindow *w, const QScreen *screen = effectiveScreen(w); if (!screen) return initialGeometry; + const auto *wp = qt_window_private(const_cast<QWindow*>(w)); QRect rect(QHighDpi::fromNativePixels(initialGeometry, w)); - rect.setSize(fixInitialSize(rect.size(), w, defaultWidth, defaultHeight)); - if (qt_window_private(const_cast<QWindow*>(w))->positionAutomatic - && w->type() != Qt::Popup) { + if (wp->resizeAutomatic) + rect.setSize(fixInitialSize(rect.size(), w, defaultWidth, defaultHeight)); + if (wp->positionAutomatic && w->type() != Qt::Popup) { const QRect availableGeometry = screen->availableGeometry(); // Center unless the geometry ( + unknown window frame) is too large for the screen). if (rect.height() < (availableGeometry.height() * 8) / 9 diff --git a/src/gui/kernel/qplatformwindow.h b/src/gui/kernel/qplatformwindow.h index 1590a10554..4d48cc2f13 100644 --- a/src/gui/kernel/qplatformwindow.h +++ b/src/gui/kernel/qplatformwindow.h @@ -71,6 +71,8 @@ class Q_GUI_EXPORT QPlatformWindow : public QPlatformSurface { Q_DECLARE_PRIVATE(QPlatformWindow) public: + Q_DISABLE_COPY_MOVE(QPlatformWindow) + explicit QPlatformWindow(QWindow *window); ~QPlatformWindow() override; @@ -108,7 +110,7 @@ public: virtual bool isActive() const; virtual bool isAncestorOf(const QPlatformWindow *child) const; virtual bool isEmbedded() const; - virtual bool isForeignWindow() const { return window()->type() == Qt::ForeignWindow; }; + virtual bool isForeignWindow() const { return false; }; virtual QPoint mapToGlobal(const QPoint &pos) const; virtual QPoint mapFromGlobal(const QPoint &pos) const; @@ -164,8 +166,6 @@ protected: static QSize constrainWindowSize(const QSize &size); QScopedPointer<QPlatformWindowPrivate> d_ptr; -private: - Q_DISABLE_COPY(QPlatformWindow) }; QT_END_NAMESPACE diff --git a/src/gui/kernel/qrasterwindow.cpp b/src/gui/kernel/qrasterwindow.cpp index c88654e794..70d87347c3 100644 --- a/src/gui/kernel/qrasterwindow.cpp +++ b/src/gui/kernel/qrasterwindow.cpp @@ -1,41 +1,41 @@ /**************************************************************************** - ** - ** Copyright (C) 2016 The Qt Company Ltd. - ** Contact: https://www.qt.io/licensing/ - ** - ** This file is part of the QtGui module of the Qt Toolkit. - ** - ** $QT_BEGIN_LICENSE:LGPL$ - ** Commercial License Usage - ** Licensees holding valid commercial Qt licenses may use this file in - ** accordance with the commercial license agreement provided with the - ** Software or, alternatively, in accordance with the terms contained in - ** a written agreement between you and The Qt Company. For licensing terms - ** and conditions see https://www.qt.io/terms-conditions. For further - ** information use the contact form at https://www.qt.io/contact-us. - ** - ** GNU Lesser General Public License Usage - ** Alternatively, this file may be used under the terms of the GNU Lesser - ** General Public License version 3 as published by the Free Software - ** Foundation and appearing in the file LICENSE.LGPL3 included in the - ** packaging of this file. Please review the following information to - ** ensure the GNU Lesser General Public License version 3 requirements - ** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. - ** - ** GNU General Public License Usage - ** Alternatively, this file may be used under the terms of the GNU - ** General Public License version 2.0 or (at your option) the GNU General - ** Public license version 3 or any later version approved by the KDE Free - ** Qt Foundation. The licenses are as published by the Free Software - ** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 - ** included in the packaging of this file. Please review the following - ** information to ensure the GNU General Public License requirements will - ** be met: https://www.gnu.org/licenses/gpl-2.0.html and - ** https://www.gnu.org/licenses/gpl-3.0.html. - ** - ** $QT_END_LICENSE$ - ** - ****************************************************************************/ +** +** Copyright (C) 2016 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ #include "qrasterwindow.h" diff --git a/src/gui/kernel/qscreen.cpp b/src/gui/kernel/qscreen.cpp index 479e228e27..952023dd1b 100644 --- a/src/gui/kernel/qscreen.cpp +++ b/src/gui/kernel/qscreen.cpp @@ -106,9 +106,18 @@ void QScreenPrivate::setPlatformScreen(QPlatformScreen *screen) */ QScreen::~QScreen() { - if (!qApp) + // Remove screen + const bool wasPrimary = QGuiApplication::primaryScreen() == this; + QGuiApplicationPrivate::screen_list.removeOne(this); + QGuiApplicationPrivate::resetCachedDevicePixelRatio(); + + if (!qGuiApp) return; + QScreen *newPrimaryScreen = QGuiApplication::primaryScreen(); + if (wasPrimary && newPrimaryScreen) + emit qGuiApp->primaryScreenChanged(newPrimaryScreen); + // Allow clients to manage windows that are affected by the screen going // away, before we fall back to moving them to the primary screen. emit qApp->screenRemoved(this); @@ -116,11 +125,8 @@ QScreen::~QScreen() if (QGuiApplication::closingDown()) return; - QScreen *primaryScreen = QGuiApplication::primaryScreen(); - if (this == primaryScreen) - return; - - bool movingFromVirtualSibling = primaryScreen && primaryScreen->handle()->virtualSiblings().contains(handle()); + bool movingFromVirtualSibling = newPrimaryScreen + && newPrimaryScreen->handle()->virtualSiblings().contains(handle()); // Move any leftover windows to the primary screen const auto allWindows = QGuiApplication::allWindows(); @@ -129,7 +135,7 @@ QScreen::~QScreen() continue; const bool wasVisible = window->isVisible(); - window->setScreen(primaryScreen); + window->setScreen(newPrimaryScreen); // Re-show window if moved from a virtual sibling screen. Otherwise // leave it up to the application developer to show the window. @@ -701,6 +707,11 @@ void QScreenPrivate::updatePrimaryOrientation() border of the window. If \a height is negative, the function copies everything to the bottom of the window. + The offset and size arguments are specified in device independent + pixels. The returned pixmap may be larger than the requested size + when grabbing from a high-DPI screen. Call QPixmap::devicePixelRatio() + to determine if this is the case. + The window system identifier (\c WId) can be retrieved using the QWidget::winId() function. The rationale for using a window identifier and not a QWidget, is to enable grabbing of windows @@ -748,7 +759,7 @@ QPixmap QScreen::grabWindow(WId window, int x, int y, int width, int height) QPixmap result = platformScreen->grabWindow(window, nativePos.x(), nativePos.y(), nativeSize.width(), nativeSize.height()); - result.setDevicePixelRatio(factor); + result.setDevicePixelRatio(result.devicePixelRatio() * factor); return result; } diff --git a/src/gui/kernel/qscreen.h b/src/gui/kernel/qscreen.h index 8c9b16e08e..14392d3036 100644 --- a/src/gui/kernel/qscreen.h +++ b/src/gui/kernel/qscreen.h @@ -169,6 +169,7 @@ private: friend class QPlatformIntegration; friend class QPlatformScreen; friend class QHighDpiScaling; + friend class QWindowSystemInterface; }; #ifndef QT_NO_DEBUG_STREAM diff --git a/src/gui/kernel/qscreen_p.h b/src/gui/kernel/qscreen_p.h index f31658355b..e5988ff829 100644 --- a/src/gui/kernel/qscreen_p.h +++ b/src/gui/kernel/qscreen_p.h @@ -64,12 +64,6 @@ class QScreenPrivate : public QObjectPrivate { Q_DECLARE_PUBLIC(QScreen) public: - QScreenPrivate() - : platformScreen(0) - , orientationUpdateMask(0) - { - } - void setPlatformScreen(QPlatformScreen *screen); void updateHighDpi() { @@ -79,16 +73,16 @@ public: void updatePrimaryOrientation(); - QPlatformScreen *platformScreen; + QPlatformScreen *platformScreen = nullptr; Qt::ScreenOrientations orientationUpdateMask; - Qt::ScreenOrientation orientation; - Qt::ScreenOrientation filteredOrientation; - Qt::ScreenOrientation primaryOrientation; + Qt::ScreenOrientation orientation = Qt::PrimaryOrientation; + Qt::ScreenOrientation filteredOrientation = Qt::PrimaryOrientation; + Qt::ScreenOrientation primaryOrientation = Qt::LandscapeOrientation; QRect geometry; QRect availableGeometry; - QDpi logicalDpi; - qreal refreshRate; + QDpi logicalDpi = {96, 96}; + qreal refreshRate = 60; }; QT_END_NAMESPACE diff --git a/src/gui/kernel/qshapedpixmapdndwindow.cpp b/src/gui/kernel/qshapedpixmapdndwindow.cpp index 8509eb0961..1a85a5e853 100644 --- a/src/gui/kernel/qshapedpixmapdndwindow.cpp +++ b/src/gui/kernel/qshapedpixmapdndwindow.cpp @@ -3,7 +3,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the plugins of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/kernel/qshapedpixmapdndwindow_p.h b/src/gui/kernel/qshapedpixmapdndwindow_p.h index 072e7c6aea..5089be7284 100644 --- a/src/gui/kernel/qshapedpixmapdndwindow_p.h +++ b/src/gui/kernel/qshapedpixmapdndwindow_p.h @@ -3,7 +3,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the plugins of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage @@ -63,7 +63,7 @@ class QShapedPixmapWindow : public QRasterWindow { Q_OBJECT public: - explicit QShapedPixmapWindow(QScreen *screen = 0); + explicit QShapedPixmapWindow(QScreen *screen = nullptr); ~QShapedPixmapWindow(); void setUseCompositing(bool on) { m_useCompositing = on; } diff --git a/src/gui/kernel/qshortcutmap.cpp b/src/gui/kernel/qshortcutmap.cpp index 3bb42c1c0b..0395c1db38 100644 --- a/src/gui/kernel/qshortcutmap.cpp +++ b/src/gui/kernel/qshortcutmap.cpp @@ -175,7 +175,7 @@ int QShortcutMap::addShortcut(QObject *owner, const QKeySequence &key, Qt::Short /*! \internal Removes a shortcut from the global map. - If \a owner is 0, all entries in the map with the key sequence specified + If \a owner is \nullptr, all entries in the map with the key sequence specified is removed. If \a key is null, all sequences for \a owner is removed from the map. If \a id is 0, any identical \a key sequences owned by \a owner are removed. @@ -222,7 +222,7 @@ int QShortcutMap::removeShortcut(int id, QObject *owner, const QKeySequence &key /*! \internal Changes the enable state of a shortcut to \a enable. - If \a owner is 0, all entries in the map with the key sequence specified + If \a owner is \nullptr, all entries in the map with the key sequence specified is removed. If \a key is null, all sequences for \a owner is removed from the map. If \a id is 0, any identical \a key sequences owned by \a owner are changed. @@ -260,7 +260,7 @@ int QShortcutMap::setShortcutEnabled(bool enable, int id, QObject *owner, const /*! \internal Changes the auto repeat state of a shortcut to \a enable. - If \a owner is 0, all entries in the map with the key sequence specified + If \a owner is \nullptr, all entries in the map with the key sequence specified is removed. If \a key is null, all sequences for \a owner is removed from the map. If \a id is 0, any identical \a key sequences owned by \a owner are changed. diff --git a/src/gui/kernel/qsimpledrag.cpp b/src/gui/kernel/qsimpledrag.cpp index a84f873437..9aab332ef5 100644 --- a/src/gui/kernel/qsimpledrag.cpp +++ b/src/gui/kernel/qsimpledrag.cpp @@ -44,7 +44,6 @@ #include "qpixmap.h" #include "qevent.h" #include "qfile.h" -#include "qtextcodec.h" #include "qguiapplication.h" #include "qpoint.h" #include "qbuffer.h" @@ -75,7 +74,7 @@ static QWindow* topLevelAt(const QPoint &pos) QWindowList list = QGuiApplication::topLevelWindows(); for (int i = list.count()-1; i >= 0; --i) { QWindow *w = list.at(i); - if (w->isVisible() && w->geometry().contains(pos) && !qobject_cast<QShapedPixmapWindow*>(w)) + if (w->isVisible() && w->handle() && w->geometry().contains(pos) && !qobject_cast<QShapedPixmapWindow*>(w)) return w; } return 0; diff --git a/src/gui/kernel/qstylehints.cpp b/src/gui/kernel/qstylehints.cpp index 48060a2c37..9b5b7a6f1e 100644 --- a/src/gui/kernel/qstylehints.cpp +++ b/src/gui/kernel/qstylehints.cpp @@ -69,29 +69,17 @@ class QStyleHintsPrivate : public QObjectPrivate { Q_DECLARE_PUBLIC(QStyleHints) public: - inline QStyleHintsPrivate() - : m_mouseDoubleClickInterval(-1) - , m_mousePressAndHoldInterval(-1) - , m_startDragDistance(-1) - , m_startDragTime(-1) - , m_keyboardInputInterval(-1) - , m_cursorFlashTime(-1) - , m_tabFocusBehavior(-1) - , m_uiEffects(-1) - , m_wheelScrollLines(-1) - , m_mouseQuickSelectionThreshold(-1) - {} - - int m_mouseDoubleClickInterval; - int m_mousePressAndHoldInterval; - int m_startDragDistance; - int m_startDragTime; - int m_keyboardInputInterval; - int m_cursorFlashTime; - int m_tabFocusBehavior; - int m_uiEffects; - int m_wheelScrollLines; - int m_mouseQuickSelectionThreshold; + int m_mouseDoubleClickInterval = -1; + int m_mousePressAndHoldInterval = -1; + int m_startDragDistance = -1; + int m_startDragTime = -1; + int m_keyboardInputInterval = -1; + int m_cursorFlashTime = -1; + int m_tabFocusBehavior = -1; + int m_uiEffects = -1; + int m_showShortcutsInContextMenus = -1; + int m_wheelScrollLines = -1; + int m_mouseQuickSelectionThreshold = -1; }; /*! @@ -371,10 +359,25 @@ bool QStyleHints::showIsMaximized() const \since 5.10 \brief \c true if the platform normally shows shortcut key sequences in context menus, otherwise \c false. + + Since Qt 5.13, the setShowShortcutsInContextMenus() function can be used to + override the platform default. */ bool QStyleHints::showShortcutsInContextMenus() const { - return themeableHint(QPlatformTheme::ShowShortcutsInContextMenus, QPlatformIntegration::ShowShortcutsInContextMenus).toBool(); + Q_D(const QStyleHints); + return d->m_showShortcutsInContextMenus >= 0 + ? d->m_showShortcutsInContextMenus != 0 + : themeableHint(QPlatformTheme::ShowShortcutsInContextMenus, QPlatformIntegration::ShowShortcutsInContextMenus).toBool(); +} + +void QStyleHints::setShowShortcutsInContextMenus(bool s) +{ + Q_D(QStyleHints); + if (s != showShortcutsInContextMenus()) { + d->m_showShortcutsInContextMenus = s ? 1 : 0; + emit showShortcutsInContextMenusChanged(s); + } } /*! diff --git a/src/gui/kernel/qstylehints.h b/src/gui/kernel/qstylehints.h index 7b0683e9b1..9091db9624 100644 --- a/src/gui/kernel/qstylehints.h +++ b/src/gui/kernel/qstylehints.h @@ -64,7 +64,7 @@ class Q_GUI_EXPORT QStyleHints : public QObject Q_PROPERTY(bool setFocusOnTouchRelease READ setFocusOnTouchRelease STORED false CONSTANT FINAL) Q_PROPERTY(bool showIsFullScreen READ showIsFullScreen STORED false CONSTANT FINAL) Q_PROPERTY(bool showIsMaximized READ showIsMaximized STORED false CONSTANT FINAL) - Q_PROPERTY(bool showShortcutsInContextMenus READ showShortcutsInContextMenus STORED false CONSTANT FINAL) + Q_PROPERTY(bool showShortcutsInContextMenus READ showShortcutsInContextMenus WRITE setShowShortcutsInContextMenus NOTIFY showShortcutsInContextMenusChanged FINAL) Q_PROPERTY(int startDragDistance READ startDragDistance NOTIFY startDragDistanceChanged FINAL) Q_PROPERTY(int startDragTime READ startDragTime NOTIFY startDragTimeChanged FINAL) Q_PROPERTY(int startDragVelocity READ startDragVelocity STORED false CONSTANT FINAL) @@ -93,6 +93,7 @@ public: bool showIsFullScreen() const; bool showIsMaximized() const; bool showShortcutsInContextMenus() const; + void setShowShortcutsInContextMenus(bool showShortcutsInContextMenus); int passwordMaskDelay() const; QChar passwordMaskCharacter() const; qreal fontSmoothingGamma() const; @@ -117,6 +118,7 @@ Q_SIGNALS: void startDragTimeChanged(int startDragTime); void tabFocusBehaviorChanged(Qt::TabFocusBehavior tabFocusBehavior); void useHoverEffectsChanged(bool useHoverEffects); + void showShortcutsInContextMenusChanged(bool); void wheelScrollLinesChanged(int scrollLines); void mouseQuickSelectionThresholdChanged(int threshold); diff --git a/src/gui/kernel/qsurfaceformat.cpp b/src/gui/kernel/qsurfaceformat.cpp index 574310f554..1a814ec21f 100644 --- a/src/gui/kernel/qsurfaceformat.cpp +++ b/src/gui/kernel/qsurfaceformat.cpp @@ -319,7 +319,8 @@ void QSurfaceFormat::setStereo(bool enable) /*! Returns the number of samples per pixel when multisampling is - enabled. By default, multisampling is disabled. + enabled, or \c -1 when multisampling is disabled. The default + return value is \c -1. \sa setSamples() */ diff --git a/src/gui/kernel/qt_gui_pch.h b/src/gui/kernel/qt_gui_pch.h index db12ba1078..5e07fa45e7 100644 --- a/src/gui/kernel/qt_gui_pch.h +++ b/src/gui/kernel/qt_gui_pch.h @@ -45,35 +45,20 @@ * UNSUPPORTED. */ -// from corelib/global/qt_pch.h +#include "../../corelib/global/qt_pch.h" + #if defined __cplusplus #include <qtguiglobal.h> - - -#ifdef Q_OS_WIN -# define _POSIX_ -# include <limits.h> -# undef _POSIX_ -#endif - -#include <qcoreapplication.h> -#include <qlist.h> -#include <qvariant.h> // All moc genereated code has this include -#include <qobject.h> -#include <qregexp.h> -#include <qstring.h> -#include <qstringlist.h> -#include <qtextcodec.h> - #include <qguiapplication.h> #include <qbitmap.h> +#include <qclipboard.h> #include <qcursor.h> #include <qevent.h> +#include <qfont.h> #include <qimage.h> #include <qpainter.h> #include <qpixmap.h> -#include <qtimer.h> - -#include <stdlib.h> - +#include <qscreen.h> +#include <qsurface.h> +#include <qwindow.h> #endif diff --git a/src/gui/kernel/qtestsupport_gui.cpp b/src/gui/kernel/qtestsupport_gui.cpp index 56e0eb52b3..7aad4d8c7d 100644 --- a/src/gui/kernel/qtestsupport_gui.cpp +++ b/src/gui/kernel/qtestsupport_gui.cpp @@ -3,7 +3,7 @@ ** Copyright (C) 2018 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtTest module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage @@ -44,23 +44,21 @@ QT_BEGIN_NAMESPACE -/*! \fn bool qWaitForWindowActive(QWindow *window, int timeout) - \relates QTest +/*! \since 5.0 Waits for \a timeout milliseconds or until the \a window is active. Returns \c true if \c window is active within \a timeout milliseconds, otherwise returns \c false. - \sa QTest::qWaitForWindowExposed(), QWindow::isActive() + \sa qWaitForWindowExposed(), QWindow::isActive() */ Q_GUI_EXPORT bool QTest::qWaitForWindowActive(QWindow *window, int timeout) { return QTest::qWaitFor([&]() { return window->isActive(); }, timeout); } -/*! \fn bool qWaitForWindowExposed(QWindow *window, int timeout) - \relates QTest +/*! \since 5.0 Waits for \a timeout milliseconds or until the \a window is exposed. @@ -73,7 +71,7 @@ Q_GUI_EXPORT bool QTest::qWaitForWindowActive(QWindow *window, int timeout) area is completely covered by other windows, or if the window is otherwise not visible. This function will then time out when waiting for such a window. - \sa QTest::qWaitForWindowActive(), QWindow::isExposed() + \sa qWaitForWindowActive(), QWindow::isExposed() */ Q_GUI_EXPORT bool QTest::qWaitForWindowExposed(QWindow *window, int timeout) { diff --git a/src/gui/kernel/qtestsupport_gui.h b/src/gui/kernel/qtestsupport_gui.h index 82a81e9214..1f0c4f0960 100644 --- a/src/gui/kernel/qtestsupport_gui.h +++ b/src/gui/kernel/qtestsupport_gui.h @@ -3,7 +3,7 @@ ** Copyright (C) 2018 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtTest module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/kernel/qwindow.cpp b/src/gui/kernel/qwindow.cpp index 17a18f3c9a..19a5d39ad5 100644 --- a/src/gui/kernel/qwindow.cpp +++ b/src/gui/kernel/qwindow.cpp @@ -166,7 +166,7 @@ QWindow::QWindow(QScreen *targetScreen) static QWindow *nonDesktopParent(QWindow *parent) { if (parent && parent->type() == Qt::Desktop) { - qWarning("QWindows can not be reparented into desktop windows"); + qWarning("QWindows cannot be reparented into desktop windows"); return nullptr; } @@ -546,6 +546,9 @@ void QWindowPrivate::create(bool recursive, WId nativeHandle) QPlatformSurfaceEvent e(QPlatformSurfaceEvent::SurfaceCreated); QGuiApplication::sendEvent(q, &e); + + if (updateRequestPending) + platformWindow->requestUpdate(); } void QWindowPrivate::clearFocusObject() @@ -685,7 +688,8 @@ QWindow *QWindow::parent() const Sets the \a parent Window. This will lead to the windowing system managing the clip of the window, so it will be clipped to the \a parent window. - Setting \a parent to be 0 will make the window become a top level window. + Setting \a parent to be \nullptr will make the window become a top level + window. If \a parent is a window created by fromWinId(), then the current window will be embedded inside \a parent, if the platform supports it. @@ -916,8 +920,7 @@ void QWindow::setFlag(Qt::WindowType flag, bool on) */ Qt::WindowType QWindow::type() const { - Q_D(const QWindow); - return static_cast<Qt::WindowType>(int(d->windowFlags & Qt::WindowType_Mask)); + return static_cast<Qt::WindowType>(int(flags() & Qt::WindowType_Mask)); } /*! @@ -1349,7 +1352,7 @@ void QWindow::setTransientParent(QWindow *parent) return; } if (parent == this) { - qWarning() << "transient parent" << parent << "can not be same as window"; + qWarning() << "transient parent" << parent << "cannot be same as window"; return; } @@ -1919,9 +1922,6 @@ void QWindowPrivate::destroy() resizeEventPending = true; receivedExpose = false; exposed = false; - - if (wasVisible) - maybeQuitOnLastWindowClosed(); } /*! @@ -2310,8 +2310,17 @@ bool QWindow::event(QEvent *ev) #endif case QEvent::Close: - if (ev->isAccepted()) + if (ev->isAccepted()) { + Q_D(QWindow); + bool wasVisible = isVisible(); destroy(); + if (wasVisible) { + // FIXME: This check for visibility is a workaround for both QWidgetWindow + // and QWindow having logic to emit lastWindowClosed, and possibly quit the + // application. We should find a better way to handle this. + d->maybeQuitOnLastWindowClosed(); + } + } break; case QEvent::Expose: @@ -2520,7 +2529,12 @@ void QWindow::tabletEvent(QTabletEvent *ev) Should return true only if the event was handled. */ + +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QWindow::nativeEvent(const QByteArray &eventType, void *message, qintptr *result) +#else bool QWindow::nativeEvent(const QByteArray &eventType, void *message, long *result) +#endif { Q_UNUSED(eventType); Q_UNUSED(message); @@ -2596,6 +2610,8 @@ void QWindowPrivate::maybeQuitOnLastWindowClosed() return; Q_Q(QWindow); + if (!q->isTopLevel()) + return; // Attempt to close the application only if this has WA_QuitOnClose set and a non-visible parent bool quitOnClose = QGuiApplication::quitOnLastWindowClosed() && !q->parent(); QWindowList list = QGuiApplication::topLevelWindows(); @@ -2652,7 +2668,7 @@ QOpenGLContext *QWindowPrivate::shareContext() const native window, or to embed a native window inside a QWindow. If foreign windows are not supported or embedding the native window - failed in the platform plugin, this function returns 0. + failed in the platform plugin, this function returns \nullptr. \note The resulting QWindow should not be used to manipulate the underlying native window (besides re-parenting), or to observe state changes of the diff --git a/src/gui/kernel/qwindow.h b/src/gui/kernel/qwindow.h index 1be3c845fe..5ee1d00f5b 100644 --- a/src/gui/kernel/qwindow.h +++ b/src/gui/kernel/qwindow.h @@ -364,7 +364,11 @@ protected: #if QT_CONFIG(tabletevent) virtual void tabletEvent(QTabletEvent *); #endif +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + virtual bool nativeEvent(const QByteArray &eventType, void *message, qintptr *result); +#else virtual bool nativeEvent(const QByteArray &eventType, void *message, long *result); +#endif QWindow(QWindowPrivate &dd, QWindow *parent); diff --git a/src/gui/kernel/qwindow_p.h b/src/gui/kernel/qwindow_p.h index 25f9a8a9b2..d918ed5b52 100644 --- a/src/gui/kernel/qwindow_p.h +++ b/src/gui/kernel/qwindow_p.h @@ -77,49 +77,15 @@ public: QWindowPrivate() : QObjectPrivate() - , surfaceType(QWindow::RasterSurface) - , windowFlags(Qt::Window) - , parentWindow(0) - , platformWindow(0) - , visible(false) - , visibilityOnDestroy(false) - , exposed(false) - , windowState(Qt::WindowNoState) - , visibility(QWindow::Hidden) - , resizeEventPending(true) - , receivedExpose(false) - , positionPolicy(WindowFrameExclusive) - , positionAutomatic(true) - , contentOrientation(Qt::PrimaryOrientation) - , opacity(qreal(1.0)) - , minimumSize(0, 0) - , maximumSize(QWINDOWSIZE_MAX, QWINDOWSIZE_MAX) - , modality(Qt::NonModal) - , blockedByModalWindow(false) - , updateRequestPending(false) - , transientParent(0) - , topLevelScreen(0) -#ifndef QT_NO_CURSOR - , cursor(Qt::ArrowCursor) - , hasCursor(false) -#endif - , compositing(false) -#if QT_CONFIG(vulkan) - , vulkanInstance(nullptr) -#endif { isWindow = true; } - ~QWindowPrivate() - { - } - void init(QScreen *targetScreen = nullptr); void maybeQuitOnLastWindowClosed(); #ifndef QT_NO_CURSOR - void setCursor(const QCursor *c = 0); + void setCursor(const QCursor *c = nullptr); bool applyCursor(); #endif @@ -156,57 +122,66 @@ public: virtual void processSafeAreaMarginsChanged() {}; bool isPopup() const { return (windowFlags & Qt::WindowType_Mask) == Qt::Popup; } + void setAutomaticPositionAndResizeEnabled(bool a) + { positionAutomatic = resizeAutomatic = a; } static QWindowPrivate *get(QWindow *window) { return window->d_func(); } static Qt::WindowState effectiveState(Qt::WindowStates); - QWindow::SurfaceType surfaceType; - Qt::WindowFlags windowFlags; - QWindow *parentWindow; - QPlatformWindow *platformWindow; - bool visible; - bool visibilityOnDestroy; - bool exposed; + virtual bool allowClickThrough(const QPoint &) const { return true; } + + QWindow::SurfaceType surfaceType = QWindow::RasterSurface; + Qt::WindowFlags windowFlags = Qt::Window; + QWindow *parentWindow = nullptr; + QPlatformWindow *platformWindow = nullptr; + bool visible= false; + bool visibilityOnDestroy = false; + bool exposed = false; QSurfaceFormat requestedFormat; QString windowTitle; QString windowFilePath; QIcon windowIcon; QRect geometry; - Qt::WindowStates windowState; - QWindow::Visibility visibility; - bool resizeEventPending; - bool receivedExpose; - PositionPolicy positionPolicy; - bool positionAutomatic; - Qt::ScreenOrientation contentOrientation; - qreal opacity; + Qt::WindowStates windowState = Qt::WindowNoState; + QWindow::Visibility visibility = QWindow::Hidden; + bool resizeEventPending = true; + bool receivedExpose = false; + PositionPolicy positionPolicy = WindowFrameExclusive; + bool positionAutomatic = true; + // resizeAutomatic suppresses resizing by QPlatformWindow::initialGeometry(). + // It also indicates that width/height=0 is acceptable (for example, for + // the QRollEffect widget) and is thus not cleared in setGeometry(). + // An alternative approach might be using -1,-1 as a default size. + bool resizeAutomatic = true; + Qt::ScreenOrientation contentOrientation = Qt::PrimaryOrientation; + qreal opacity= 1; QRegion mask; - QSize minimumSize; - QSize maximumSize; + QSize minimumSize = {0, 0}; + QSize maximumSize = {QWINDOWSIZE_MAX, QWINDOWSIZE_MAX}; QSize baseSize; QSize sizeIncrement; - Qt::WindowModality modality; - bool blockedByModalWindow; + Qt::WindowModality modality = Qt::NonModal; + bool blockedByModalWindow = false; - bool updateRequestPending; + bool updateRequestPending = false; bool transientParentPropertySet = false; QPointer<QWindow> transientParent; QPointer<QScreen> topLevelScreen; #ifndef QT_NO_CURSOR - QCursor cursor; - bool hasCursor; + QCursor cursor = {Qt::ArrowCursor}; + bool hasCursor = false; #endif - bool compositing; + bool compositing = false; QElapsedTimer lastComposeTime; #if QT_CONFIG(vulkan) - QVulkanInstance *vulkanInstance; + QVulkanInstance *vulkanInstance = nullptr; #endif }; diff --git a/src/gui/kernel/qwindowsysteminterface.cpp b/src/gui/kernel/qwindowsysteminterface.cpp index 07ece5689e..6f3edb10b4 100644 --- a/src/gui/kernel/qwindowsysteminterface.cpp +++ b/src/gui/kernel/qwindowsysteminterface.cpp @@ -57,6 +57,7 @@ QT_BEGIN_NAMESPACE QElapsedTimer QWindowSystemInterfacePrivate::eventTime; bool QWindowSystemInterfacePrivate::synchronousWindowSystemEvents = false; +bool QWindowSystemInterfacePrivate::platformFiltersEvents = false; bool QWindowSystemInterfacePrivate::TabletEvent::platformSynthesizesMouse = true; QWaitCondition QWindowSystemInterfacePrivate::eventsFlushed; QMutex QWindowSystemInterfacePrivate::flushEventMutex; @@ -393,6 +394,9 @@ QT_DEFINE_QPA_EVENT_HANDLER(void, handleMouseEvent, QWindow *window, ulong times Qt::MouseButton button, QEvent::Type type, Qt::KeyboardModifiers mods, Qt::MouseEventSource source) { + Q_ASSERT_X(type != QEvent::MouseButtonDblClick && type != QEvent::NonClientAreaMouseButtonDblClick, + "QWindowSystemInterface::handleMouseEvent", + "QTBUG-71263: Native double clicks are not implemented."); auto localPos = QHighDpi::fromNativeLocalPosition(local, window); auto globalPos = QHighDpi::fromNativePixels(global, window); @@ -691,13 +695,29 @@ QList<QTouchEvent::TouchPoint> } if (states == Qt::TouchPointReleased) { - g_nextPointId = 1; - g_pointIdMap->clear(); + // All points on deviceId have been released. + // Remove all points associated with that device from g_pointIdMap. + // (On other devices, some touchpoints might still be pressed. + // But this function is only called with points from one device at a time.) + for (auto it = g_pointIdMap->begin(); it != g_pointIdMap->end();) { + if (it.key() >> 32 == quint64(deviceId)) + it = g_pointIdMap->erase(it); + else + ++it; + } + if (g_pointIdMap->isEmpty()) + g_nextPointId = 1; } return touchPoints; } +void QWindowSystemInterfacePrivate::clearPointIdMap() +{ + g_pointIdMap->clear(); + g_nextPointId = 1; +} + QList<QWindowSystemInterface::TouchPoint> QWindowSystemInterfacePrivate::toNativeTouchPoints(const QList<QTouchEvent::TouchPoint>& pointList, const QWindow *window) @@ -760,6 +780,67 @@ QT_DEFINE_QPA_EVENT_HANDLER(void, handleTouchCancelEvent, QWindow *window, ulong QWindowSystemInterfacePrivate::handleWindowSystemEvent<Delivery>(e); } +/*! + Should be called by the implementation whenever a new screen is added. + + The first screen added will be the primary screen, used for default-created + windows, GL contexts, and other resources unless otherwise specified. + + This adds the screen to QGuiApplication::screens(), and emits the + QGuiApplication::screenAdded() signal. + + The screen should be deleted by calling QWindowSystemInterface::handleScreenRemoved(). +*/ +void QWindowSystemInterface::handleScreenAdded(QPlatformScreen *ps, bool isPrimary) +{ + QScreen *screen = new QScreen(ps); + + if (isPrimary) + QGuiApplicationPrivate::screen_list.prepend(screen); + else + QGuiApplicationPrivate::screen_list.append(screen); + + QGuiApplicationPrivate::resetCachedDevicePixelRatio(); + + emit qGuiApp->screenAdded(screen); + + if (isPrimary) + emit qGuiApp->primaryScreenChanged(screen); +} + +/*! + Should be called by the implementation whenever a screen is removed. + + This removes the screen from QGuiApplication::screens(), and deletes it. + + Failing to call this and manually deleting the QPlatformScreen instead may + lead to a crash due to a pure virtual call. +*/ +void QWindowSystemInterface::handleScreenRemoved(QPlatformScreen *platformScreen) +{ + // Important to keep this order since the QSceen doesn't own the platform screen + delete platformScreen->screen(); + delete platformScreen; +} + +/*! + Should be called whenever the primary screen changes. + + When the screen specified as primary changes, this method will notify + QGuiApplication and emit the QGuiApplication::primaryScreenChanged signal. + */ +void QWindowSystemInterface::handlePrimaryScreenChanged(QPlatformScreen *newPrimary) +{ + QScreen *newPrimaryScreen = newPrimary->screen(); + int indexOfScreen = QGuiApplicationPrivate::screen_list.indexOf(newPrimaryScreen); + Q_ASSERT(indexOfScreen >= 0); + if (indexOfScreen == 0) + return; + + QGuiApplicationPrivate::screen_list.swapItemsAt(0, indexOfScreen); + emit qGuiApp->primaryScreenChanged(newPrimaryScreen); +} + void QWindowSystemInterface::handleScreenOrientationChange(QScreen *screen, Qt::ScreenOrientation orientation) { QWindowSystemInterfacePrivate::ScreenOrientationEvent *e = @@ -843,7 +924,11 @@ QPlatformDropQtResponse QWindowSystemInterface::handleDrop(QWindow *window, cons \note This function can only be called from the GUI thread. */ +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QWindowSystemInterface::handleNativeEvent(QWindow *window, const QByteArray &eventType, void *message, qintptr *result) +#else bool QWindowSystemInterface::handleNativeEvent(QWindow *window, const QByteArray &eventType, void *message, long *result) +#endif { return QGuiApplicationPrivate::processNativeEvent(window, eventType, message, result); } @@ -1047,10 +1132,15 @@ bool QWindowSystemInterface::sendWindowSystemEvents(QEventLoop::ProcessEventsFla int nevents = 0; while (QWindowSystemInterfacePrivate::windowSystemEventsQueued()) { - QWindowSystemInterfacePrivate::WindowSystemEvent *event = - (flags & QEventLoop::ExcludeUserInputEvents) ? - QWindowSystemInterfacePrivate::getNonUserInputWindowSystemEvent() : - QWindowSystemInterfacePrivate::getWindowSystemEvent(); + QWindowSystemInterfacePrivate::WindowSystemEvent *event = nullptr; + + if (QWindowSystemInterfacePrivate::platformFiltersEvents) { + event = QWindowSystemInterfacePrivate::getWindowSystemEvent(); + } else { + event = flags & QEventLoop::ExcludeUserInputEvents ? + QWindowSystemInterfacePrivate::getNonUserInputWindowSystemEvent() : + QWindowSystemInterfacePrivate::getWindowSystemEvent(); + } if (!event) break; @@ -1089,6 +1179,21 @@ bool QWindowSystemInterface::nonUserInputEventsQueued() return QWindowSystemInterfacePrivate::nonUserInputEventsQueued(); } +/*! + Platforms that implement UserInputEvent filtering at native event level must + set this property to \c true. The default is \c false, which means that event + filtering logic is handled by QWindowSystemInterface. Doing the filtering in + platform plugins is necessary when supporting AbstractEventDispatcher::filterNativeEvent(), + which should respect flags that were passed to event dispatcher's processEvents() + call. + + \since 5.12 +*/ +void QWindowSystemInterface::setPlatformFiltersEvents(bool enable) +{ + QWindowSystemInterfacePrivate::platformFiltersEvents = enable; +} + // --------------------- QtTestLib support --------------------- // The following functions are used by testlib, and need to be synchronous to avoid diff --git a/src/gui/kernel/qwindowsysteminterface.h b/src/gui/kernel/qwindowsysteminterface.h index 6bf6ee645c..fd70eda9ff 100644 --- a/src/gui/kernel/qwindowsysteminterface.h +++ b/src/gui/kernel/qwindowsysteminterface.h @@ -230,9 +230,17 @@ public: Qt::MouseButtons buttons, Qt::KeyboardModifiers modifiers); #endif // QT_CONFIG(draganddrop) +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + static bool handleNativeEvent(QWindow *window, const QByteArray &eventType, void *message, qintptr *result); +#else static bool handleNativeEvent(QWindow *window, const QByteArray &eventType, void *message, long *result); +#endif // Changes to the screen + static void handleScreenAdded(QPlatformScreen *screen, bool isPrimary = false); + static void handleScreenRemoved(QPlatformScreen *screen); + static void handlePrimaryScreenChanged(QPlatformScreen *newPrimary); + static void handleScreenOrientationChange(QScreen *screen, Qt::ScreenOrientation newOrientation); static void handleScreenGeometryChange(QScreen *screen, const QRect &newGeometry, const QRect &newAvailableGeometry); static void handleScreenLogicalDotsPerInchChange(QScreen *screen, qreal newDpiX, qreal newDpiY); @@ -292,6 +300,7 @@ public: static void deferredFlushWindowSystemEvents(QEventLoop::ProcessEventsFlags flags); static int windowSystemEventsQueued(); static bool nonUserInputEventsQueued(); + static void setPlatformFiltersEvents(bool enable); }; #ifndef QT_NO_DEBUG_STREAM diff --git a/src/gui/kernel/qwindowsysteminterface_p.h b/src/gui/kernel/qwindowsysteminterface_p.h index 492f559f22..d6513f1836 100644 --- a/src/gui/kernel/qwindowsysteminterface_p.h +++ b/src/gui/kernel/qwindowsysteminterface_p.h @@ -123,7 +123,7 @@ public: class CloseEvent : public WindowSystemEvent { public: - explicit CloseEvent(QWindow *w, bool *a = 0) + explicit CloseEvent(QWindow *w, bool *a = nullptr) : WindowSystemEvent(Close), window(w), accepted(a) { } QPointer<QWindow> window; @@ -398,7 +398,7 @@ public: class TabletEnterProximityEvent : public InputEvent { public: TabletEnterProximityEvent(ulong time, int device, int pointerType, qint64 uid) - : InputEvent(0, time, TabletEnterProximity, Qt::NoModifier), + : InputEvent(nullptr, time, TabletEnterProximity, Qt::NoModifier), device(device), pointerType(pointerType), uid(uid) { } int device; int pointerType; @@ -408,7 +408,7 @@ public: class TabletLeaveProximityEvent : public InputEvent { public: TabletLeaveProximityEvent(ulong time, int device, int pointerType, qint64 uid) - : InputEvent(0, time, TabletLeaveProximity, Qt::NoModifier), + : InputEvent(nullptr, time, TabletLeaveProximity, Qt::NoModifier), device(device), pointerType(pointerType), uid(uid) { } int device; int pointerType; @@ -474,7 +474,7 @@ public: for (int i = 0; i < impl.size(); ++i) if (!(impl.at(i)->type & QWindowSystemInterfacePrivate::UserInputEvent)) return impl.takeAt(i); - return 0; + return nullptr; } bool nonUserInputEventsQueued() { @@ -495,7 +495,7 @@ public: if (impl.at(i)->type == t) return impl.at(i); } - return 0; + return nullptr; } void remove(const WindowSystemEvent *e) { @@ -508,7 +508,7 @@ public: } } private: - Q_DISABLE_COPY(WindowSystemEventList) + Q_DISABLE_COPY_MOVE(WindowSystemEventList) }; static WindowSystemEventList windowSystemEventQueue; @@ -525,6 +525,7 @@ public: public: static QElapsedTimer eventTime; static bool synchronousWindowSystemEvents; + static bool platformFiltersEvents; static QWaitCondition eventsFlushed; static QMutex flushEventMutex; @@ -536,6 +537,7 @@ public: static QList<QWindowSystemInterface::TouchPoint> toNativeTouchPoints(const QList<QTouchEvent::TouchPoint>& pointList, const QWindow *window); + static void clearPointIdMap(); static void installWindowSystemEventHandler(QWindowSystemEventHandler *handler); static void removeWindowSystemEventhandler(QWindowSystemEventHandler *handler); diff --git a/src/gui/math3d/qquaternion.cpp b/src/gui/math3d/qquaternion.cpp index fe1b0425a8..899ec12eb3 100644 --- a/src/gui/math3d/qquaternion.cpp +++ b/src/gui/math3d/qquaternion.cpp @@ -325,15 +325,11 @@ void QQuaternion::normalize() Rotates \a vector with this quaternion to produce a new vector in 3D space. The following code: - \code - QVector3D result = q.rotatedVector(vector); - \endcode + \snippet code/src_gui_math3d_qquaternion.cpp 0 is equivalent to the following: - \code - QVector3D result = (q * QQuaternion(0, vector) * q.conjugated()).vector(); - \endcode + \snippet code/src_gui_math3d_qquaternion.cpp 1 */ QVector3D QQuaternion::rotatedVector(const QVector3D& vector) const { diff --git a/src/gui/opengl/qopengl.cpp b/src/gui/opengl/qopengl.cpp index e961c42a25..2b1e57a4bb 100644 --- a/src/gui/opengl/qopengl.cpp +++ b/src/gui/opengl/qopengl.cpp @@ -60,6 +60,10 @@ QT_BEGIN_NAMESPACE typedef const GLubyte * (QOPENGLF_APIENTRYP qt_glGetStringi)(GLenum, GLuint); #endif +#ifndef GL_CONTEXT_LOST +#define GL_CONTEXT_LOST 0x0507 +#endif + QOpenGLExtensionMatcher::QOpenGLExtensionMatcher() { QOpenGLContext *ctx = QOpenGLContext::currentContext(); @@ -80,8 +84,13 @@ QOpenGLExtensionMatcher::QOpenGLExtensionMatcher() } else { #ifdef QT_OPENGL_3 // clear error state - while (funcs->glGetError()) {} - + while (true) { // Clear error state. + GLenum error = funcs->glGetError(); + if (error == GL_NO_ERROR) + break; + if (error == GL_CONTEXT_LOST) + return; + }; qt_glGetStringi glGetStringi = (qt_glGetStringi)ctx->getProcAddress("glGetStringi"); if (!glGetStringi) diff --git a/src/gui/opengl/qopenglbuffer.cpp b/src/gui/opengl/qopenglbuffer.cpp index 000494244d..537097c09f 100644 --- a/src/gui/opengl/qopenglbuffer.cpp +++ b/src/gui/opengl/qopenglbuffer.cpp @@ -63,12 +63,7 @@ QT_BEGIN_NAMESPACE QOpenGLBuffer objects can be copied around as a reference to the underlying OpenGL buffer object: - \code - QOpenGLBuffer buffer1(QOpenGLBuffer::IndexBuffer); - buffer1.create(); - - QOpenGLBuffer buffer2 = buffer1; - \endcode + \snippet code/src_gui_opengl_qopenglbuffer.cpp 0 QOpenGLBuffer performs a shallow copy when objects are copied in this manner, but does not implement copy-on-write semantics. The original @@ -484,9 +479,7 @@ void QOpenGLBuffer::release() been bound to the context but wants to make sure that it is released. - \code - QOpenGLBuffer::release(QOpenGLBuffer::VertexBuffer); - \endcode + \snippet code/src_gui_opengl_qopenglbuffer.cpp 1 */ void QOpenGLBuffer::release(QOpenGLBuffer::Type type) { diff --git a/src/gui/opengl/qopenglcustomshaderstage_p.h b/src/gui/opengl/qopenglcustomshaderstage_p.h index f4a71af88e..ce3e9efd23 100644 --- a/src/gui/opengl/qopenglcustomshaderstage_p.h +++ b/src/gui/opengl/qopenglcustomshaderstage_p.h @@ -80,7 +80,7 @@ protected: private: QOpenGLCustomShaderStagePrivate* d_ptr; - Q_DISABLE_COPY(QOpenGLCustomShaderStage) + Q_DISABLE_COPY_MOVE(QOpenGLCustomShaderStage) }; diff --git a/src/gui/opengl/qopengldebug.cpp b/src/gui/opengl/qopengldebug.cpp index 7072db5af4..2e628a2bd5 100644 --- a/src/gui/opengl/qopengldebug.cpp +++ b/src/gui/opengl/qopengldebug.cpp @@ -89,16 +89,7 @@ QT_BEGIN_NAMESPACE call. Moreover, OpenGL errors stack up, therefore glGetError should always be used in a loop like this: - \code - - GLenum error = GL_NO_ERROR; - do { - error = glGetError(); - if (error != GL_NO_ERROR) - // handle the error - } while (error != GL_NO_ERROR); - - \endcode + \snippet code/src_gui_opengl_qopengldebug.cpp 0 If you try to clear the error stack, make sure not just keep going until GL_NO_ERROR is returned but also break on GL_CONTEXT_LOST as that error @@ -125,20 +116,7 @@ QT_BEGIN_NAMESPACE to create a debug context from Qt, you must set the QSurfaceFormat::DebugContext format option on the QSurfaceFormat used to create the QOpenGLContext object: - \code - - QSurfaceFormat format; - // asks for a OpenGL 3.2 debug context using the Core profile - format.setMajorVersion(3); - format.setMinorVersion(2); - format.setProfile(QSurfaceFormat::CoreProfile); - format.setOption(QSurfaceFormat::DebugContext); - - QOpenGLContext *context = new QOpenGLContext; - context->setFormat(format); - context->create(); - - \endcode + \snippet code/src_gui_opengl_qopengldebug.cpp 1 Note that requesting a 3.2 OpenGL Core Profile is just for the example's purposes; this class is not tied to any specific OpenGL or OpenGL ES @@ -152,24 +130,13 @@ QT_BEGIN_NAMESPACE object), and like the other OpenGL functions in Qt you \e{must} initialize it before usage by calling initialize() whilst there is a current OpenGL context: - \code - - QOpenGLContext *ctx = QOpenGLContext::currentContext(); - QOpenGLDebugLogger *logger = new QOpenGLDebugLogger(this); - - logger->initialize(); // initializes in the current context, i.e. ctx - - \endcode + \snippet code/src_gui_opengl_qopengldebug.cpp 2 Note that the \c{GL_KHR_debug} extension \e{must} be available in the context in order to access the messages logged by OpenGL. You can check the presence of this extension by calling: - \code - - ctx->hasExtension(QByteArrayLiteral("GL_KHR_debug")) - - \endcode + \snippet code/src_gui_opengl_qopengldebug.cpp 3 where \c{ctx} is a valid QOpenGLContext. If the extension is not available, initialize() will return false. @@ -179,13 +146,7 @@ QT_BEGIN_NAMESPACE OpenGL implementations keep an internal log of debug messages. Messages stored in this log can be retrieved by using the loggedMessages() function: - \code - - const QList<QOpenGLDebugMessage> messages = logger->loggedMessages(); - for (const QOpenGLDebugMessage &message : messages) - qDebug() << message; - - \endcode + \snippet code/src_gui_opengl_qopengldebug.cpp 4 The internal log has a limited size; when it fills up, older messages will get discarded to make room for the new incoming messages. When you call @@ -203,12 +164,7 @@ QT_BEGIN_NAMESPACE you need to connect a suitable slot to the messageLogged() signal, and start logging by calling startLogging(): - \code - - connect(logger, &QOpenGLDebugLogger::messageLogged, receiver, &LogHandler::handleLoggedMessage); - logger->startLogging(); - - \endcode + \snippet code/src_gui_opengl_qopengldebug.cpp 5 Similarly, logging can be disabled at any time by calling the stopLogging() function. @@ -259,14 +215,7 @@ QT_BEGIN_NAMESPACE \l{QOpenGLDebugMessage::}{createThirdPartyMessage()}, and then inserting it into the log by calling logMessage(): - \code - - QOpenGLDebugMessage message = - QOpenGLDebugMessage::createApplicationMessage(QStringLiteral("Custom message")); - - logger->logMessage(message); - - \endcode + \snippet code/src_gui_opengl_qopengldebug.cpp 6 Note that OpenGL implementations have a vendor-specific limit to the length of the messages that can be inserted in the debug log. You can retrieve diff --git a/src/gui/opengl/qopengldebug.h b/src/gui/opengl/qopengldebug.h index 556ec175e1..1ba3ef91ac 100644 --- a/src/gui/opengl/qopengldebug.h +++ b/src/gui/opengl/qopengldebug.h @@ -111,11 +111,11 @@ public: QOpenGLDebugMessage &operator=(const QOpenGLDebugMessage &debugMessage); #ifdef Q_COMPILER_RVALUE_REFS - QOpenGLDebugMessage &operator=(QOpenGLDebugMessage &&other) Q_DECL_NOTHROW { swap(other); return *this; } + QOpenGLDebugMessage &operator=(QOpenGLDebugMessage &&other) noexcept { swap(other); return *this; } #endif ~QOpenGLDebugMessage(); - void swap(QOpenGLDebugMessage &other) Q_DECL_NOTHROW { qSwap(d, other.d); } + void swap(QOpenGLDebugMessage &other) noexcept { qSwap(d, other.d); } Source source() const; Type type() const; diff --git a/src/gui/opengl/qopenglengineshadermanager.cpp b/src/gui/opengl/qopenglengineshadermanager.cpp index b7bac2728a..1e5a10c99c 100644 --- a/src/gui/opengl/qopenglengineshadermanager.cpp +++ b/src/gui/opengl/qopenglengineshadermanager.cpp @@ -256,9 +256,13 @@ QOpenGLEngineSharedShaders::QOpenGLEngineSharedShaders(QOpenGLContext* context) QByteArray fragSource; // Compile up the simple shader: +#ifdef Q_OS_WASM + vertexSource.append(qShaderSnippets[PositionOnlyVertexShader]); + vertexSource.append(qShaderSnippets[MainVertexShader]); +#else vertexSource.append(qShaderSnippets[MainVertexShader]); vertexSource.append(qShaderSnippets[PositionOnlyVertexShader]); - +#endif fragSource.append(qShaderSnippets[MainFragmentShader]); fragSource.append(qShaderSnippets[ShockingPinkSrcFragmentShader]); @@ -384,9 +388,13 @@ QOpenGLEngineShaderProg *QOpenGLEngineSharedShaders::findProgramInCache(const QO fragSource.append(qShaderSnippets[prog.maskFragShader]); QByteArray vertexSource; +#ifdef Q_OS_WASM + vertexSource.append(qShaderSnippets[prog.positionVertexShader]); + vertexSource.append(qShaderSnippets[prog.mainVertexShader]); +#else vertexSource.append(qShaderSnippets[prog.mainVertexShader]); vertexSource.append(qShaderSnippets[prog.positionVertexShader]); - +#endif QScopedPointer<QOpenGLShaderProgram> shaderProgram(new QOpenGLShaderProgram); CachedShader shaderCache(fragSource, vertexSource); diff --git a/src/gui/opengl/qopenglengineshadermanager_p.h b/src/gui/opengl/qopenglengineshadermanager_p.h index d43788d777..14c79f5de3 100644 --- a/src/gui/opengl/qopenglengineshadermanager_p.h +++ b/src/gui/opengl/qopenglengineshadermanager_p.h @@ -370,7 +370,7 @@ private: class QOpenGLEngineShaderProg { public: - QOpenGLEngineShaderProg() : program(0) {} + QOpenGLEngineShaderProg() : program(nullptr) {} ~QOpenGLEngineShaderProg() { if (program) diff --git a/src/gui/opengl/qopengles2ext.h b/src/gui/opengl/qopengles2ext.h index 8ff50a924e..8517e24267 100644 --- a/src/gui/opengl/qopengles2ext.h +++ b/src/gui/opengl/qopengles2ext.h @@ -1,5 +1,5 @@ -#ifndef __gl2ext_h_ -#define __gl2ext_h_ 1 +#ifndef __gles2_gl2ext_h_ +#define __gles2_gl2ext_h_ 1 #if 0 #pragma qt_no_master_include @@ -25,7 +25,7 @@ typedef struct __GLsync *GLsync; #endif /* -** Copyright (c) 2013-2017 The Khronos Group Inc. +** Copyright (c) 2013-2018 The Khronos Group Inc. ** ** Permission is hereby granted, free of charge, to any person obtaining a ** copy of this software and/or associated documentation files (the @@ -57,7 +57,7 @@ typedef struct __GLsync *GLsync; #define GL_APIENTRYP GL_APIENTRY* #endif -/* Generated on date 20170331 */ +/* Generated on date 20190228 */ /* Generated C header for: * API: gles2 @@ -178,6 +178,16 @@ GL_APICALL void GL_APIENTRY glGetPointervKHR (GLenum pname, void **params); #define GL_CONTEXT_FLAG_NO_ERROR_BIT_KHR 0x00000008 #endif /* GL_KHR_no_error */ +#ifndef GL_KHR_parallel_shader_compile +#define GL_KHR_parallel_shader_compile 1 +#define GL_MAX_SHADER_COMPILER_THREADS_KHR 0x91B0 +#define GL_COMPLETION_STATUS_KHR 0x91B1 +typedef void (GL_APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSKHRPROC) (GLuint count); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glMaxShaderCompilerThreadsKHR (GLuint count); +#endif +#endif /* GL_KHR_parallel_shader_compile */ + #ifndef GL_KHR_robust_buffer_access_behavior #define GL_KHR_robust_buffer_access_behavior 1 #endif /* GL_KHR_robust_buffer_access_behavior */ @@ -343,12 +353,12 @@ GL_APICALL GLboolean GL_APIENTRY glIsEnablediOES (GLenum target, GLuint index); typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSBASEVERTEXOESPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); typedef void (GL_APIENTRYP PFNGLDRAWRANGEELEMENTSBASEVERTEXOESPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXOESPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); -typedef void (GL_APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXOESPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, const GLint *basevertex); +typedef void (GL_APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, const GLint *basevertex); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glDrawElementsBaseVertexOES (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); GL_APICALL void GL_APIENTRY glDrawRangeElementsBaseVertexOES (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); GL_APICALL void GL_APIENTRY glDrawElementsInstancedBaseVertexOES (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); -GL_APICALL void GL_APIENTRY glMultiDrawElementsBaseVertexOES (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, const GLint *basevertex); +GL_APICALL void GL_APIENTRY glMultiDrawElementsBaseVertexEXT (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, const GLint *basevertex); #endif #endif /* GL_OES_draw_elements_base_vertex */ @@ -810,6 +820,22 @@ GL_APICALL void GL_APIENTRY glGetFloati_vOES (GLenum target, GLuint index, GLflo #define GL_ATC_RGBA_INTERPOLATED_ALPHA_AMD 0x87EE #endif /* GL_AMD_compressed_ATC_texture */ +#ifndef GL_AMD_framebuffer_multisample_advanced +#define GL_AMD_framebuffer_multisample_advanced 1 +#define GL_RENDERBUFFER_STORAGE_SAMPLES_AMD 0x91B2 +#define GL_MAX_COLOR_FRAMEBUFFER_SAMPLES_AMD 0x91B3 +#define GL_MAX_COLOR_FRAMEBUFFER_STORAGE_SAMPLES_AMD 0x91B4 +#define GL_MAX_DEPTH_STENCIL_FRAMEBUFFER_SAMPLES_AMD 0x91B5 +#define GL_NUM_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B6 +#define GL_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B7 +typedef void (GL_APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glRenderbufferStorageMultisampleAdvancedAMD (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +GL_APICALL void GL_APIENTRY glNamedRenderbufferStorageMultisampleAdvancedAMD (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#endif +#endif /* GL_AMD_framebuffer_multisample_advanced */ + #ifndef GL_AMD_performance_monitor #define GL_AMD_performance_monitor 1 #define GL_COUNTER_TYPE_AMD 0x8BC0 @@ -1070,6 +1096,20 @@ GL_APICALL void GL_APIENTRY glGetSyncivAPPLE (GLsync sync, GLenum pname, GLsizei #define GL_SHADER_BINARY_DMP 0x9250 #endif /* GL_DMP_shader_binary */ +#ifndef GL_EXT_EGL_image_array +#define GL_EXT_EGL_image_array 1 +#endif /* GL_EXT_EGL_image_array */ + +#ifndef GL_EXT_EGL_image_storage +#define GL_EXT_EGL_image_storage 1 +typedef void (GL_APIENTRYP PFNGLEGLIMAGETARGETTEXSTORAGEEXTPROC) (GLenum target, GLeglImageOES image, const GLint* attrib_list); +typedef void (GL_APIENTRYP PFNGLEGLIMAGETARGETTEXTURESTORAGEEXTPROC) (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glEGLImageTargetTexStorageEXT (GLenum target, GLeglImageOES image, const GLint* attrib_list); +GL_APICALL void GL_APIENTRY glEGLImageTargetTextureStorageEXT (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#endif +#endif /* GL_EXT_EGL_image_storage */ + #ifndef GL_EXT_YUV_target #define GL_EXT_YUV_target 1 #define GL_SAMPLER_EXTERNAL_2D_Y2Y_EXT 0x8BE7 @@ -1141,6 +1181,20 @@ GL_APICALL void GL_APIENTRY glClearTexSubImageEXT (GLuint texture, GLint level, #endif #endif /* GL_EXT_clear_texture */ +#ifndef GL_EXT_clip_control +#define GL_EXT_clip_control 1 +#define GL_LOWER_LEFT_EXT 0x8CA1 +#define GL_UPPER_LEFT_EXT 0x8CA2 +#define GL_NEGATIVE_ONE_TO_ONE_EXT 0x935E +#define GL_ZERO_TO_ONE_EXT 0x935F +#define GL_CLIP_ORIGIN_EXT 0x935C +#define GL_CLIP_DEPTH_MODE_EXT 0x935D +typedef void (GL_APIENTRYP PFNGLCLIPCONTROLEXTPROC) (GLenum origin, GLenum depth); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glClipControlEXT (GLenum origin, GLenum depth); +#endif +#endif /* GL_EXT_clip_control */ + #ifndef GL_EXT_clip_cull_distance #define GL_EXT_clip_cull_distance 1 #define GL_MAX_CLIP_DISTANCES_EXT 0x0D32 @@ -1211,6 +1265,11 @@ GL_APICALL void GL_APIENTRY glPopGroupMarkerEXT (void); #endif #endif /* GL_EXT_debug_marker */ +#ifndef GL_EXT_depth_clamp +#define GL_EXT_depth_clamp 1 +#define GL_DEPTH_CLAMP_EXT 0x864F +#endif /* GL_EXT_depth_clamp */ + #ifndef GL_EXT_discard_framebuffer #define GL_EXT_discard_framebuffer 1 #define GL_COLOR_EXT 0x1800 @@ -1326,12 +1385,10 @@ GL_APICALL GLboolean GL_APIENTRY glIsEnablediEXT (GLenum target, GLuint index); typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSBASEVERTEXEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); typedef void (GL_APIENTRYP PFNGLDRAWRANGEELEMENTSBASEVERTEXEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); -typedef void (GL_APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, const GLint *basevertex); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glDrawElementsBaseVertexEXT (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); GL_APICALL void GL_APIENTRY glDrawRangeElementsBaseVertexEXT (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); GL_APICALL void GL_APIENTRY glDrawElementsInstancedBaseVertexEXT (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); -GL_APICALL void GL_APIENTRY glMultiDrawElementsBaseVertexEXT (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, const GLint *basevertex); #endif #endif /* GL_EXT_draw_elements_base_vertex */ @@ -1355,6 +1412,17 @@ GL_APICALL void GL_APIENTRY glDrawTransformFeedbackInstancedEXT (GLenum mode, GL #endif #endif /* GL_EXT_draw_transform_feedback */ +#ifndef GL_EXT_external_buffer +#define GL_EXT_external_buffer 1 +typedef void *GLeglClientBufferEXT; +typedef void (GL_APIENTRYP PFNGLBUFFERSTORAGEEXTERNALEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +typedef void (GL_APIENTRYP PFNGLNAMEDBUFFERSTORAGEEXTERNALEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glBufferStorageExternalEXT (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +GL_APICALL void GL_APIENTRY glNamedBufferStorageExternalEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#endif +#endif /* GL_EXT_external_buffer */ + #ifndef GL_EXT_float_blend #define GL_EXT_float_blend 1 #endif /* GL_EXT_float_blend */ @@ -1433,6 +1501,85 @@ GL_APICALL void GL_APIENTRY glFlushMappedBufferRangeEXT (GLenum target, GLintptr #endif #endif /* GL_EXT_map_buffer_range */ +#ifndef GL_EXT_memory_object +#define GL_EXT_memory_object 1 +#define GL_TEXTURE_TILING_EXT 0x9580 +#define GL_DEDICATED_MEMORY_OBJECT_EXT 0x9581 +#define GL_PROTECTED_MEMORY_OBJECT_EXT 0x959B +#define GL_NUM_TILING_TYPES_EXT 0x9582 +#define GL_TILING_TYPES_EXT 0x9583 +#define GL_OPTIMAL_TILING_EXT 0x9584 +#define GL_LINEAR_TILING_EXT 0x9585 +#define GL_NUM_DEVICE_UUIDS_EXT 0x9596 +#define GL_DEVICE_UUID_EXT 0x9597 +#define GL_DRIVER_UUID_EXT 0x9598 +#define GL_UUID_SIZE_EXT 16 +typedef void (GL_APIENTRYP PFNGLGETUNSIGNEDBYTEVEXTPROC) (GLenum pname, GLubyte *data); +typedef void (GL_APIENTRYP PFNGLGETUNSIGNEDBYTEI_VEXTPROC) (GLenum target, GLuint index, GLubyte *data); +typedef void (GL_APIENTRYP PFNGLDELETEMEMORYOBJECTSEXTPROC) (GLsizei n, const GLuint *memoryObjects); +typedef GLboolean (GL_APIENTRYP PFNGLISMEMORYOBJECTEXTPROC) (GLuint memoryObject); +typedef void (GL_APIENTRYP PFNGLCREATEMEMORYOBJECTSEXTPROC) (GLsizei n, GLuint *memoryObjects); +typedef void (GL_APIENTRYP PFNGLMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, const GLint *params); +typedef void (GL_APIENTRYP PFNGLGETMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEMEM2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEMEM2DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEMEM3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEMEM3DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLBUFFERSTORAGEMEMEXTPROC) (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGEMEM2DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGEMEM2DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGEMEM3DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGEMEM3DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLNAMEDBUFFERSTORAGEMEMEXTPROC) (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glGetUnsignedBytevEXT (GLenum pname, GLubyte *data); +GL_APICALL void GL_APIENTRY glGetUnsignedBytei_vEXT (GLenum target, GLuint index, GLubyte *data); +GL_APICALL void GL_APIENTRY glDeleteMemoryObjectsEXT (GLsizei n, const GLuint *memoryObjects); +GL_APICALL GLboolean GL_APIENTRY glIsMemoryObjectEXT (GLuint memoryObject); +GL_APICALL void GL_APIENTRY glCreateMemoryObjectsEXT (GLsizei n, GLuint *memoryObjects); +GL_APICALL void GL_APIENTRY glMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, const GLint *params); +GL_APICALL void GL_APIENTRY glGetMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, GLint *params); +GL_APICALL void GL_APIENTRY glTexStorageMem2DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTexStorageMem2DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTexStorageMem3DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTexStorageMem3DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glBufferStorageMemEXT (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureStorageMem2DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureStorageMem2DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureStorageMem3DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureStorageMem3DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glNamedBufferStorageMemEXT (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_EXT_memory_object */ + +#ifndef GL_EXT_memory_object_fd +#define GL_EXT_memory_object_fd 1 +#define GL_HANDLE_TYPE_OPAQUE_FD_EXT 0x9586 +typedef void (GL_APIENTRYP PFNGLIMPORTMEMORYFDEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glImportMemoryFdEXT (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_memory_object_fd */ + +#ifndef GL_EXT_memory_object_win32 +#define GL_EXT_memory_object_win32 1 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_EXT 0x9587 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_KMT_EXT 0x9588 +#define GL_DEVICE_LUID_EXT 0x9599 +#define GL_DEVICE_NODE_MASK_EXT 0x959A +#define GL_LUID_SIZE_EXT 8 +#define GL_HANDLE_TYPE_D3D12_TILEPOOL_EXT 0x9589 +#define GL_HANDLE_TYPE_D3D12_RESOURCE_EXT 0x958A +#define GL_HANDLE_TYPE_D3D11_IMAGE_EXT 0x958B +#define GL_HANDLE_TYPE_D3D11_IMAGE_KMT_EXT 0x958C +typedef void (GL_APIENTRYP PFNGLIMPORTMEMORYWIN32HANDLEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +typedef void (GL_APIENTRYP PFNGLIMPORTMEMORYWIN32NAMEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glImportMemoryWin32HandleEXT (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +GL_APICALL void GL_APIENTRY glImportMemoryWin32NameEXT (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_memory_object_win32 */ + #ifndef GL_EXT_multi_draw_arrays #define GL_EXT_multi_draw_arrays 1 typedef void (GL_APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); @@ -1598,6 +1745,55 @@ GL_APICALL void GL_APIENTRY glGetnUniformivEXT (GLuint program, GLint location, #define GL_FRAMEBUFFER_SRGB_EXT 0x8DB9 #endif /* GL_EXT_sRGB_write_control */ +#ifndef GL_EXT_semaphore +#define GL_EXT_semaphore 1 +#define GL_LAYOUT_GENERAL_EXT 0x958D +#define GL_LAYOUT_COLOR_ATTACHMENT_EXT 0x958E +#define GL_LAYOUT_DEPTH_STENCIL_ATTACHMENT_EXT 0x958F +#define GL_LAYOUT_DEPTH_STENCIL_READ_ONLY_EXT 0x9590 +#define GL_LAYOUT_SHADER_READ_ONLY_EXT 0x9591 +#define GL_LAYOUT_TRANSFER_SRC_EXT 0x9592 +#define GL_LAYOUT_TRANSFER_DST_EXT 0x9593 +#define GL_LAYOUT_DEPTH_READ_ONLY_STENCIL_ATTACHMENT_EXT 0x9530 +#define GL_LAYOUT_DEPTH_ATTACHMENT_STENCIL_READ_ONLY_EXT 0x9531 +typedef void (GL_APIENTRYP PFNGLGENSEMAPHORESEXTPROC) (GLsizei n, GLuint *semaphores); +typedef void (GL_APIENTRYP PFNGLDELETESEMAPHORESEXTPROC) (GLsizei n, const GLuint *semaphores); +typedef GLboolean (GL_APIENTRYP PFNGLISSEMAPHOREEXTPROC) (GLuint semaphore); +typedef void (GL_APIENTRYP PFNGLSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, const GLuint64 *params); +typedef void (GL_APIENTRYP PFNGLGETSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, GLuint64 *params); +typedef void (GL_APIENTRYP PFNGLWAITSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +typedef void (GL_APIENTRYP PFNGLSIGNALSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glGenSemaphoresEXT (GLsizei n, GLuint *semaphores); +GL_APICALL void GL_APIENTRY glDeleteSemaphoresEXT (GLsizei n, const GLuint *semaphores); +GL_APICALL GLboolean GL_APIENTRY glIsSemaphoreEXT (GLuint semaphore); +GL_APICALL void GL_APIENTRY glSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, const GLuint64 *params); +GL_APICALL void GL_APIENTRY glGetSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, GLuint64 *params); +GL_APICALL void GL_APIENTRY glWaitSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +GL_APICALL void GL_APIENTRY glSignalSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#endif +#endif /* GL_EXT_semaphore */ + +#ifndef GL_EXT_semaphore_fd +#define GL_EXT_semaphore_fd 1 +typedef void (GL_APIENTRYP PFNGLIMPORTSEMAPHOREFDEXTPROC) (GLuint semaphore, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glImportSemaphoreFdEXT (GLuint semaphore, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_semaphore_fd */ + +#ifndef GL_EXT_semaphore_win32 +#define GL_EXT_semaphore_win32 1 +#define GL_HANDLE_TYPE_D3D12_FENCE_EXT 0x9594 +#define GL_D3D12_FENCE_VALUE_EXT 0x9595 +typedef void (GL_APIENTRYP PFNGLIMPORTSEMAPHOREWIN32HANDLEEXTPROC) (GLuint semaphore, GLenum handleType, void *handle); +typedef void (GL_APIENTRYP PFNGLIMPORTSEMAPHOREWIN32NAMEEXTPROC) (GLuint semaphore, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glImportSemaphoreWin32HandleEXT (GLuint semaphore, GLenum handleType, void *handle); +GL_APICALL void GL_APIENTRY glImportSemaphoreWin32NameEXT (GLuint semaphore, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_semaphore_win32 */ + #ifndef GL_EXT_separate_shader_objects #define GL_EXT_separate_shader_objects 1 #define GL_ACTIVE_PROGRAM_EXT 0x8259 @@ -1703,6 +1899,14 @@ GL_APICALL void GL_APIENTRY glProgramUniformMatrix4x3fvEXT (GLuint program, GLin #define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52 #endif /* GL_EXT_shader_framebuffer_fetch */ +#ifndef GL_EXT_shader_framebuffer_fetch_non_coherent +#define GL_EXT_shader_framebuffer_fetch_non_coherent 1 +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIEREXTPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferFetchBarrierEXT (void); +#endif +#endif /* GL_EXT_shader_framebuffer_fetch_non_coherent */ + #ifndef GL_EXT_shader_group_vote #define GL_EXT_shader_group_vote 1 #endif /* GL_EXT_shader_group_vote */ @@ -1890,18 +2094,42 @@ GL_APICALL void GL_APIENTRY glTexBufferRangeEXT (GLenum target, GLenum internalf #define GL_TEXTURE_ASTC_DECODE_PRECISION_EXT 0x8F69 #endif /* GL_EXT_texture_compression_astc_decode_mode */ +#ifndef GL_EXT_texture_compression_bptc +#define GL_EXT_texture_compression_bptc 1 +#define GL_COMPRESSED_RGBA_BPTC_UNORM_EXT 0x8E8C +#define GL_COMPRESSED_SRGB_ALPHA_BPTC_UNORM_EXT 0x8E8D +#define GL_COMPRESSED_RGB_BPTC_SIGNED_FLOAT_EXT 0x8E8E +#define GL_COMPRESSED_RGB_BPTC_UNSIGNED_FLOAT_EXT 0x8E8F +#endif /* GL_EXT_texture_compression_bptc */ + #ifndef GL_EXT_texture_compression_dxt1 #define GL_EXT_texture_compression_dxt1 1 #define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0 #define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1 #endif /* GL_EXT_texture_compression_dxt1 */ +#ifndef GL_EXT_texture_compression_rgtc +#define GL_EXT_texture_compression_rgtc 1 +#define GL_COMPRESSED_RED_RGTC1_EXT 0x8DBB +#define GL_COMPRESSED_SIGNED_RED_RGTC1_EXT 0x8DBC +#define GL_COMPRESSED_RED_GREEN_RGTC2_EXT 0x8DBD +#define GL_COMPRESSED_SIGNED_RED_GREEN_RGTC2_EXT 0x8DBE +#endif /* GL_EXT_texture_compression_rgtc */ + #ifndef GL_EXT_texture_compression_s3tc #define GL_EXT_texture_compression_s3tc 1 #define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT 0x83F2 #define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3 #endif /* GL_EXT_texture_compression_s3tc */ +#ifndef GL_EXT_texture_compression_s3tc_srgb +#define GL_EXT_texture_compression_s3tc_srgb 1 +#define GL_COMPRESSED_SRGB_S3TC_DXT1_EXT 0x8C4C +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT1_EXT 0x8C4D +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT3_EXT 0x8C4E +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F +#endif /* GL_EXT_texture_compression_s3tc_srgb */ + #ifndef GL_EXT_texture_cube_map_array #define GL_EXT_texture_cube_map_array 1 #define GL_TEXTURE_CUBE_MAP_ARRAY_EXT 0x9009 @@ -1923,12 +2151,24 @@ GL_APICALL void GL_APIENTRY glTexBufferRangeEXT (GLenum target, GLenum internalf #ifndef GL_EXT_texture_filter_minmax #define GL_EXT_texture_filter_minmax 1 +#define GL_TEXTURE_REDUCTION_MODE_EXT 0x9366 +#define GL_WEIGHTED_AVERAGE_EXT 0x9367 #endif /* GL_EXT_texture_filter_minmax */ #ifndef GL_EXT_texture_format_BGRA8888 #define GL_EXT_texture_format_BGRA8888 1 #endif /* GL_EXT_texture_format_BGRA8888 */ +#ifndef GL_EXT_texture_format_sRGB_override +#define GL_EXT_texture_format_sRGB_override 1 +#define GL_TEXTURE_FORMAT_SRGB_OVERRIDE_EXT 0x8FBF +#endif /* GL_EXT_texture_format_sRGB_override */ + +#ifndef GL_EXT_texture_mirror_clamp_to_edge +#define GL_EXT_texture_mirror_clamp_to_edge 1 +#define GL_MIRROR_CLAMP_TO_EDGE_EXT 0x8743 +#endif /* GL_EXT_texture_mirror_clamp_to_edge */ + #ifndef GL_EXT_texture_norm16 #define GL_EXT_texture_norm16 1 #define GL_R16_EXT 0x822A @@ -1938,6 +2178,10 @@ GL_APICALL void GL_APIENTRY glTexBufferRangeEXT (GLenum target, GLenum internalf #define GL_RGB16_SNORM_EXT 0x8F9A #endif /* GL_EXT_texture_norm16 */ +#ifndef GL_EXT_texture_query_lod +#define GL_EXT_texture_query_lod 1 +#endif /* GL_EXT_texture_query_lod */ + #ifndef GL_EXT_texture_rg #define GL_EXT_texture_rg 1 #define GL_RED_EXT 0x1903 @@ -2019,6 +2263,16 @@ GL_APICALL void GL_APIENTRY glTextureViewEXT (GLuint texture, GLenum target, GLu #define GL_UNPACK_SKIP_PIXELS_EXT 0x0CF4 #endif /* GL_EXT_unpack_subimage */ +#ifndef GL_EXT_win32_keyed_mutex +#define GL_EXT_win32_keyed_mutex 1 +typedef GLboolean (GL_APIENTRYP PFNGLACQUIREKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key, GLuint timeout); +typedef GLboolean (GL_APIENTRYP PFNGLRELEASEKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL GLboolean GL_APIENTRY glAcquireKeyedMutexWin32EXT (GLuint memory, GLuint64 key, GLuint timeout); +GL_APICALL GLboolean GL_APIENTRY glReleaseKeyedMutexWin32EXT (GLuint memory, GLuint64 key); +#endif +#endif /* GL_EXT_win32_keyed_mutex */ + #ifndef GL_EXT_window_rectangles #define GL_EXT_window_rectangles 1 #define GL_INCLUSIVE_EXT 0x8F10 @@ -2121,6 +2375,11 @@ GL_APICALL void GL_APIENTRY glFramebufferTexture2DMultisampleIMG (GLenum target, #define GL_CUBIC_MIPMAP_LINEAR_IMG 0x913B #endif /* GL_IMG_texture_filter_cubic */ +#ifndef GL_INTEL_blackhole_render +#define GL_INTEL_blackhole_render 1 +#define GL_BLACKHOLE_RENDER_INTEL 0x83FC +#endif /* GL_INTEL_blackhole_render */ + #ifndef GL_INTEL_conservative_rasterization #define GL_INTEL_conservative_rasterization 1 #define GL_CONSERVATIVE_RASTERIZATION_INTEL 0x83FE @@ -2163,7 +2422,7 @@ typedef void (GL_APIENTRYP PFNGLENDPERFQUERYINTELPROC) (GLuint queryHandle); typedef void (GL_APIENTRYP PFNGLGETFIRSTPERFQUERYIDINTELPROC) (GLuint *queryId); typedef void (GL_APIENTRYP PFNGLGETNEXTPERFQUERYIDINTELPROC) (GLuint queryId, GLuint *nextQueryId); typedef void (GL_APIENTRYP PFNGLGETPERFCOUNTERINFOINTELPROC) (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); -typedef void (GL_APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, GLvoid *data, GLuint *bytesWritten); +typedef void (GL_APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); typedef void (GL_APIENTRYP PFNGLGETPERFQUERYIDBYNAMEINTELPROC) (GLchar *queryName, GLuint *queryId); typedef void (GL_APIENTRYP PFNGLGETPERFQUERYINFOINTELPROC) (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); #ifdef GL_GLEXT_PROTOTYPES @@ -2174,12 +2433,22 @@ GL_APICALL void GL_APIENTRY glEndPerfQueryINTEL (GLuint queryHandle); GL_APICALL void GL_APIENTRY glGetFirstPerfQueryIdINTEL (GLuint *queryId); GL_APICALL void GL_APIENTRY glGetNextPerfQueryIdINTEL (GLuint queryId, GLuint *nextQueryId); GL_APICALL void GL_APIENTRY glGetPerfCounterInfoINTEL (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); -GL_APICALL void GL_APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, GLvoid *data, GLuint *bytesWritten); +GL_APICALL void GL_APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); GL_APICALL void GL_APIENTRY glGetPerfQueryIdByNameINTEL (GLchar *queryName, GLuint *queryId); GL_APICALL void GL_APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); #endif #endif /* GL_INTEL_performance_query */ +#ifndef GL_MESA_framebuffer_flip_y +#define GL_MESA_framebuffer_flip_y 1 +#define GL_FRAMEBUFFER_FLIP_Y_MESA 0x8BBB +#endif /* GL_MESA_framebuffer_flip_y */ + +#ifndef GL_MESA_program_binary_formats +#define GL_MESA_program_binary_formats 1 +#define GL_PROGRAM_BINARY_FORMAT_MESA 0x875F +#endif /* GL_MESA_program_binary_formats */ + #ifndef GL_MESA_shader_integer_functions #define GL_MESA_shader_integer_functions 1 #endif /* GL_MESA_shader_integer_functions */ @@ -2284,6 +2553,27 @@ GL_APICALL void GL_APIENTRY glBlendBarrierNV (void); #define GL_BLEND_ADVANCED_COHERENT_NV 0x9285 #endif /* GL_NV_blend_equation_advanced_coherent */ +#ifndef GL_NV_blend_minmax_factor +#define GL_NV_blend_minmax_factor 1 +#define GL_FACTOR_MIN_AMD 0x901C +#define GL_FACTOR_MAX_AMD 0x901D +#endif /* GL_NV_blend_minmax_factor */ + +#ifndef GL_NV_clip_space_w_scaling +#define GL_NV_clip_space_w_scaling 1 +#define GL_VIEWPORT_POSITION_W_SCALE_NV 0x937C +#define GL_VIEWPORT_POSITION_W_SCALE_X_COEFF_NV 0x937D +#define GL_VIEWPORT_POSITION_W_SCALE_Y_COEFF_NV 0x937E +typedef void (GL_APIENTRYP PFNGLVIEWPORTPOSITIONWSCALENVPROC) (GLuint index, GLfloat xcoeff, GLfloat ycoeff); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glViewportPositionWScaleNV (GLuint index, GLfloat xcoeff, GLfloat ycoeff); +#endif +#endif /* GL_NV_clip_space_w_scaling */ + +#ifndef GL_NV_compute_shader_derivatives +#define GL_NV_compute_shader_derivatives 1 +#endif /* GL_NV_compute_shader_derivatives */ + #ifndef GL_NV_conditional_render #define GL_NV_conditional_render 1 #define GL_QUERY_WAIT_NV 0x8E13 @@ -2310,6 +2600,11 @@ GL_APICALL void GL_APIENTRY glSubpixelPrecisionBiasNV (GLuint xbits, GLuint ybit #endif #endif /* GL_NV_conservative_raster */ +#ifndef GL_NV_conservative_raster_pre_snap +#define GL_NV_conservative_raster_pre_snap 1 +#define GL_CONSERVATIVE_RASTER_MODE_PRE_SNAP_NV 0x9550 +#endif /* GL_NV_conservative_raster_pre_snap */ + #ifndef GL_NV_conservative_raster_pre_snap_triangles #define GL_NV_conservative_raster_pre_snap_triangles 1 #define GL_CONSERVATIVE_RASTER_MODE_NV 0x954D @@ -2655,6 +2950,34 @@ GL_APICALL void GL_APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum #endif #endif /* GL_NV_internalformat_sample_query */ +#ifndef GL_NV_memory_attachment +#define GL_NV_memory_attachment 1 +#define GL_ATTACHED_MEMORY_OBJECT_NV 0x95A4 +#define GL_ATTACHED_MEMORY_OFFSET_NV 0x95A5 +#define GL_MEMORY_ATTACHABLE_ALIGNMENT_NV 0x95A6 +#define GL_MEMORY_ATTACHABLE_SIZE_NV 0x95A7 +#define GL_MEMORY_ATTACHABLE_NV 0x95A8 +#define GL_DETACHED_MEMORY_INCARNATION_NV 0x95A9 +#define GL_DETACHED_TEXTURES_NV 0x95AA +#define GL_DETACHED_BUFFERS_NV 0x95AB +#define GL_MAX_DETACHED_TEXTURES_NV 0x95AC +#define GL_MAX_DETACHED_BUFFERS_NV 0x95AD +typedef void (GL_APIENTRYP PFNGLGETMEMORYOBJECTDETACHEDRESOURCESUIVNVPROC) (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +typedef void (GL_APIENTRYP PFNGLRESETMEMORYOBJECTPARAMETERNVPROC) (GLuint memory, GLenum pname); +typedef void (GL_APIENTRYP PFNGLTEXATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLBUFFERATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTUREATTACHMEMORYNVPROC) (GLuint texture, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLNAMEDBUFFERATTACHMEMORYNVPROC) (GLuint buffer, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glGetMemoryObjectDetachedResourcesuivNV (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +GL_APICALL void GL_APIENTRY glResetMemoryObjectParameterNV (GLuint memory, GLenum pname); +GL_APICALL void GL_APIENTRY glTexAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glBufferAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureAttachMemoryNV (GLuint texture, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glNamedBufferAttachMemoryNV (GLuint buffer, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_NV_memory_attachment */ + #ifndef GL_NV_non_square_matrices #define GL_NV_non_square_matrices 1 #define GL_FLOAT_MAT2x3_NV 0x8B65 @@ -2681,6 +3004,7 @@ GL_APICALL void GL_APIENTRY glUniformMatrix4x3fvNV (GLint location, GLsizei coun #ifndef GL_NV_path_rendering #define GL_NV_path_rendering 1 +typedef double GLdouble; #define GL_PATH_FORMAT_SVG_NV 0x9070 #define GL_PATH_FORMAT_PS_NV 0x9071 #define GL_STANDARD_FONT_NAME_NV 0x9072 @@ -2891,6 +3215,25 @@ typedef GLenum (GL_APIENTRYP PFNGLPATHGLYPHINDEXARRAYNVPROC) (GLuint firstPathNa typedef GLenum (GL_APIENTRYP PFNGLPATHMEMORYGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); typedef void (GL_APIENTRYP PFNGLPROGRAMPATHFRAGMENTINPUTGENNVPROC) (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); typedef void (GL_APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params); +typedef void (GL_APIENTRYP PFNGLMATRIXFRUSTUMEXTPROC) (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADIDENTITYEXTPROC) (GLenum mode); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULTTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULTTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULTFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULTDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (GL_APIENTRYP PFNGLMATRIXORTHOEXTPROC) (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +typedef void (GL_APIENTRYP PFNGLMATRIXPOPEXTPROC) (GLenum mode); +typedef void (GL_APIENTRYP PFNGLMATRIXPUSHEXTPROC) (GLenum mode); +typedef void (GL_APIENTRYP PFNGLMATRIXROTATEFEXTPROC) (GLenum mode, GLfloat angle, GLfloat x, GLfloat y, GLfloat z); +typedef void (GL_APIENTRYP PFNGLMATRIXROTATEDEXTPROC) (GLenum mode, GLdouble angle, GLdouble x, GLdouble y, GLdouble z); +typedef void (GL_APIENTRYP PFNGLMATRIXSCALEFEXTPROC) (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +typedef void (GL_APIENTRYP PFNGLMATRIXSCALEDEXTPROC) (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +typedef void (GL_APIENTRYP PFNGLMATRIXTRANSLATEFEXTPROC) (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +typedef void (GL_APIENTRYP PFNGLMATRIXTRANSLATEDEXTPROC) (GLenum mode, GLdouble x, GLdouble y, GLdouble z); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL GLuint GL_APIENTRY glGenPathsNV (GLsizei range); GL_APICALL void GL_APIENTRY glDeletePathsNV (GLuint path, GLsizei range); @@ -2949,6 +3292,25 @@ GL_APICALL GLenum GL_APIENTRY glPathGlyphIndexArrayNV (GLuint firstPathName, GLe GL_APICALL GLenum GL_APIENTRY glPathMemoryGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); GL_APICALL void GL_APIENTRY glProgramPathFragmentInputGenNV (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); GL_APICALL void GL_APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params); +GL_APICALL void GL_APIENTRY glMatrixFrustumEXT (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +GL_APICALL void GL_APIENTRY glMatrixLoadIdentityEXT (GLenum mode); +GL_APICALL void GL_APIENTRY glMatrixLoadTransposefEXT (GLenum mode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixLoadTransposedEXT (GLenum mode, const GLdouble *m); +GL_APICALL void GL_APIENTRY glMatrixLoadfEXT (GLenum mode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixLoaddEXT (GLenum mode, const GLdouble *m); +GL_APICALL void GL_APIENTRY glMatrixMultTransposefEXT (GLenum mode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixMultTransposedEXT (GLenum mode, const GLdouble *m); +GL_APICALL void GL_APIENTRY glMatrixMultfEXT (GLenum mode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixMultdEXT (GLenum mode, const GLdouble *m); +GL_APICALL void GL_APIENTRY glMatrixOrthoEXT (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +GL_APICALL void GL_APIENTRY glMatrixPopEXT (GLenum mode); +GL_APICALL void GL_APIENTRY glMatrixPushEXT (GLenum mode); +GL_APICALL void GL_APIENTRY glMatrixRotatefEXT (GLenum mode, GLfloat angle, GLfloat x, GLfloat y, GLfloat z); +GL_APICALL void GL_APIENTRY glMatrixRotatedEXT (GLenum mode, GLdouble angle, GLdouble x, GLdouble y, GLdouble z); +GL_APICALL void GL_APIENTRY glMatrixScalefEXT (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +GL_APICALL void GL_APIENTRY glMatrixScaledEXT (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +GL_APICALL void GL_APIENTRY glMatrixTranslatefEXT (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +GL_APICALL void GL_APIENTRY glMatrixTranslatedEXT (GLenum mode, GLdouble x, GLdouble y, GLdouble z); #endif #endif /* GL_NV_path_rendering */ @@ -2957,6 +3319,14 @@ GL_APICALL void GL_APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum pro #define GL_SHARED_EDGE_NV 0xC0 #endif /* GL_NV_path_rendering_shared_edge */ +#ifndef GL_NV_pixel_buffer_object +#define GL_NV_pixel_buffer_object 1 +#define GL_PIXEL_PACK_BUFFER_NV 0x88EB +#define GL_PIXEL_UNPACK_BUFFER_NV 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING_NV 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING_NV 0x88EF +#endif /* GL_NV_pixel_buffer_object */ + #ifndef GL_NV_polygon_mode #define GL_NV_polygon_mode 1 #define GL_POLYGON_MODE_NV 0x0B40 @@ -3034,6 +3404,18 @@ GL_APICALL void GL_APIENTRY glResolveDepthValuesNV (void); #define GL_NV_sample_mask_override_coverage 1 #endif /* GL_NV_sample_mask_override_coverage */ +#ifndef GL_NV_scissor_exclusive +#define GL_NV_scissor_exclusive 1 +#define GL_SCISSOR_TEST_EXCLUSIVE_NV 0x9555 +#define GL_SCISSOR_BOX_EXCLUSIVE_NV 0x9556 +typedef void (GL_APIENTRYP PFNGLSCISSOREXCLUSIVENVPROC) (GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLSCISSOREXCLUSIVEARRAYVNVPROC) (GLuint first, GLsizei count, const GLint *v); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glScissorExclusiveNV (GLint x, GLint y, GLsizei width, GLsizei height); +GL_APICALL void GL_APIENTRY glScissorExclusiveArrayvNV (GLuint first, GLsizei count, const GLint *v); +#endif +#endif /* GL_NV_scissor_exclusive */ + #ifndef GL_NV_shader_atomic_fp16_vector #define GL_NV_shader_atomic_fp16_vector 1 #endif /* GL_NV_shader_atomic_fp16_vector */ @@ -3052,6 +3434,10 @@ GL_APICALL void GL_APIENTRY glResolveDepthValuesNV (void); #define GL_SAMPLER_CUBE_SHADOW_NV 0x8DC5 #endif /* GL_NV_shadow_samplers_cube */ +#ifndef GL_NV_stereo_view_rendering +#define GL_NV_stereo_view_rendering 1 +#endif /* GL_NV_stereo_view_rendering */ + #ifndef GL_NV_texture_border_clamp #define GL_NV_texture_border_clamp 1 #define GL_TEXTURE_BORDER_COLOR_NV 0x1004 @@ -3148,6 +3534,10 @@ GL_APICALL void GL_APIENTRY glFramebufferTextureMultisampleMultiviewOVR (GLenum #endif #endif /* GL_OVR_multiview_multisampled_render_to_texture */ +#ifndef GL_QCOM_YUV_texture_gather +#define GL_QCOM_YUV_texture_gather 1 +#endif /* GL_QCOM_YUV_texture_gather */ + #ifndef GL_QCOM_alpha_test #define GL_QCOM_alpha_test 1 #define GL_ALPHA_TEST_QCOM 0x0BC0 @@ -3245,6 +3635,38 @@ GL_APICALL void GL_APIENTRY glFramebufferFoveationParametersQCOM (GLuint framebu #define GL_PERFMON_GLOBAL_MODE_QCOM 0x8FA0 #endif /* GL_QCOM_perfmon_global_mode */ +#ifndef GL_QCOM_shader_framebuffer_fetch_noncoherent +#define GL_QCOM_shader_framebuffer_fetch_noncoherent 1 +#define GL_FRAMEBUFFER_FETCH_NONCOHERENT_QCOM 0x96A2 +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIERQCOMPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferFetchBarrierQCOM (void); +#endif +#endif /* GL_QCOM_shader_framebuffer_fetch_noncoherent */ + +#ifndef GL_QCOM_shader_framebuffer_fetch_rate +#define GL_QCOM_shader_framebuffer_fetch_rate 1 +#endif /* GL_QCOM_shader_framebuffer_fetch_rate */ + +#ifndef GL_QCOM_texture_foveated +#define GL_QCOM_texture_foveated 1 +#define GL_TEXTURE_FOVEATED_FEATURE_BITS_QCOM 0x8BFB +#define GL_TEXTURE_FOVEATED_MIN_PIXEL_DENSITY_QCOM 0x8BFC +#define GL_TEXTURE_FOVEATED_FEATURE_QUERY_QCOM 0x8BFD +#define GL_TEXTURE_FOVEATED_NUM_FOCAL_POINTS_QUERY_QCOM 0x8BFE +#define GL_FRAMEBUFFER_INCOMPLETE_FOVEATION_QCOM 0x8BFF +typedef void (GL_APIENTRYP PFNGLTEXTUREFOVEATIONPARAMETERSQCOMPROC) (GLuint texture, GLuint layer, GLuint focalPoint, GLfloat focalX, GLfloat focalY, GLfloat gainX, GLfloat gainY, GLfloat foveaArea); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTextureFoveationParametersQCOM (GLuint texture, GLuint layer, GLuint focalPoint, GLfloat focalX, GLfloat focalY, GLfloat gainX, GLfloat gainY, GLfloat foveaArea); +#endif +#endif /* GL_QCOM_texture_foveated */ + +#ifndef GL_QCOM_texture_foveated_subsampled_layout +#define GL_QCOM_texture_foveated_subsampled_layout 1 +#define GL_FOVEATION_SUBSAMPLED_LAYOUT_METHOD_BIT_QCOM 0x00000004 +#define GL_MAX_SHADER_SUBSAMPLED_IMAGE_UNITS_QCOM 0x8FA1 +#endif /* GL_QCOM_texture_foveated_subsampled_layout */ + #ifndef GL_QCOM_tiled_rendering #define GL_QCOM_tiled_rendering 1 #define GL_COLOR_BUFFER_BIT0_QCOM 0x00000001 diff --git a/src/gui/opengl/qopenglext.h b/src/gui/opengl/qopenglext.h index 856adb679e..e3f9205619 100644 --- a/src/gui/opengl/qopenglext.h +++ b/src/gui/opengl/qopenglext.h @@ -12,7 +12,7 @@ extern "C" { #endif /* -** Copyright (c) 2013-2017 The Khronos Group Inc. +** Copyright (c) 2013-2018 The Khronos Group Inc. ** ** Permission is hereby granted, free of charge, to any person obtaining a ** copy of this software and/or associated documentation files (the @@ -57,7 +57,7 @@ extern "C" { #define GLAPI extern #endif -#define GL_GLEXT_VERSION 20170325 +#define GL_GLEXT_VERSION 20190228 /* Generated C header for: * API: gl @@ -359,15 +359,17 @@ GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *m); #define GL_TEXTURE_FILTER_CONTROL 0x8500 #define GL_DEPTH_TEXTURE_MODE 0x884B #define GL_COMPARE_R_TO_TEXTURE 0x884E -#define GL_FUNC_ADD 0x8006 -#define GL_FUNC_SUBTRACT 0x800A -#define GL_FUNC_REVERSE_SUBTRACT 0x800B -#define GL_MIN 0x8007 -#define GL_MAX 0x8008 +#define GL_BLEND_COLOR 0x8005 +#define GL_BLEND_EQUATION 0x8009 #define GL_CONSTANT_COLOR 0x8001 #define GL_ONE_MINUS_CONSTANT_COLOR 0x8002 #define GL_CONSTANT_ALPHA 0x8003 #define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 +#define GL_FUNC_ADD 0x8006 +#define GL_FUNC_REVERSE_SUBTRACT 0x800B +#define GL_FUNC_SUBTRACT 0x800A +#define GL_MIN 0x8007 +#define GL_MAX 0x8008 typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei drawcount); typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount); @@ -468,9 +470,14 @@ GLAPI void APIENTRY glBlendEquation (GLenum mode); #ifndef GL_VERSION_1_5 #define GL_VERSION_1_5 1 -#include <stddef.h> -typedef ptrdiff_t GLsizeiptr; -typedef ptrdiff_t GLintptr; +#ifdef _WIN64 +typedef signed long long int GLsizeiptr; +typedef signed long long int GLintptr; +#else +typedef signed long int GLsizeiptr; +typedef signed long int GLintptr; +#endif + #define GL_BUFFER_SIZE 0x8764 #define GL_BUFFER_USAGE 0x8765 #define GL_QUERY_COUNTER_BITS 0x8864 @@ -2867,6 +2874,42 @@ GLAPI void APIENTRY glTextureBarrier (void); #endif #endif /* GL_VERSION_4_5 */ +#ifndef GL_VERSION_4_6 +#define GL_VERSION_4_6 1 +#define GL_SHADER_BINARY_FORMAT_SPIR_V 0x9551 +#define GL_SPIR_V_BINARY 0x9552 +#define GL_PARAMETER_BUFFER 0x80EE +#define GL_PARAMETER_BUFFER_BINDING 0x80EF +#define GL_CONTEXT_FLAG_NO_ERROR_BIT 0x00000008 +#define GL_VERTICES_SUBMITTED 0x82EE +#define GL_PRIMITIVES_SUBMITTED 0x82EF +#define GL_VERTEX_SHADER_INVOCATIONS 0x82F0 +#define GL_TESS_CONTROL_SHADER_PATCHES 0x82F1 +#define GL_TESS_EVALUATION_SHADER_INVOCATIONS 0x82F2 +#define GL_GEOMETRY_SHADER_PRIMITIVES_EMITTED 0x82F3 +#define GL_FRAGMENT_SHADER_INVOCATIONS 0x82F4 +#define GL_COMPUTE_SHADER_INVOCATIONS 0x82F5 +#define GL_CLIPPING_INPUT_PRIMITIVES 0x82F6 +#define GL_CLIPPING_OUTPUT_PRIMITIVES 0x82F7 +#define GL_POLYGON_OFFSET_CLAMP 0x8E1B +#define GL_SPIR_V_EXTENSIONS 0x9553 +#define GL_NUM_SPIR_V_EXTENSIONS 0x9554 +#define GL_TEXTURE_MAX_ANISOTROPY 0x84FE +#define GL_MAX_TEXTURE_MAX_ANISOTROPY 0x84FF +#define GL_TRANSFORM_FEEDBACK_OVERFLOW 0x82EC +#define GL_TRANSFORM_FEEDBACK_STREAM_OVERFLOW 0x82ED +typedef void (APIENTRYP PFNGLSPECIALIZESHADERPROC) (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTCOUNTPROC) (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTPROC) (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLPOLYGONOFFSETCLAMPPROC) (GLfloat factor, GLfloat units, GLfloat clamp); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSpecializeShader (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +GLAPI void APIENTRY glMultiDrawArraysIndirectCount (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirectCount (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glPolygonOffsetClamp (GLfloat factor, GLfloat units, GLfloat clamp); +#endif +#endif /* GL_VERSION_4_6 */ + #ifndef GL_ARB_ES2_compatibility #define GL_ARB_ES2_compatibility 1 #endif /* GL_ARB_ES2_compatibility */ @@ -3470,8 +3513,6 @@ typedef unsigned short GLhalfARB; #ifndef GL_ARB_imaging #define GL_ARB_imaging 1 -#define GL_BLEND_COLOR 0x8005 -#define GL_BLEND_EQUATION 0x8009 #define GL_CONVOLUTION_1D 0x8010 #define GL_CONVOLUTION_2D 0x8011 #define GL_SEPARABLE_2D 0x8012 @@ -3608,11 +3649,11 @@ GLAPI void APIENTRY glResetMinmax (GLenum target); #define GL_ARB_indirect_parameters 1 #define GL_PARAMETER_BUFFER_ARB 0x80EE #define GL_PARAMETER_BUFFER_BINDING_ARB 0x80EF -typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTCOUNTARBPROC) (GLenum mode, GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTARBPROC) (GLenum mode, GLenum type, GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTCOUNTARBPROC) (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTARBPROC) (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMultiDrawArraysIndirectCountARB (GLenum mode, GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); -GLAPI void APIENTRY glMultiDrawElementsIndirectCountARB (GLenum mode, GLenum type, GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawArraysIndirectCountARB (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirectCountARB (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); #endif #endif /* GL_ARB_indirect_parameters */ @@ -3632,6 +3673,25 @@ GLAPI void APIENTRY glVertexAttribDivisorARB (GLuint index, GLuint divisor); #ifndef GL_ARB_internalformat_query2 #define GL_ARB_internalformat_query2 1 #define GL_SRGB_DECODE_ARB 0x8299 +#define GL_VIEW_CLASS_EAC_R11 0x9383 +#define GL_VIEW_CLASS_EAC_RG11 0x9384 +#define GL_VIEW_CLASS_ETC2_RGB 0x9385 +#define GL_VIEW_CLASS_ETC2_RGBA 0x9386 +#define GL_VIEW_CLASS_ETC2_EAC_RGBA 0x9387 +#define GL_VIEW_CLASS_ASTC_4x4_RGBA 0x9388 +#define GL_VIEW_CLASS_ASTC_5x4_RGBA 0x9389 +#define GL_VIEW_CLASS_ASTC_5x5_RGBA 0x938A +#define GL_VIEW_CLASS_ASTC_6x5_RGBA 0x938B +#define GL_VIEW_CLASS_ASTC_6x6_RGBA 0x938C +#define GL_VIEW_CLASS_ASTC_8x5_RGBA 0x938D +#define GL_VIEW_CLASS_ASTC_8x6_RGBA 0x938E +#define GL_VIEW_CLASS_ASTC_8x8_RGBA 0x938F +#define GL_VIEW_CLASS_ASTC_10x5_RGBA 0x9390 +#define GL_VIEW_CLASS_ASTC_10x6_RGBA 0x9391 +#define GL_VIEW_CLASS_ASTC_10x8_RGBA 0x9392 +#define GL_VIEW_CLASS_ASTC_10x10_RGBA 0x9393 +#define GL_VIEW_CLASS_ASTC_12x10_RGBA 0x9394 +#define GL_VIEW_CLASS_ASTC_12x12_RGBA 0x9395 #endif /* GL_ARB_internalformat_query2 */ #ifndef GL_ARB_invalidate_subdata @@ -3889,6 +3949,10 @@ GLAPI void APIENTRY glPointParameterfvARB (GLenum pname, const GLfloat *params); #define GL_COORD_REPLACE_ARB 0x8862 #endif /* GL_ARB_point_sprite */ +#ifndef GL_ARB_polygon_offset_clamp +#define GL_ARB_polygon_offset_clamp 1 +#endif /* GL_ARB_polygon_offset_clamp */ + #ifndef GL_ARB_post_depth_coverage #define GL_ARB_post_depth_coverage 1 #endif /* GL_ARB_post_depth_coverage */ @@ -4287,6 +4351,10 @@ GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xo #define GL_ARB_sparse_texture_clamp 1 #endif /* GL_ARB_sparse_texture_clamp */ +#ifndef GL_ARB_spirv_extensions +#define GL_ARB_spirv_extensions 1 +#endif /* GL_ARB_spirv_extensions */ + #ifndef GL_ARB_stencil_texturing #define GL_ARB_stencil_texturing 1 #endif /* GL_ARB_stencil_texturing */ @@ -4439,6 +4507,10 @@ GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, void #define GL_DOT3_RGBA_ARB 0x86AF #endif /* GL_ARB_texture_env_dot3 */ +#ifndef GL_ARB_texture_filter_anisotropic +#define GL_ARB_texture_filter_anisotropic 1 +#endif /* GL_ARB_texture_filter_anisotropic */ + #ifndef GL_ARB_texture_filter_minmax #define GL_ARB_texture_filter_minmax 1 #define GL_TEXTURE_REDUCTION_MODE_ARB 0x9366 @@ -4944,6 +5016,16 @@ GLAPI void APIENTRY glBlendBarrierKHR (void); #define GL_CONTEXT_FLAG_NO_ERROR_BIT_KHR 0x00000008 #endif /* GL_KHR_no_error */ +#ifndef GL_KHR_parallel_shader_compile +#define GL_KHR_parallel_shader_compile 1 +#define GL_MAX_SHADER_COMPILER_THREADS_KHR 0x91B0 +#define GL_COMPLETION_STATUS_KHR 0x91B1 +typedef void (APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSKHRPROC) (GLuint count); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMaxShaderCompilerThreadsKHR (GLuint count); +#endif +#endif /* GL_KHR_parallel_shader_compile */ + #ifndef GL_KHR_robust_buffer_access_behavior #define GL_KHR_robust_buffer_access_behavior 1 #endif /* GL_KHR_robust_buffer_access_behavior */ @@ -5384,6 +5466,22 @@ GLAPI void APIENTRY glBlendEquationSeparateIndexedAMD (GLuint buf, GLenum modeRG #endif #endif /* GL_AMD_draw_buffers_blend */ +#ifndef GL_AMD_framebuffer_multisample_advanced +#define GL_AMD_framebuffer_multisample_advanced 1 +#define GL_RENDERBUFFER_STORAGE_SAMPLES_AMD 0x91B2 +#define GL_MAX_COLOR_FRAMEBUFFER_SAMPLES_AMD 0x91B3 +#define GL_MAX_COLOR_FRAMEBUFFER_STORAGE_SAMPLES_AMD 0x91B4 +#define GL_MAX_DEPTH_STENCIL_FRAMEBUFFER_SAMPLES_AMD 0x91B5 +#define GL_NUM_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B6 +#define GL_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B7 +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRenderbufferStorageMultisampleAdvancedAMD (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleAdvancedAMD (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#endif +#endif /* GL_AMD_framebuffer_multisample_advanced */ + #ifndef GL_AMD_framebuffer_sample_positions #define GL_AMD_framebuffer_sample_positions 1 #define GL_SUBSAMPLE_DISTANCE_AMD 0x883F @@ -5423,6 +5521,10 @@ GLAPI void APIENTRY glGetNamedFramebufferParameterfvAMD (GLuint framebuffer, GLe #define GL_FLOAT16_MAT4x3_AMD 0x91CD #endif /* GL_AMD_gpu_shader_half_float */ +#ifndef GL_AMD_gpu_shader_int16 +#define GL_AMD_gpu_shader_int16 1 +#endif /* GL_AMD_gpu_shader_int16 */ + #ifndef GL_AMD_gpu_shader_int64 #define GL_AMD_gpu_shader_int64 1 typedef int64_t GLint64EXT; @@ -5644,6 +5746,14 @@ GLAPI void APIENTRY glSetMultisamplefvAMD (GLenum pname, GLuint index, const GLf #define GL_AMD_shader_explicit_vertex_parameter 1 #endif /* GL_AMD_shader_explicit_vertex_parameter */ +#ifndef GL_AMD_shader_gpu_shader_half_float_fetch +#define GL_AMD_shader_gpu_shader_half_float_fetch 1 +#endif /* GL_AMD_shader_gpu_shader_half_float_fetch */ + +#ifndef GL_AMD_shader_image_load_store_lod +#define GL_AMD_shader_image_load_store_lod 1 +#endif /* GL_AMD_shader_image_load_store_lod */ + #ifndef GL_AMD_shader_stencil_export #define GL_AMD_shader_stencil_export 1 #endif /* GL_AMD_shader_stencil_export */ @@ -5683,6 +5793,10 @@ GLAPI void APIENTRY glStencilOpValueAMD (GLenum face, GLuint value); #endif #endif /* GL_AMD_stencil_operation_extended */ +#ifndef GL_AMD_texture_gather_bias_lod +#define GL_AMD_texture_gather_bias_lod 1 +#endif /* GL_AMD_texture_gather_bias_lod */ + #ifndef GL_AMD_texture_texture4 #define GL_AMD_texture_texture4 1 #endif /* GL_AMD_texture_texture4 */ @@ -6383,6 +6497,17 @@ GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum pname, GLfloat param); #define GL_422_REV_AVERAGE_EXT 0x80CF #endif /* GL_EXT_422_pixels */ +#ifndef GL_EXT_EGL_image_storage +#define GL_EXT_EGL_image_storage 1 +typedef void *GLeglImageOES; +typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXSTORAGEEXTPROC) (GLenum target, GLeglImageOES image, const GLint* attrib_list); +typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXTURESTORAGEEXTPROC) (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glEGLImageTargetTexStorageEXT (GLenum target, GLeglImageOES image, const GLint* attrib_list); +GLAPI void APIENTRY glEGLImageTargetTextureStorageEXT (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#endif +#endif /* GL_EXT_EGL_image_storage */ + #ifndef GL_EXT_abgr #define GL_EXT_abgr 1 #define GL_ABGR_EXT 0x8000 @@ -7234,6 +7359,17 @@ GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum mode, GLuint start, GLuint en #endif #endif /* GL_EXT_draw_range_elements */ +#ifndef GL_EXT_external_buffer +#define GL_EXT_external_buffer 1 +typedef void *GLeglClientBufferEXT; +typedef void (APIENTRYP PFNGLBUFFERSTORAGEEXTERNALEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEEXTERNALEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferStorageExternalEXT (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +GLAPI void APIENTRY glNamedBufferStorageExternalEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#endif +#endif /* GL_EXT_external_buffer */ + #ifndef GL_EXT_fog_coord #define GL_EXT_fog_coord 1 #define GL_FOG_COORDINATE_SOURCE_EXT 0x8450 @@ -7577,6 +7713,89 @@ GLAPI void APIENTRY glTextureMaterialEXT (GLenum face, GLenum mode); #endif #endif /* GL_EXT_light_texture */ +#ifndef GL_EXT_memory_object +#define GL_EXT_memory_object 1 +#define GL_TEXTURE_TILING_EXT 0x9580 +#define GL_DEDICATED_MEMORY_OBJECT_EXT 0x9581 +#define GL_PROTECTED_MEMORY_OBJECT_EXT 0x959B +#define GL_NUM_TILING_TYPES_EXT 0x9582 +#define GL_TILING_TYPES_EXT 0x9583 +#define GL_OPTIMAL_TILING_EXT 0x9584 +#define GL_LINEAR_TILING_EXT 0x9585 +#define GL_NUM_DEVICE_UUIDS_EXT 0x9596 +#define GL_DEVICE_UUID_EXT 0x9597 +#define GL_DRIVER_UUID_EXT 0x9598 +#define GL_UUID_SIZE_EXT 16 +typedef void (APIENTRYP PFNGLGETUNSIGNEDBYTEVEXTPROC) (GLenum pname, GLubyte *data); +typedef void (APIENTRYP PFNGLGETUNSIGNEDBYTEI_VEXTPROC) (GLenum target, GLuint index, GLubyte *data); +typedef void (APIENTRYP PFNGLDELETEMEMORYOBJECTSEXTPROC) (GLsizei n, const GLuint *memoryObjects); +typedef GLboolean (APIENTRYP PFNGLISMEMORYOBJECTEXTPROC) (GLuint memoryObject); +typedef void (APIENTRYP PFNGLCREATEMEMORYOBJECTSEXTPROC) (GLsizei n, GLuint *memoryObjects); +typedef void (APIENTRYP PFNGLMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLGETMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM2DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM3DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLBUFFERSTORAGEMEMEXTPROC) (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM2DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM2DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM3DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM3DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEMEMEXTPROC) (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM1DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM1DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetUnsignedBytevEXT (GLenum pname, GLubyte *data); +GLAPI void APIENTRY glGetUnsignedBytei_vEXT (GLenum target, GLuint index, GLubyte *data); +GLAPI void APIENTRY glDeleteMemoryObjectsEXT (GLsizei n, const GLuint *memoryObjects); +GLAPI GLboolean APIENTRY glIsMemoryObjectEXT (GLuint memoryObject); +GLAPI void APIENTRY glCreateMemoryObjectsEXT (GLsizei n, GLuint *memoryObjects); +GLAPI void APIENTRY glMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, const GLint *params); +GLAPI void APIENTRY glGetMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, GLint *params); +GLAPI void APIENTRY glTexStorageMem2DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem2DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem3DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem3DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glBufferStorageMemEXT (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem2DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem2DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem3DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem3DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glNamedBufferStorageMemEXT (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem1DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem1DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_EXT_memory_object */ + +#ifndef GL_EXT_memory_object_fd +#define GL_EXT_memory_object_fd 1 +#define GL_HANDLE_TYPE_OPAQUE_FD_EXT 0x9586 +typedef void (APIENTRYP PFNGLIMPORTMEMORYFDEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportMemoryFdEXT (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_memory_object_fd */ + +#ifndef GL_EXT_memory_object_win32 +#define GL_EXT_memory_object_win32 1 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_EXT 0x9587 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_KMT_EXT 0x9588 +#define GL_DEVICE_LUID_EXT 0x9599 +#define GL_DEVICE_NODE_MASK_EXT 0x959A +#define GL_LUID_SIZE_EXT 8 +#define GL_HANDLE_TYPE_D3D12_TILEPOOL_EXT 0x9589 +#define GL_HANDLE_TYPE_D3D12_RESOURCE_EXT 0x958A +#define GL_HANDLE_TYPE_D3D11_IMAGE_EXT 0x958B +#define GL_HANDLE_TYPE_D3D11_IMAGE_KMT_EXT 0x958C +typedef void (APIENTRYP PFNGLIMPORTMEMORYWIN32HANDLEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +typedef void (APIENTRYP PFNGLIMPORTMEMORYWIN32NAMEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportMemoryWin32HandleEXT (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +GLAPI void APIENTRY glImportMemoryWin32NameEXT (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_memory_object_win32 */ + #ifndef GL_EXT_misc_attribute #define GL_EXT_misc_attribute 1 #endif /* GL_EXT_misc_attribute */ @@ -7818,6 +8037,55 @@ GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint size, GLenum type, GLsizei #endif #endif /* GL_EXT_secondary_color */ +#ifndef GL_EXT_semaphore +#define GL_EXT_semaphore 1 +#define GL_LAYOUT_GENERAL_EXT 0x958D +#define GL_LAYOUT_COLOR_ATTACHMENT_EXT 0x958E +#define GL_LAYOUT_DEPTH_STENCIL_ATTACHMENT_EXT 0x958F +#define GL_LAYOUT_DEPTH_STENCIL_READ_ONLY_EXT 0x9590 +#define GL_LAYOUT_SHADER_READ_ONLY_EXT 0x9591 +#define GL_LAYOUT_TRANSFER_SRC_EXT 0x9592 +#define GL_LAYOUT_TRANSFER_DST_EXT 0x9593 +#define GL_LAYOUT_DEPTH_READ_ONLY_STENCIL_ATTACHMENT_EXT 0x9530 +#define GL_LAYOUT_DEPTH_ATTACHMENT_STENCIL_READ_ONLY_EXT 0x9531 +typedef void (APIENTRYP PFNGLGENSEMAPHORESEXTPROC) (GLsizei n, GLuint *semaphores); +typedef void (APIENTRYP PFNGLDELETESEMAPHORESEXTPROC) (GLsizei n, const GLuint *semaphores); +typedef GLboolean (APIENTRYP PFNGLISSEMAPHOREEXTPROC) (GLuint semaphore); +typedef void (APIENTRYP PFNGLSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, const GLuint64 *params); +typedef void (APIENTRYP PFNGLGETSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, GLuint64 *params); +typedef void (APIENTRYP PFNGLWAITSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +typedef void (APIENTRYP PFNGLSIGNALSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenSemaphoresEXT (GLsizei n, GLuint *semaphores); +GLAPI void APIENTRY glDeleteSemaphoresEXT (GLsizei n, const GLuint *semaphores); +GLAPI GLboolean APIENTRY glIsSemaphoreEXT (GLuint semaphore); +GLAPI void APIENTRY glSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, const GLuint64 *params); +GLAPI void APIENTRY glGetSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, GLuint64 *params); +GLAPI void APIENTRY glWaitSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +GLAPI void APIENTRY glSignalSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#endif +#endif /* GL_EXT_semaphore */ + +#ifndef GL_EXT_semaphore_fd +#define GL_EXT_semaphore_fd 1 +typedef void (APIENTRYP PFNGLIMPORTSEMAPHOREFDEXTPROC) (GLuint semaphore, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportSemaphoreFdEXT (GLuint semaphore, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_semaphore_fd */ + +#ifndef GL_EXT_semaphore_win32 +#define GL_EXT_semaphore_win32 1 +#define GL_HANDLE_TYPE_D3D12_FENCE_EXT 0x9594 +#define GL_D3D12_FENCE_VALUE_EXT 0x9595 +typedef void (APIENTRYP PFNGLIMPORTSEMAPHOREWIN32HANDLEEXTPROC) (GLuint semaphore, GLenum handleType, void *handle); +typedef void (APIENTRYP PFNGLIMPORTSEMAPHOREWIN32NAMEEXTPROC) (GLuint semaphore, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportSemaphoreWin32HandleEXT (GLuint semaphore, GLenum handleType, void *handle); +GLAPI void APIENTRY glImportSemaphoreWin32NameEXT (GLuint semaphore, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_semaphore_win32 */ + #ifndef GL_EXT_separate_shader_objects #define GL_EXT_separate_shader_objects 1 #define GL_ACTIVE_PROGRAM_EXT 0x8B8D @@ -7838,6 +8106,19 @@ GLAPI GLuint APIENTRY glCreateShaderProgramEXT (GLenum type, const GLchar *strin #define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA #endif /* GL_EXT_separate_specular_color */ +#ifndef GL_EXT_shader_framebuffer_fetch +#define GL_EXT_shader_framebuffer_fetch 1 +#define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52 +#endif /* GL_EXT_shader_framebuffer_fetch */ + +#ifndef GL_EXT_shader_framebuffer_fetch_non_coherent +#define GL_EXT_shader_framebuffer_fetch_non_coherent 1 +typedef void (APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIEREXTPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferFetchBarrierEXT (void); +#endif +#endif /* GL_EXT_shader_framebuffer_fetch_non_coherent */ + #ifndef GL_EXT_shader_image_load_formatted #define GL_EXT_shader_image_load_formatted 1 #endif /* GL_EXT_shader_image_load_formatted */ @@ -8138,6 +8419,8 @@ GLAPI void APIENTRY glTexBufferEXT (GLenum target, GLenum internalformat, GLuint #ifndef GL_EXT_texture_filter_minmax #define GL_EXT_texture_filter_minmax 1 +#define GL_TEXTURE_REDUCTION_MODE_EXT 0x9366 +#define GL_WEIGHTED_AVERAGE_EXT 0x9367 #endif /* GL_EXT_texture_filter_minmax */ #ifndef GL_EXT_texture_integer @@ -8272,6 +8555,11 @@ GLAPI void APIENTRY glTextureNormalEXT (GLenum mode); #define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F #endif /* GL_EXT_texture_sRGB */ +#ifndef GL_EXT_texture_sRGB_R8 +#define GL_EXT_texture_sRGB_R8 1 +#define GL_SR8_EXT 0x8FBD +#endif /* GL_EXT_texture_sRGB_R8 */ + #ifndef GL_EXT_texture_sRGB_decode #define GL_EXT_texture_sRGB_decode 1 #define GL_TEXTURE_SRGB_DECODE_EXT 0x8A48 @@ -8684,6 +8972,16 @@ GLAPI void APIENTRY glVertexWeightPointerEXT (GLint size, GLenum type, GLsizei s #endif #endif /* GL_EXT_vertex_weighting */ +#ifndef GL_EXT_win32_keyed_mutex +#define GL_EXT_win32_keyed_mutex 1 +typedef GLboolean (APIENTRYP PFNGLACQUIREKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key, GLuint timeout); +typedef GLboolean (APIENTRYP PFNGLRELEASEKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glAcquireKeyedMutexWin32EXT (GLuint memory, GLuint64 key, GLuint timeout); +GLAPI GLboolean APIENTRY glReleaseKeyedMutexWin32EXT (GLuint memory, GLuint64 key); +#endif +#endif /* GL_EXT_win32_keyed_mutex */ + #ifndef GL_EXT_window_rectangles #define GL_EXT_window_rectangles 1 #define GL_INCLUSIVE_EXT 0x8F10 @@ -8875,6 +9173,11 @@ GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum sfactorRGB, GLenum dfactorRG #define GL_INTERLACE_READ_INGR 0x8568 #endif /* GL_INGR_interlace_read */ +#ifndef GL_INTEL_blackhole_render +#define GL_INTEL_blackhole_render 1 +#define GL_BLACKHOLE_RENDER_INTEL 0x83FC +#endif /* GL_INTEL_blackhole_render */ + #ifndef GL_INTEL_conservative_rasterization #define GL_INTEL_conservative_rasterization 1 #define GL_CONSERVATIVE_RASTERIZATION_INTEL 0x83FE @@ -8956,7 +9259,7 @@ typedef void (APIENTRYP PFNGLENDPERFQUERYINTELPROC) (GLuint queryHandle); typedef void (APIENTRYP PFNGLGETFIRSTPERFQUERYIDINTELPROC) (GLuint *queryId); typedef void (APIENTRYP PFNGLGETNEXTPERFQUERYIDINTELPROC) (GLuint queryId, GLuint *nextQueryId); typedef void (APIENTRYP PFNGLGETPERFCOUNTERINFOINTELPROC) (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); -typedef void (APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, GLvoid *data, GLuint *bytesWritten); +typedef void (APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); typedef void (APIENTRYP PFNGLGETPERFQUERYIDBYNAMEINTELPROC) (GLchar *queryName, GLuint *queryId); typedef void (APIENTRYP PFNGLGETPERFQUERYINFOINTELPROC) (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); #ifdef GL_GLEXT_PROTOTYPES @@ -8967,7 +9270,7 @@ GLAPI void APIENTRY glEndPerfQueryINTEL (GLuint queryHandle); GLAPI void APIENTRY glGetFirstPerfQueryIdINTEL (GLuint *queryId); GLAPI void APIENTRY glGetNextPerfQueryIdINTEL (GLuint queryId, GLuint *nextQueryId); GLAPI void APIENTRY glGetPerfCounterInfoINTEL (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); -GLAPI void APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, GLvoid *data, GLuint *bytesWritten); +GLAPI void APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); GLAPI void APIENTRY glGetPerfQueryIdByNameINTEL (GLchar *queryName, GLuint *queryId); GLAPI void APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); #endif @@ -8988,6 +9291,11 @@ GLAPI void APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLen #define GL_PACK_INVERT_MESA 0x8758 #endif /* GL_MESA_pack_invert */ +#ifndef GL_MESA_program_binary_formats +#define GL_MESA_program_binary_formats 1 +#define GL_PROGRAM_BINARY_FORMAT_MESA 0x875F +#endif /* GL_MESA_program_binary_formats */ + #ifndef GL_MESA_resize_buffers #define GL_MESA_resize_buffers 1 typedef void (APIENTRYP PFNGLRESIZEBUFFERSMESAPROC) (void); @@ -9000,6 +9308,13 @@ GLAPI void APIENTRY glResizeBuffersMESA (void); #define GL_MESA_shader_integer_functions 1 #endif /* GL_MESA_shader_integer_functions */ +#ifndef GL_MESA_tile_raster_order +#define GL_MESA_tile_raster_order 1 +#define GL_TILE_RASTER_ORDER_FIXED_MESA 0x8BB8 +#define GL_TILE_RASTER_ORDER_INCREASING_X_MESA 0x8BB9 +#define GL_TILE_RASTER_ORDER_INCREASING_Y_MESA 0x8BBA +#endif /* GL_MESA_tile_raster_order */ + #ifndef GL_MESA_window_pos #define GL_MESA_window_pos 1 typedef void (APIENTRYP PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y); @@ -9226,6 +9541,10 @@ GLAPI void APIENTRY glBlendBarrierNV (void); #define GL_BLEND_ADVANCED_COHERENT_NV 0x9285 #endif /* GL_NV_blend_equation_advanced_coherent */ +#ifndef GL_NV_blend_minmax_factor +#define GL_NV_blend_minmax_factor 1 +#endif /* GL_NV_blend_minmax_factor */ + #ifndef GL_NV_blend_square #define GL_NV_blend_square 1 #endif /* GL_NV_blend_square */ @@ -9306,6 +9625,10 @@ GLAPI void APIENTRY glCallCommandListNV (GLuint list); #define GL_COMPUTE_PROGRAM_PARAMETER_BUFFER_NV 0x90FC #endif /* GL_NV_compute_program5 */ +#ifndef GL_NV_compute_shader_derivatives +#define GL_NV_compute_shader_derivatives 1 +#endif /* GL_NV_compute_shader_derivatives */ + #ifndef GL_NV_conditional_render #define GL_NV_conditional_render 1 #define GL_QUERY_WAIT_NV 0x8E13 @@ -9343,6 +9666,11 @@ GLAPI void APIENTRY glConservativeRasterParameterfNV (GLenum pname, GLfloat valu #endif #endif /* GL_NV_conservative_raster_dilate */ +#ifndef GL_NV_conservative_raster_pre_snap +#define GL_NV_conservative_raster_pre_snap 1 +#define GL_CONSERVATIVE_RASTER_MODE_PRE_SNAP_NV 0x9550 +#endif /* GL_NV_conservative_raster_pre_snap */ + #ifndef GL_NV_conservative_raster_pre_snap_triangles #define GL_NV_conservative_raster_pre_snap_triangles 1 #define GL_CONSERVATIVE_RASTER_MODE_NV 0x954D @@ -9354,6 +9682,10 @@ GLAPI void APIENTRY glConservativeRasterParameteriNV (GLenum pname, GLint param) #endif #endif /* GL_NV_conservative_raster_pre_snap_triangles */ +#ifndef GL_NV_conservative_raster_underestimation +#define GL_NV_conservative_raster_underestimation 1 +#endif /* GL_NV_conservative_raster_underestimation */ + #ifndef GL_NV_copy_depth_to_color #define GL_NV_copy_depth_to_color 1 #define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E @@ -9595,6 +9927,10 @@ GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint id, GLsizei len, cons #define GL_NV_fragment_program_option 1 #endif /* GL_NV_fragment_program_option */ +#ifndef GL_NV_fragment_shader_barycentric +#define GL_NV_fragment_shader_barycentric 1 +#endif /* GL_NV_fragment_shader_barycentric */ + #ifndef GL_NV_fragment_shader_interlock #define GL_NV_fragment_shader_interlock 1 #endif /* GL_NV_fragment_shader_interlock */ @@ -9662,7 +9998,7 @@ GLAPI void APIENTRY glFramebufferTextureFaceEXT (GLenum target, GLenum attachmen #define GL_PER_GPU_STORAGE_NV 0x9548 #define GL_MULTICAST_PROGRAMMABLE_SAMPLE_LOCATION_NV 0x9549 typedef void (APIENTRYP PFNGLRENDERGPUMASKNVPROC) (GLbitfield mask); -typedef void (APIENTRYP PFNGLMULTICASTBUFFERSUBDATANVPROC) (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const GLvoid *data); +typedef void (APIENTRYP PFNGLMULTICASTBUFFERSUBDATANVPROC) (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); typedef void (APIENTRYP PFNGLMULTICASTCOPYBUFFERSUBDATANVPROC) (GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); typedef void (APIENTRYP PFNGLMULTICASTCOPYIMAGESUBDATANVPROC) (GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); typedef void (APIENTRYP PFNGLMULTICASTBLITFRAMEBUFFERNVPROC) (GLuint srcGpu, GLuint dstGpu, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); @@ -9675,7 +10011,7 @@ typedef void (APIENTRYP PFNGLMULTICASTGETQUERYOBJECTI64VNVPROC) (GLuint gpu, GLu typedef void (APIENTRYP PFNGLMULTICASTGETQUERYOBJECTUI64VNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLuint64 *params); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glRenderGpuMaskNV (GLbitfield mask); -GLAPI void APIENTRY glMulticastBufferSubDataNV (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const GLvoid *data); +GLAPI void APIENTRY glMulticastBufferSubDataNV (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); GLAPI void APIENTRY glMulticastCopyBufferSubDataNV (GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); GLAPI void APIENTRY glMulticastCopyImageSubDataNV (GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); GLAPI void APIENTRY glMulticastBlitFramebufferNV (GLuint srcGpu, GLuint dstGpu, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); @@ -9879,6 +10215,96 @@ GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum interna #define GL_MAX_SPOT_EXPONENT_NV 0x8505 #endif /* GL_NV_light_max_exponent */ +#ifndef GL_NV_memory_attachment +#define GL_NV_memory_attachment 1 +#define GL_ATTACHED_MEMORY_OBJECT_NV 0x95A4 +#define GL_ATTACHED_MEMORY_OFFSET_NV 0x95A5 +#define GL_MEMORY_ATTACHABLE_ALIGNMENT_NV 0x95A6 +#define GL_MEMORY_ATTACHABLE_SIZE_NV 0x95A7 +#define GL_MEMORY_ATTACHABLE_NV 0x95A8 +#define GL_DETACHED_MEMORY_INCARNATION_NV 0x95A9 +#define GL_DETACHED_TEXTURES_NV 0x95AA +#define GL_DETACHED_BUFFERS_NV 0x95AB +#define GL_MAX_DETACHED_TEXTURES_NV 0x95AC +#define GL_MAX_DETACHED_BUFFERS_NV 0x95AD +typedef void (APIENTRYP PFNGLGETMEMORYOBJECTDETACHEDRESOURCESUIVNVPROC) (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +typedef void (APIENTRYP PFNGLRESETMEMORYOBJECTPARAMETERNVPROC) (GLuint memory, GLenum pname); +typedef void (APIENTRYP PFNGLTEXATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLBUFFERATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTUREATTACHMEMORYNVPROC) (GLuint texture, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLNAMEDBUFFERATTACHMEMORYNVPROC) (GLuint buffer, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetMemoryObjectDetachedResourcesuivNV (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +GLAPI void APIENTRY glResetMemoryObjectParameterNV (GLuint memory, GLenum pname); +GLAPI void APIENTRY glTexAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glBufferAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureAttachMemoryNV (GLuint texture, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glNamedBufferAttachMemoryNV (GLuint buffer, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_NV_memory_attachment */ + +#ifndef GL_NV_mesh_shader +#define GL_NV_mesh_shader 1 +#define GL_MESH_SHADER_NV 0x9559 +#define GL_TASK_SHADER_NV 0x955A +#define GL_MAX_MESH_UNIFORM_BLOCKS_NV 0x8E60 +#define GL_MAX_MESH_TEXTURE_IMAGE_UNITS_NV 0x8E61 +#define GL_MAX_MESH_IMAGE_UNIFORMS_NV 0x8E62 +#define GL_MAX_MESH_UNIFORM_COMPONENTS_NV 0x8E63 +#define GL_MAX_MESH_ATOMIC_COUNTER_BUFFERS_NV 0x8E64 +#define GL_MAX_MESH_ATOMIC_COUNTERS_NV 0x8E65 +#define GL_MAX_MESH_SHADER_STORAGE_BLOCKS_NV 0x8E66 +#define GL_MAX_COMBINED_MESH_UNIFORM_COMPONENTS_NV 0x8E67 +#define GL_MAX_TASK_UNIFORM_BLOCKS_NV 0x8E68 +#define GL_MAX_TASK_TEXTURE_IMAGE_UNITS_NV 0x8E69 +#define GL_MAX_TASK_IMAGE_UNIFORMS_NV 0x8E6A +#define GL_MAX_TASK_UNIFORM_COMPONENTS_NV 0x8E6B +#define GL_MAX_TASK_ATOMIC_COUNTER_BUFFERS_NV 0x8E6C +#define GL_MAX_TASK_ATOMIC_COUNTERS_NV 0x8E6D +#define GL_MAX_TASK_SHADER_STORAGE_BLOCKS_NV 0x8E6E +#define GL_MAX_COMBINED_TASK_UNIFORM_COMPONENTS_NV 0x8E6F +#define GL_MAX_MESH_WORK_GROUP_INVOCATIONS_NV 0x95A2 +#define GL_MAX_TASK_WORK_GROUP_INVOCATIONS_NV 0x95A3 +#define GL_MAX_MESH_TOTAL_MEMORY_SIZE_NV 0x9536 +#define GL_MAX_TASK_TOTAL_MEMORY_SIZE_NV 0x9537 +#define GL_MAX_MESH_OUTPUT_VERTICES_NV 0x9538 +#define GL_MAX_MESH_OUTPUT_PRIMITIVES_NV 0x9539 +#define GL_MAX_TASK_OUTPUT_COUNT_NV 0x953A +#define GL_MAX_DRAW_MESH_TASKS_COUNT_NV 0x953D +#define GL_MAX_MESH_VIEWS_NV 0x9557 +#define GL_MESH_OUTPUT_PER_VERTEX_GRANULARITY_NV 0x92DF +#define GL_MESH_OUTPUT_PER_PRIMITIVE_GRANULARITY_NV 0x9543 +#define GL_MAX_MESH_WORK_GROUP_SIZE_NV 0x953B +#define GL_MAX_TASK_WORK_GROUP_SIZE_NV 0x953C +#define GL_MESH_WORK_GROUP_SIZE_NV 0x953E +#define GL_TASK_WORK_GROUP_SIZE_NV 0x953F +#define GL_MESH_VERTICES_OUT_NV 0x9579 +#define GL_MESH_PRIMITIVES_OUT_NV 0x957A +#define GL_MESH_OUTPUT_TYPE_NV 0x957B +#define GL_UNIFORM_BLOCK_REFERENCED_BY_MESH_SHADER_NV 0x959C +#define GL_UNIFORM_BLOCK_REFERENCED_BY_TASK_SHADER_NV 0x959D +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_MESH_SHADER_NV 0x959E +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_TASK_SHADER_NV 0x959F +#define GL_REFERENCED_BY_MESH_SHADER_NV 0x95A0 +#define GL_REFERENCED_BY_TASK_SHADER_NV 0x95A1 +#define GL_MESH_SUBROUTINE_NV 0x957C +#define GL_TASK_SUBROUTINE_NV 0x957D +#define GL_MESH_SUBROUTINE_UNIFORM_NV 0x957E +#define GL_TASK_SUBROUTINE_UNIFORM_NV 0x957F +#define GL_MESH_SHADER_BIT_NV 0x00000040 +#define GL_TASK_SHADER_BIT_NV 0x00000080 +typedef void (APIENTRYP PFNGLDRAWMESHTASKSNVPROC) (GLuint first, GLuint count); +typedef void (APIENTRYP PFNGLDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect); +typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect, GLsizei drawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTCOUNTNVPROC) (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawMeshTasksNV (GLuint first, GLuint count); +GLAPI void APIENTRY glDrawMeshTasksIndirectNV (GLintptr indirect); +GLAPI void APIENTRY glMultiDrawMeshTasksIndirectNV (GLintptr indirect, GLsizei drawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawMeshTasksIndirectCountNV (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#endif +#endif /* GL_NV_mesh_shader */ + #ifndef GL_NV_multisample_coverage #define GL_NV_multisample_coverage 1 #endif /* GL_NV_multisample_coverage */ @@ -10306,6 +10732,32 @@ GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint index); #endif #endif /* GL_NV_primitive_restart */ +#ifndef GL_NV_query_resource +#define GL_NV_query_resource 1 +#define GL_QUERY_RESOURCE_TYPE_VIDMEM_ALLOC_NV 0x9540 +#define GL_QUERY_RESOURCE_MEMTYPE_VIDMEM_NV 0x9542 +#define GL_QUERY_RESOURCE_SYS_RESERVED_NV 0x9544 +#define GL_QUERY_RESOURCE_TEXTURE_NV 0x9545 +#define GL_QUERY_RESOURCE_RENDERBUFFER_NV 0x9546 +#define GL_QUERY_RESOURCE_BUFFEROBJECT_NV 0x9547 +typedef GLint (APIENTRYP PFNGLQUERYRESOURCENVPROC) (GLenum queryType, GLint tagId, GLuint bufSize, GLint *buffer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLint APIENTRY glQueryResourceNV (GLenum queryType, GLint tagId, GLuint bufSize, GLint *buffer); +#endif +#endif /* GL_NV_query_resource */ + +#ifndef GL_NV_query_resource_tag +#define GL_NV_query_resource_tag 1 +typedef void (APIENTRYP PFNGLGENQUERYRESOURCETAGNVPROC) (GLsizei n, GLint *tagIds); +typedef void (APIENTRYP PFNGLDELETEQUERYRESOURCETAGNVPROC) (GLsizei n, const GLint *tagIds); +typedef void (APIENTRYP PFNGLQUERYRESOURCETAGNVPROC) (GLint tagId, const GLchar *tagString); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenQueryResourceTagNV (GLsizei n, GLint *tagIds); +GLAPI void APIENTRY glDeleteQueryResourceTagNV (GLsizei n, const GLint *tagIds); +GLAPI void APIENTRY glQueryResourceTagNV (GLint tagId, const GLchar *tagString); +#endif +#endif /* GL_NV_query_resource_tag */ + #ifndef GL_NV_register_combiners #define GL_NV_register_combiners 1 #define GL_REGISTER_COMBINERS_NV 0x8522 @@ -10398,6 +10850,11 @@ GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum stage, GLenum pname, #endif #endif /* GL_NV_register_combiners2 */ +#ifndef GL_NV_representative_fragment_test +#define GL_NV_representative_fragment_test 1 +#define GL_REPRESENTATIVE_FRAGMENT_TEST_NV 0x937F +#endif /* GL_NV_representative_fragment_test */ + #ifndef GL_NV_robustness_video_memory_purge #define GL_NV_robustness_video_memory_purge 1 #define GL_PURGED_CONTEXT_RESET_NV 0x92BB @@ -10427,6 +10884,18 @@ GLAPI void APIENTRY glResolveDepthValuesNV (void); #define GL_NV_sample_mask_override_coverage 1 #endif /* GL_NV_sample_mask_override_coverage */ +#ifndef GL_NV_scissor_exclusive +#define GL_NV_scissor_exclusive 1 +#define GL_SCISSOR_TEST_EXCLUSIVE_NV 0x9555 +#define GL_SCISSOR_BOX_EXCLUSIVE_NV 0x9556 +typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVENVPROC) (GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVEARRAYVNVPROC) (GLuint first, GLsizei count, const GLint *v); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glScissorExclusiveNV (GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glScissorExclusiveArrayvNV (GLuint first, GLsizei count, const GLint *v); +#endif +#endif /* GL_NV_scissor_exclusive */ + #ifndef GL_NV_shader_atomic_counters #define GL_NV_shader_atomic_counters 1 #endif /* GL_NV_shader_atomic_counters */ @@ -10491,6 +10960,10 @@ GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLs #define GL_NV_shader_storage_buffer_object 1 #endif /* GL_NV_shader_storage_buffer_object */ +#ifndef GL_NV_shader_texture_footprint +#define GL_NV_shader_texture_footprint 1 +#endif /* GL_NV_shader_texture_footprint */ + #ifndef GL_NV_shader_thread_group #define GL_NV_shader_thread_group 1 #define GL_WARP_SIZE_NV 0x9339 @@ -10502,6 +10975,47 @@ GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLs #define GL_NV_shader_thread_shuffle 1 #endif /* GL_NV_shader_thread_shuffle */ +#ifndef GL_NV_shading_rate_image +#define GL_NV_shading_rate_image 1 +#define GL_SHADING_RATE_IMAGE_NV 0x9563 +#define GL_SHADING_RATE_NO_INVOCATIONS_NV 0x9564 +#define GL_SHADING_RATE_1_INVOCATION_PER_PIXEL_NV 0x9565 +#define GL_SHADING_RATE_1_INVOCATION_PER_1X2_PIXELS_NV 0x9566 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X1_PIXELS_NV 0x9567 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X2_PIXELS_NV 0x9568 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X4_PIXELS_NV 0x9569 +#define GL_SHADING_RATE_1_INVOCATION_PER_4X2_PIXELS_NV 0x956A +#define GL_SHADING_RATE_1_INVOCATION_PER_4X4_PIXELS_NV 0x956B +#define GL_SHADING_RATE_2_INVOCATIONS_PER_PIXEL_NV 0x956C +#define GL_SHADING_RATE_4_INVOCATIONS_PER_PIXEL_NV 0x956D +#define GL_SHADING_RATE_8_INVOCATIONS_PER_PIXEL_NV 0x956E +#define GL_SHADING_RATE_16_INVOCATIONS_PER_PIXEL_NV 0x956F +#define GL_SHADING_RATE_IMAGE_BINDING_NV 0x955B +#define GL_SHADING_RATE_IMAGE_TEXEL_WIDTH_NV 0x955C +#define GL_SHADING_RATE_IMAGE_TEXEL_HEIGHT_NV 0x955D +#define GL_SHADING_RATE_IMAGE_PALETTE_SIZE_NV 0x955E +#define GL_MAX_COARSE_FRAGMENT_SAMPLES_NV 0x955F +#define GL_SHADING_RATE_SAMPLE_ORDER_DEFAULT_NV 0x95AE +#define GL_SHADING_RATE_SAMPLE_ORDER_PIXEL_MAJOR_NV 0x95AF +#define GL_SHADING_RATE_SAMPLE_ORDER_SAMPLE_MAJOR_NV 0x95B0 +typedef void (APIENTRYP PFNGLBINDSHADINGRATEIMAGENVPROC) (GLuint texture); +typedef void (APIENTRYP PFNGLGETSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint entry, GLenum *rate); +typedef void (APIENTRYP PFNGLGETSHADINGRATESAMPLELOCATIONIVNVPROC) (GLenum rate, GLuint samples, GLuint index, GLint *location); +typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEBARRIERNVPROC) (GLboolean synchronize); +typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates); +typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERNVPROC) (GLenum order); +typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERCUSTOMNVPROC) (GLenum rate, GLuint samples, const GLint *locations); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindShadingRateImageNV (GLuint texture); +GLAPI void APIENTRY glGetShadingRateImagePaletteNV (GLuint viewport, GLuint entry, GLenum *rate); +GLAPI void APIENTRY glGetShadingRateSampleLocationivNV (GLenum rate, GLuint samples, GLuint index, GLint *location); +GLAPI void APIENTRY glShadingRateImageBarrierNV (GLboolean synchronize); +GLAPI void APIENTRY glShadingRateImagePaletteNV (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates); +GLAPI void APIENTRY glShadingRateSampleOrderNV (GLenum order); +GLAPI void APIENTRY glShadingRateSampleOrderCustomNV (GLenum rate, GLuint samples, const GLint *locations); +#endif +#endif /* GL_NV_shading_rate_image */ + #ifndef GL_NV_stereo_view_rendering #define GL_NV_stereo_view_rendering 1 #endif /* GL_NV_stereo_view_rendering */ @@ -10582,6 +11096,10 @@ GLAPI void APIENTRY glTextureImage3DMultisampleCoverageNV (GLuint texture, GLenu #define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV 0x84F8 #endif /* GL_NV_texture_rectangle */ +#ifndef GL_NV_texture_rectangle_compressed +#define GL_NV_texture_rectangle_compressed 1 +#endif /* GL_NV_texture_rectangle_compressed */ + #ifndef GL_NV_texture_shader #define GL_NV_texture_shader 1 #define GL_OFFSET_TEXTURE_RECTANGLE_NV 0x864C @@ -10808,6 +11326,14 @@ GLAPI void APIENTRY glVDPAUUnmapSurfacesNV (GLsizei numSurface, const GLvdpauSur #endif #endif /* GL_NV_vdpau_interop */ +#ifndef GL_NV_vdpau_interop2 +#define GL_NV_vdpau_interop2 1 +typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACEWITHPICTURESTRUCTURENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames, GLboolean isFrameStructure); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceWithPictureStructureNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames, GLboolean isFrameStructure); +#endif +#endif /* GL_NV_vdpau_interop2 */ + #ifndef GL_NV_vertex_array_range #define GL_NV_vertex_array_range 1 #define GL_VERTEX_ARRAY_RANGE_NV 0x851D diff --git a/src/gui/opengl/qopenglextensions_p.h b/src/gui/opengl/qopenglextensions_p.h index af8ee8201d..137f1e831f 100644 --- a/src/gui/opengl/qopenglextensions_p.h +++ b/src/gui/opengl/qopenglextensions_p.h @@ -107,7 +107,7 @@ public: QOpenGLExtensionsPrivate *d() const; private: - static bool isInitialized(const QOpenGLFunctionsPrivate *d) { return d != 0; } + static bool isInitialized(const QOpenGLFunctionsPrivate *d) { return d != nullptr; } }; Q_DECLARE_OPERATORS_FOR_FLAGS(QOpenGLExtensions::OpenGLExtensions) diff --git a/src/gui/opengl/qopenglframebufferobject.cpp b/src/gui/opengl/qopenglframebufferobject.cpp index cae3d516c4..e7631b09ce 100644 --- a/src/gui/opengl/qopenglframebufferobject.cpp +++ b/src/gui/opengl/qopenglframebufferobject.cpp @@ -249,7 +249,7 @@ QOpenGLFramebufferObjectFormat::~QOpenGLFramebufferObjectFormat() If the desired amount of samples per pixel is not supported by the hardware then the maximum number of samples per pixel will be used. Note that - multisample framebuffer objects can not be bound as textures. Also, the + multisample framebuffer objects cannot be bound as textures. Also, the \c{GL_EXT_framebuffer_multisample} extension is required to create a framebuffer with more than one sample per pixel. diff --git a/src/gui/opengl/qopenglframebufferobject_p.h b/src/gui/opengl/qopenglframebufferobject_p.h index 778a38b823..644bb6c59b 100644 --- a/src/gui/opengl/qopenglframebufferobject_p.h +++ b/src/gui/opengl/qopenglframebufferobject_p.h @@ -109,8 +109,8 @@ public: class QOpenGLFramebufferObjectPrivate { public: - QOpenGLFramebufferObjectPrivate() : fbo_guard(0), depth_buffer_guard(0) - , stencil_buffer_guard(0) + QOpenGLFramebufferObjectPrivate() : fbo_guard(nullptr), depth_buffer_guard(nullptr) + , stencil_buffer_guard(nullptr) , valid(false) {} ~QOpenGLFramebufferObjectPrivate() {} @@ -135,9 +135,9 @@ public: QOpenGLExtensions funcs; struct ColorAttachment { - ColorAttachment() : internalFormat(0), guard(0) { } + ColorAttachment() : internalFormat(0), guard(nullptr) { } ColorAttachment(const QSize &size, GLenum internalFormat) - : size(size), internalFormat(internalFormat), guard(0) { } + : size(size), internalFormat(internalFormat), guard(nullptr) { } QSize size; GLenum internalFormat; QOpenGLSharedResourceGuard *guard; diff --git a/src/gui/opengl/qopenglfunctions.cpp b/src/gui/opengl/qopenglfunctions.cpp index 700fb77ad7..8ec814296a 100644 --- a/src/gui/opengl/qopenglfunctions.cpp +++ b/src/gui/opengl/qopenglfunctions.cpp @@ -90,65 +90,18 @@ void CLASS::init(QOpenGLContext *context) \ that need it. The recommended way to use QOpenGLFunctions is by direct inheritance: - \code - class MyGLWindow : public QWindow, protected QOpenGLFunctions - { - \Q_OBJECT - public: - MyGLWindow(QScreen *screen = 0); - - protected: - void initializeGL(); - void paintGL(); - - QOpenGLContext *m_context; - }; - - MyGLWindow(QScreen *screen) - : QWindow(screen), QOpenGLWidget(parent) - { - setSurfaceType(OpenGLSurface); - create(); - - // Create an OpenGL context - m_context = new QOpenGLContext; - m_context->create(); - - // Setup scene and render it - initializeGL(); - paintGL(); - } - - void MyGLWindow::initializeGL() - { - m_context->makeCurrent(this); - initializeOpenGLFunctions(); - } - \endcode + \snippet code/src_gui_opengl_qopenglfunctions.cpp 0 The \c{paintGL()} function can then use any of the OpenGL ES 2.0 functions without explicit resolution, such as glActiveTexture() in the following example: - \code - void MyGLWindow::paintGL() - { - m_context->makeCurrent(this); - glActiveTexture(GL_TEXTURE1); - glBindTexture(GL_TEXTURE_2D, textureId); - ... - m_context->swapBuffers(this); - m_context->doneCurrent(); - } - \endcode + \snippet code/src_gui_opengl_qopenglfunctions.cpp 1 QOpenGLFunctions can also be used directly for ad-hoc invocation of OpenGL ES 2.0 functions on all platforms: - \code - QOpenGLFunctions glFuncs(QOpenGLContext::currentContext()); - glFuncs.glActiveTexture(GL_TEXTURE1); - \endcode + \snippet code/src_gui_opengl_qopenglfunctions.cpp 2 An alternative approach is to query the context's associated QOpenGLFunctions instance. This is somewhat faster than the previous @@ -157,10 +110,7 @@ void CLASS::init(QOpenGLContext *context) \ resolving happens only once for a given context, regardless of the number of QOpenGLFunctions instances initialized for it. - \code - QOpenGLFunctions *glFuncs = QOpenGLContext::currentContext()->functions(); - glFuncs->glActiveTexture(GL_TEXTURE1); - \endcode + \snippet code/src_gui_opengl_qopenglfunctions.cpp 3 QOpenGLFunctions provides wrappers for all OpenGL ES 2.0 functions, including the common subset of OpenGL 1.x and ES @@ -175,10 +125,7 @@ void CLASS::init(QOpenGLContext *context) \ feature. For example, the following checks if non power of two textures are available: - \code - QOpenGLFunctions funcs(QOpenGLContext::currentContext()); - bool npot = funcs.hasOpenGLFeature(QOpenGLFunctions::NPOTTextures); - \endcode + \snippet code/src_gui_opengl_qopenglfunctions.cpp 4 \sa QOpenGLContext, QSurfaceFormat */ @@ -195,6 +142,7 @@ void CLASS::init(QOpenGLContext *context) \ \value BlendColor glBlendColor() is available. \value BlendEquation glBlendEquation() is available. \value BlendEquationSeparate glBlendEquationSeparate() is available. + \value BlendEquationAdvanced Advanced blend equations are available. \value BlendFuncSeparate glBlendFuncSeparate() is available. \value BlendSubtract Blend subtract mode is available. \value CompressedTextures Compressed texture functions are available. @@ -258,7 +206,8 @@ QOpenGLFunctions::QOpenGLFunctions() /*! Constructs a function resolver for \a context. If \a context - is null, then the resolver will be created for the current QOpenGLContext. + is \nullptr, then the resolver will be created for the current + QOpenGLContext. The context or another context in the group must be current. @@ -5087,8 +5036,8 @@ QOpenGLExtraFunctions::QOpenGLExtraFunctions() } /*! - Constructs a function resolver for context. If \a context is null, then - the resolver will be created for the current QOpenGLContext. + Constructs a function resolver for context. If \a context is \nullptr, + then the resolver will be created for the current QOpenGLContext. The context or another context in the group must be current. diff --git a/src/gui/opengl/qopenglfunctions.h b/src/gui/opengl/qopenglfunctions.h index 00287b0665..4554291bbd 100644 --- a/src/gui/opengl/qopenglfunctions.h +++ b/src/gui/opengl/qopenglfunctions.h @@ -228,26 +228,8 @@ struct QOpenGLFunctionsPrivate; #undef glTexLevelParameteriv #if defined(Q_CLANG_QDOC) -#undef GLint -typedef int GLint; -#undef GLsizei -typedef int GLsizei; -#undef GLuint -typedef unsigned int GLuint; -#undef GLubyte -typedef unsigned int GLubyte; -#undef GLenum -typedef unsigned int GLenum; #undef GLbitfield typedef unsigned int GLbitfield; -#undef GLfloat -typedef float GLfloat; -#undef GLclampf -typedef float GLclampf; -#undef GLboolean -typedef bool GLboolean; -#undef GLvoid -typedef void GLvoid; #undef GLchar typedef char GLchar; #endif diff --git a/src/gui/opengl/qopenglfunctions_4_4_compatibility.cpp b/src/gui/opengl/qopenglfunctions_4_4_compatibility.cpp index a33efd0b95..5c7170b8fa 100644 --- a/src/gui/opengl/qopenglfunctions_4_4_compatibility.cpp +++ b/src/gui/opengl/qopenglfunctions_4_4_compatibility.cpp @@ -3,7 +3,7 @@ ** Copyright (C) 2015 Klaralvdalens Datakonsult AB (KDAB) ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtWidgets module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/opengl/qopenglfunctions_4_4_core.cpp b/src/gui/opengl/qopenglfunctions_4_4_core.cpp index 019a70087a..54833f9058 100644 --- a/src/gui/opengl/qopenglfunctions_4_4_core.cpp +++ b/src/gui/opengl/qopenglfunctions_4_4_core.cpp @@ -3,7 +3,7 @@ ** Copyright (C) 2015 Klaralvdalens Datakonsult AB (KDAB) ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtWidgets module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/opengl/qopenglfunctions_4_5_compatibility.h b/src/gui/opengl/qopenglfunctions_4_5_compatibility.h index 7a97085a85..a809c1c90b 100644 --- a/src/gui/opengl/qopenglfunctions_4_5_compatibility.h +++ b/src/gui/opengl/qopenglfunctions_4_5_compatibility.h @@ -4,7 +4,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtWidgets module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/opengl/qopenglfunctions_4_5_core.cpp b/src/gui/opengl/qopenglfunctions_4_5_core.cpp index 27c0223cf9..a47ebb9ee9 100644 --- a/src/gui/opengl/qopenglfunctions_4_5_core.cpp +++ b/src/gui/opengl/qopenglfunctions_4_5_core.cpp @@ -3,7 +3,7 @@ ** Copyright (C) 2015 Klaralvdalens Datakonsult AB (KDAB) ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtWidgets module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/opengl/qopenglgradientcache_p.h b/src/gui/opengl/qopenglgradientcache_p.h index cbdbbb0c54..1d34223bdd 100644 --- a/src/gui/opengl/qopenglgradientcache_p.h +++ b/src/gui/opengl/qopenglgradientcache_p.h @@ -66,7 +66,7 @@ class QOpenGL2GradientCache : public QOpenGLSharedResource struct CacheInfo { inline CacheInfo(QGradientStops s, qreal op, QGradient::InterpolationMode mode) : - stops(qMove(s)), opacity(op), interpolationMode(mode) {} + stops(std::move(s)), opacity(op), interpolationMode(mode) {} GLuint texId; QGradientStops stops; diff --git a/src/gui/opengl/qopenglpaintengine.cpp b/src/gui/opengl/qopenglpaintengine.cpp index 001cb839fa..042b9ebd79 100644 --- a/src/gui/opengl/qopenglpaintengine.cpp +++ b/src/gui/opengl/qopenglpaintengine.cpp @@ -1574,14 +1574,15 @@ void QOpenGL2PaintEngineEx::drawImage(const QRectF& dest, const QImage& image, c case QImage::Format_Alpha8: if (ctx->functions()->hasOpenGLFeature(QOpenGLFunctions::TextureRGFormats)) { d->shaderManager->setSrcPixelType(QOpenGLEngineShaderManager::AlphaImageSrc); - bindOption = QOpenGLTextureUploader::UseRedFor8BitBindOption; + bindOption = QOpenGLTextureUploader::UseRedForAlphaAndLuminanceBindOption; } else d->shaderManager->setSrcPixelType(QOpenGLEngineShaderManager::ImageSrc); break; case QImage::Format_Grayscale8: + case QImage::Format_Grayscale16: if (ctx->functions()->hasOpenGLFeature(QOpenGLFunctions::TextureRGFormats)) { d->shaderManager->setSrcPixelType(QOpenGLEngineShaderManager::GrayscaleImageSrc); - bindOption = QOpenGLTextureUploader::UseRedFor8BitBindOption; + bindOption = QOpenGLTextureUploader::UseRedForAlphaAndLuminanceBindOption; } else d->shaderManager->setSrcPixelType(QOpenGLEngineShaderManager::ImageSrc); break; diff --git a/src/gui/opengl/qopenglpaintengine_p.h b/src/gui/opengl/qopenglpaintengine_p.h index 0541ce6168..81f17572b2 100644 --- a/src/gui/opengl/qopenglpaintengine_p.h +++ b/src/gui/opengl/qopenglpaintengine_p.h @@ -166,7 +166,7 @@ public: bool shouldDrawCachedGlyphs(QFontEngine *, const QTransform &) const override; private: - Q_DISABLE_COPY(QOpenGL2PaintEngineEx) + Q_DISABLE_COPY_MOVE(QOpenGL2PaintEngineEx) friend class QOpenGLEngineShaderManager; }; @@ -187,9 +187,9 @@ public: QOpenGL2PaintEngineExPrivate(QOpenGL2PaintEngineEx *q_ptr) : q(q_ptr), - shaderManager(0), + shaderManager(nullptr), width(0), height(0), - ctx(0), + ctx(nullptr), useSystemClip(true), elementIndicesVBOId(0), opacityArray(0), @@ -361,9 +361,9 @@ void QOpenGL2PaintEngineExPrivate::uploadData(unsigned int arrayIndex, const GLf opacityBuffer.allocate(data, count * sizeof(float)); } if (arrayIndex == QT_OPACITY_ATTR) - funcs.glVertexAttribPointer(arrayIndex, 1, GL_FLOAT, GL_FALSE, 0, 0); + funcs.glVertexAttribPointer(arrayIndex, 1, GL_FLOAT, GL_FALSE, 0, nullptr); else - funcs.glVertexAttribPointer(arrayIndex, 2, GL_FLOAT, GL_FALSE, 0, 0); + funcs.glVertexAttribPointer(arrayIndex, 2, GL_FLOAT, GL_FALSE, 0, nullptr); } else { // If we already uploaded the data we don't have to do it again if (data == vertexAttribPointers[arrayIndex]) diff --git a/src/gui/opengl/qopenglpixeltransferoptions.h b/src/gui/opengl/qopenglpixeltransferoptions.h index 2fc52b82d8..be60e66e71 100644 --- a/src/gui/opengl/qopenglpixeltransferoptions.h +++ b/src/gui/opengl/qopenglpixeltransferoptions.h @@ -56,13 +56,13 @@ public: QOpenGLPixelTransferOptions(); QOpenGLPixelTransferOptions(const QOpenGLPixelTransferOptions &); #ifdef Q_COMPILER_RVALUE_REFS - QOpenGLPixelTransferOptions &operator=(QOpenGLPixelTransferOptions &&other) Q_DECL_NOTHROW + QOpenGLPixelTransferOptions &operator=(QOpenGLPixelTransferOptions &&other) noexcept { swap(other); return *this; } #endif QOpenGLPixelTransferOptions &operator=(const QOpenGLPixelTransferOptions &); ~QOpenGLPixelTransferOptions(); - void swap(QOpenGLPixelTransferOptions &other) Q_DECL_NOTHROW + void swap(QOpenGLPixelTransferOptions &other) noexcept { data.swap(other.data); } void setAlignment(int alignment); diff --git a/src/gui/opengl/qopenglprogrambinarycache.cpp b/src/gui/opengl/qopenglprogrambinarycache.cpp index 0f03101329..c96021a969 100644 --- a/src/gui/opengl/qopenglprogrambinarycache.cpp +++ b/src/gui/opengl/qopenglprogrambinarycache.cpp @@ -63,7 +63,7 @@ Q_DECLARE_LOGGING_CATEGORY(DBG_SHADER_CACHE) #endif const quint32 BINSHADER_MAGIC = 0x5174; -const quint32 BINSHADER_VERSION = 0x2; +const quint32 BINSHADER_VERSION = 0x3; const quint32 BINSHADER_QTVERSION = QT_VERSION; namespace { @@ -120,7 +120,7 @@ QString QOpenGLProgramBinaryCache::cacheFileName(const QByteArray &cacheKey) con return m_cacheDir + QString::fromUtf8(cacheKey); } -#define BASE_HEADER_SIZE (int(3 * sizeof(quint32))) +#define BASE_HEADER_SIZE (int(4 * sizeof(quint32))) #define FULL_HEADER_SIZE(stringsSize) (BASE_HEADER_SIZE + 12 + stringsSize + 8) #define PADDING_SIZE(fullHeaderSize) (((fullHeaderSize + 3) & ~3) - fullHeaderSize) @@ -159,6 +159,10 @@ bool QOpenGLProgramBinaryCache::verifyHeader(const QByteArray &buf) const qCDebug(DBG_SHADER_CACHE, "Qt version does not match"); return false; } + if (readUInt(&p) != sizeof(quintptr)) { + qCDebug(DBG_SHADER_CACHE, "Architecture does not match"); + return false; + } return true; } @@ -371,6 +375,7 @@ void QOpenGLProgramBinaryCache::save(const QByteArray &cacheKey, uint programId) writeUInt(&p, BINSHADER_MAGIC); writeUInt(&p, BINSHADER_VERSION); writeUInt(&p, BINSHADER_QTVERSION); + writeUInt(&p, sizeof(quintptr)); writeStr(&p, info.glvendor); writeStr(&p, info.glrenderer); diff --git a/src/gui/opengl/qopenglqueryhelper_p.h b/src/gui/opengl/qopenglqueryhelper_p.h index 60dbf9c743..ad91ca9f96 100644 --- a/src/gui/opengl/qopenglqueryhelper_p.h +++ b/src/gui/opengl/qopenglqueryhelper_p.h @@ -65,18 +65,18 @@ class QOpenGLQueryHelper { public: QOpenGLQueryHelper(QOpenGLContext *context) - : GetQueryObjectuiv(0), - GetQueryObjectiv(0), - GetQueryiv(0), - EndQuery(0), - BeginQuery(0), - IsQuery(0), - DeleteQueries(0), - GenQueries(0), - GetInteger64v(0), - GetQueryObjectui64v(0), - GetQueryObjecti64v(0), - QueryCounter(0) + : GetQueryObjectuiv(nullptr), + GetQueryObjectiv(nullptr), + GetQueryiv(nullptr), + EndQuery(nullptr), + BeginQuery(nullptr), + IsQuery(nullptr), + DeleteQueries(nullptr), + GenQueries(nullptr), + GetInteger64v(nullptr), + GetQueryObjectui64v(nullptr), + GetQueryObjecti64v(nullptr), + QueryCounter(nullptr) { Q_ASSERT(context); diff --git a/src/gui/opengl/qopenglshaderprogram.cpp b/src/gui/opengl/qopenglshaderprogram.cpp index c39177080d..f225d5dc75 100644 --- a/src/gui/opengl/qopenglshaderprogram.cpp +++ b/src/gui/opengl/qopenglshaderprogram.cpp @@ -3667,7 +3667,8 @@ QVector<float> QOpenGLShaderProgram::defaultInnerTessellationLevels() const Language (GLSL) are supported on this system; false otherwise. The \a context is used to resolve the GLSL extensions. - If \a context is null, then QOpenGLContext::currentContext() is used. + If \a context is \nullptr, then QOpenGLContext::currentContext() + is used. */ bool QOpenGLShaderProgram::hasOpenGLShaderPrograms(QOpenGLContext *context) { @@ -3694,7 +3695,8 @@ void QOpenGLShaderProgram::shaderDestroyed() this system; false otherwise. The \a context is used to resolve the GLSL extensions. - If \a context is null, then QOpenGLContext::currentContext() is used. + If \a context is \nullptr, then QOpenGLContext::currentContext() + is used. */ bool QOpenGLShader::hasOpenGLShaders(ShaderType type, QOpenGLContext *context) { diff --git a/src/gui/opengl/qopenglshaderprogram.h b/src/gui/opengl/qopenglshaderprogram.h index bdd18c9d68..c79101fd4d 100644 --- a/src/gui/opengl/qopenglshaderprogram.h +++ b/src/gui/opengl/qopenglshaderprogram.h @@ -50,13 +50,6 @@ #include <QtGui/qvector4d.h> #include <QtGui/qmatrix4x4.h> -#if defined(Q_CLANG_QDOC) -#undef GLint -typedef int GLint; -#undef GLfloat -typedef double GLfloat; -#endif - QT_BEGIN_NAMESPACE diff --git a/src/gui/opengl/qopengltexture.cpp b/src/gui/opengl/qopengltexture.cpp index cea4b51a5c..61a6202017 100644 --- a/src/gui/opengl/qopengltexture.cpp +++ b/src/gui/opengl/qopengltexture.cpp @@ -1467,6 +1467,122 @@ void QOpenGLTexturePrivate::setData(int mipLevel, int layer, int layerCount, QOp } } +void QOpenGLTexturePrivate::setData(int xOffset, int yOffset, int zOffset, int width, int height, int depth, + int mipLevel, int layer, int layerCount, QOpenGLTexture::CubeMapFace cubeFace, + QOpenGLTexture::PixelFormat sourceFormat, QOpenGLTexture::PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options) +{ + switch (target) { + case QOpenGLTexture::Target1D: + Q_UNUSED(layer); + Q_UNUSED(cubeFace); + Q_UNUSED(layerCount); + Q_UNUSED(yOffset); + Q_UNUSED(zOffset); + Q_UNUSED(height); + Q_UNUSED(depth); + texFuncs->glTextureSubImage1D(textureId, target, bindingTarget, mipLevel, + xOffset, width, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::Target1DArray: + Q_UNUSED(cubeFace); + Q_UNUSED(yOffset); + Q_UNUSED(zOffset); + Q_UNUSED(height); + Q_UNUSED(depth); + texFuncs->glTextureSubImage2D(textureId, target, bindingTarget, mipLevel, + xOffset, layer, + width, + layerCount, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::Target2D: + Q_UNUSED(layer); + Q_UNUSED(cubeFace); + Q_UNUSED(layerCount); + Q_UNUSED(zOffset); + Q_UNUSED(depth); + texFuncs->glTextureSubImage2D(textureId, target, bindingTarget, mipLevel, + xOffset, yOffset, + width, height, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::Target2DArray: + Q_UNUSED(cubeFace); + Q_UNUSED(zOffset); + Q_UNUSED(depth); + texFuncs->glTextureSubImage3D(textureId, target, bindingTarget, mipLevel, + xOffset, yOffset, layer, + width, height, layerCount, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::Target3D: + Q_UNUSED(cubeFace); + Q_UNUSED(layerCount); + texFuncs->glTextureSubImage3D(textureId, target, bindingTarget, mipLevel, + xOffset, yOffset, zOffset, + width, height, depth, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::TargetCubeMap: + Q_UNUSED(layer); + Q_UNUSED(layerCount); + Q_UNUSED(zOffset); + Q_UNUSED(depth); + texFuncs->glTextureSubImage2D(textureId, cubeFace, bindingTarget, mipLevel, + xOffset, yOffset, + width, height, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::TargetCubeMapArray: { + Q_UNUSED(zOffset); + Q_UNUSED(depth); + int faceIndex = cubeFace - QOpenGLTexture::CubeMapPositiveX; + int layerFace = 6 * layer + faceIndex; + texFuncs->glTextureSubImage3D(textureId, target, bindingTarget, mipLevel, + xOffset, yOffset, layerFace, + width, height, + layerCount, + sourceFormat, sourceType, data, options); + break; + } + + case QOpenGLTexture::TargetRectangle: + Q_UNUSED(mipLevel); + Q_UNUSED(layer); + Q_UNUSED(cubeFace); + Q_UNUSED(layerCount); + Q_UNUSED(zOffset); + Q_UNUSED(depth); + texFuncs->glTextureSubImage2D(textureId, target, bindingTarget, 0, + xOffset, yOffset, + width, height, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::Target2DMultisample: + case QOpenGLTexture::Target2DMultisampleArray: + case QOpenGLTexture::TargetBuffer: + // We don't upload pixel data for these targets + qWarning("QOpenGLTexture::setData(): Texture target does not support pixel data upload"); + break; + } + + // If requested perform automatic mip map generation + if (mipLevel == 0 && autoGenerateMipMaps && mipLevels > 1) { + Q_Q(QOpenGLTexture); + q->generateMipMaps(); + } +} + + void QOpenGLTexturePrivate::setCompressedData(int mipLevel, int layer, int layerCount, QOpenGLTexture::CubeMapFace cubeFace, int dataSize, const void *data, @@ -3380,6 +3496,153 @@ void QOpenGLTexture::setData(PixelFormat sourceFormat, PixelType sourceType, d->setData(0, 0, 1, QOpenGLTexture::CubeMapPositiveX, sourceFormat, sourceType, data, options); } +/*! + \since 5.14 + \overload + + This overload is to be used to update a part of the texture. Parameters \a + xOffset, \a yOffset, \a zOffset specify the texel offsets within the + texture. Parameters \a width, \a height and \a depth specify the dimensions + of the sub image. + + The structure of the pixel data pointed to by \a data is specified by \a + sourceFormat and \a sourceType. The pixel data upload can optionally be + controlled by \a options. +*/ +void QOpenGLTexture::setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options) +{ + Q_D(QOpenGLTexture); + Q_ASSERT(d->textureId); + d->setData(xOffset, yOffset, zOffset, + width, height, depth, + 0, 0, 1, + QOpenGLTexture::CubeMapPositiveX, sourceFormat, + sourceType, data, options); +} + +/*! + \since 5.14 + \overload + + This overload is to be used to update a part of the texture. Parameters \a + xOffset, \a yOffset, \a zOffset specify the texel offsets within the + texture. Parameters \a width, \a height and \a depth specify the dimensions + of the sub image. The mip map level the sub image we want to + update is specified with \a mipLevel. + + The structure of the pixel data pointed to by \a data is specified by \a + sourceFormat and \a sourceType. The pixel data upload can optionally be + controlled by \a options. +*/ +void QOpenGLTexture::setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options) +{ + Q_D(QOpenGLTexture); + Q_ASSERT(d->textureId); + d->setData(xOffset, yOffset, zOffset, + width, height, depth, + mipLevel, 0, 1, + QOpenGLTexture::CubeMapPositiveX, sourceFormat, + sourceType, data, options); +} + +/*! + \since 5.14 + \overload + + This overload is to be used to update a part of the texture. Parameters \a + xOffset, \a yOffset, \a zOffset specify the texel offsets within the + texture. Parameters \a width, \a height and \a depth specify the dimensions + of the sub image. The mip map level and layerof the sub image we want to + update are specified with \a mipLevel and \a layer. + + The structure of the pixel data pointed to by \a data is specified by \a + sourceFormat and \a sourceType. The pixel data upload can optionally be + controlled by \a options. +*/ +void QOpenGLTexture::setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, int layer, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options) +{ + Q_D(QOpenGLTexture); + Q_ASSERT(d->textureId); + d->setData(xOffset, yOffset, zOffset, + width, height, depth, + mipLevel, layer, 1, + QOpenGLTexture::CubeMapPositiveX, sourceFormat, + sourceType, data, options); +} + +/*! + \since 5.14 + \overload + + This overload is to be used to update a part of the texture. Parameters \a + xOffset, \a yOffset, \a zOffset specify the texel offsets within the + texture. Parameters \a width, \a height and \a depth specify the dimensions + of the sub image.The mip map level, layer and cube map face of the sub + image we want to update are specified with \a mipLevel, \a layer and \a + face. + + The structure of the pixel data pointed to by \a data is specified by \a + sourceFormat and \a sourceType. The pixel data upload can optionally be + controlled by \a options. +*/ +void QOpenGLTexture::setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, int layer, + CubeMapFace face, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options) +{ + Q_D(QOpenGLTexture); + Q_ASSERT(d->textureId); + d->setData(xOffset, yOffset, zOffset, + width, height, depth, + mipLevel, layer, 1, + face, sourceFormat, + sourceType, data, options); +} + +/*! + \since 5.14 + \overload + + This overload is to be used to update a part of the texture. Parameters \a + xOffset, \a yOffset, \a zOffset specify the texel offsets within the + texture. Parameters \a width, \a height and \a depth specify the dimensions + of the sub image.The mip map level, starting layer, cube map face and + number of layers of the sub image we want to update are specified with \a + mipLevel, \a layer, \a face and \a layerCount. + + The structure of the pixel data pointed to by \a data is specified by \a + sourceFormat and \a sourceType. The pixel data upload can optionally be + controlled by \a options. +*/ +void QOpenGLTexture::setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, int layer, + CubeMapFace face, int layerCount, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options) +{ + Q_D(QOpenGLTexture); + Q_ASSERT(d->textureId); + d->setData(xOffset, yOffset, zOffset, + width, height, depth, + mipLevel, layer, layerCount, + face, sourceFormat, + sourceType, data, options); +} + #if QT_DEPRECATED_SINCE(5, 3) /*! \obsolete @@ -3914,8 +4177,7 @@ bool QOpenGLTexture::isAutoMipMapGenerationEnabled() const have disabled automatic mipmap generation then you need to call this function or the overload to create the mipmap chain. - \note Mipmap generation is not supported for compressed textures with OpenGL - ES 2.0. + \note Mipmap generation is not supported for compressed textures with OpenGL ES. \sa setAutoMipMapGenerationEnabled(), setMipLevels(), mipLevels() */ @@ -3926,7 +4188,7 @@ void QOpenGLTexture::generateMipMaps() Q_ASSERT(d->textureId); if (isCompressedFormat(d->format)) { if (QOpenGLContext *ctx = QOpenGLContext::currentContext()) - if (ctx->isOpenGLES() && ctx->format().majorVersion() < 3) + if (ctx->isOpenGLES()) return; } d->texFuncs->glGenerateTextureMipmap(d->textureId, d->target, d->bindingTarget); @@ -3951,7 +4213,7 @@ void QOpenGLTexture::generateMipMaps(int baseLevel, bool resetBaseLevel) Q_ASSERT(d->textureId); if (isCompressedFormat(d->format)) { if (QOpenGLContext *ctx = QOpenGLContext::currentContext()) - if (ctx->isOpenGLES() && ctx->format().majorVersion() < 3) + if (ctx->isOpenGLES()) return; } int oldBaseLevel; @@ -4115,7 +4377,7 @@ QOpenGLTexture::DepthStencilMode QOpenGLTexture::depthStencilMode() const */ -/* +/*! \since 5.5 Sets the texture comparison function on this texture to \a function. The texture diff --git a/src/gui/opengl/qopengltexture.h b/src/gui/opengl/qopengltexture.h index c0c5283374..7d984babc8 100644 --- a/src/gui/opengl/qopengltexture.h +++ b/src/gui/opengl/qopengltexture.h @@ -485,6 +485,32 @@ public: void setData(PixelFormat sourceFormat, PixelType sourceType, const void *data, const QOpenGLPixelTransferOptions * const options = nullptr); + void setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options = nullptr); + void setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, int mipLevel, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options = nullptr); + void setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, int layer, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options = nullptr); + void setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, int layer, + CubeMapFace cubeFace, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options = nullptr); + void setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, int layer, + CubeMapFace cubeFace, int layerCount, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options = nullptr); + // Compressed data upload // ### Qt 6: remove the non-const void * overloads #if QT_DEPRECATED_SINCE(5, 3) diff --git a/src/gui/opengl/qopengltexture_p.h b/src/gui/opengl/qopengltexture_p.h index f7694f77bc..9f3457ad0a 100644 --- a/src/gui/opengl/qopengltexture_p.h +++ b/src/gui/opengl/qopengltexture_p.h @@ -101,6 +101,10 @@ public: void setData(int mipLevel, int layer, int layerCount, QOpenGLTexture::CubeMapFace cubeFace, QOpenGLTexture::PixelFormat sourceFormat, QOpenGLTexture::PixelType sourceType, const void *data, const QOpenGLPixelTransferOptions * const options); + void setData(int xOffset, int yOffset, int zOffset, int width, int height, int depth, + int mipLevel, int layer, int layerCount, QOpenGLTexture::CubeMapFace cubeFace, + QOpenGLTexture::PixelFormat sourceFormat, QOpenGLTexture::PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options); void setCompressedData(int mipLevel, int layer, int layerCount, QOpenGLTexture::CubeMapFace cubeFace, int dataSize, const void *data, const QOpenGLPixelTransferOptions * const options); diff --git a/src/gui/opengl/qopengltexturecache.cpp b/src/gui/opengl/qopengltexturecache.cpp index 8de0b25fee..ef07dbe109 100644 --- a/src/gui/opengl/qopengltexturecache.cpp +++ b/src/gui/opengl/qopengltexturecache.cpp @@ -97,7 +97,7 @@ void QOpenGLTextureCacheWrapper::cleanupTexturesForPixmapData(QPlatformPixmap *p QOpenGLTextureCache::QOpenGLTextureCache(QOpenGLContext *ctx) : QOpenGLSharedResource(ctx->shareGroup()) - , m_cache(64 * 1024) // 64 MB cache + , m_cache(256 * 1024) // 256 MB cache { } diff --git a/src/gui/opengl/qopengltextureglyphcache.cpp b/src/gui/opengl/qopengltextureglyphcache.cpp index 556d52ef99..e3cbba955d 100644 --- a/src/gui/opengl/qopengltextureglyphcache.cpp +++ b/src/gui/opengl/qopengltextureglyphcache.cpp @@ -344,15 +344,25 @@ void QOpenGLTextureGlyphCache::resizeTextureData(int width, int height) { QString source; +#ifdef Q_OS_WASM + source.append(QLatin1String(isCoreProfile ? qopenglslUntransformedPositionVertexShader_core : qopenglslUntransformedPositionVertexShader)); + source.append(QLatin1String(isCoreProfile ? qopenglslMainWithTexCoordsVertexShader_core : qopenglslMainWithTexCoordsVertexShader)); +#else source.append(QLatin1String(isCoreProfile ? qopenglslMainWithTexCoordsVertexShader_core : qopenglslMainWithTexCoordsVertexShader)); source.append(QLatin1String(isCoreProfile ? qopenglslUntransformedPositionVertexShader_core : qopenglslUntransformedPositionVertexShader)); +#endif m_blitProgram->addCacheableShaderFromSourceCode(QOpenGLShader::Vertex, source); } { QString source; +#ifdef Q_OS_WASM + source.append(QLatin1String(isCoreProfile ? qopenglslImageSrcFragmentShader_core : qopenglslImageSrcFragmentShader)); + source.append(QLatin1String(isCoreProfile ? qopenglslMainFragmentShader_core : qopenglslMainFragmentShader)); +#else source.append(QLatin1String(isCoreProfile ? qopenglslMainFragmentShader_core : qopenglslMainFragmentShader)); source.append(QLatin1String(isCoreProfile ? qopenglslImageSrcFragmentShader_core : qopenglslImageSrcFragmentShader)); +#endif m_blitProgram->addCacheableShaderFromSourceCode(QOpenGLShader::Fragment, source); } diff --git a/src/gui/opengl/qopengltextureglyphcache_p.h b/src/gui/opengl/qopengltextureglyphcache_p.h index 598cb00ee5..aed128cf9e 100644 --- a/src/gui/opengl/qopengltextureglyphcache_p.h +++ b/src/gui/opengl/qopengltextureglyphcache_p.h @@ -139,7 +139,7 @@ public: inline void setPaintEnginePrivate(QOpenGL2PaintEngineExPrivate *p) { pex = p; } - inline const QOpenGLContextGroup *contextGroup() const { return m_textureResource ? m_textureResource->group() : 0; } + inline const QOpenGLContextGroup *contextGroup() const { return m_textureResource ? m_textureResource->group() : nullptr; } inline int serialNumber() const { return m_serialNumber; } diff --git a/src/gui/opengl/qopengltexturehelper_p.h b/src/gui/opengl/qopengltexturehelper_p.h index 00f6f9e5aa..62d0125daf 100644 --- a/src/gui/opengl/qopengltexturehelper_p.h +++ b/src/gui/opengl/qopengltexturehelper_p.h @@ -167,7 +167,7 @@ public: inline void glTextureSubImage3D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, - const GLvoid *pixels, const QOpenGLPixelTransferOptions * const options = 0) + const GLvoid *pixels, const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -181,7 +181,7 @@ public: inline void glTextureSubImage2D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, - const GLvoid *pixels, const QOpenGLPixelTransferOptions * const options = 0) + const GLvoid *pixels, const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -195,7 +195,7 @@ public: inline void glTextureSubImage1D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, - const GLvoid *pixels, const QOpenGLPixelTransferOptions * const options = 0) + const GLvoid *pixels, const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -222,7 +222,7 @@ public: inline void glCompressedTextureSubImage1D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits, - const QOpenGLPixelTransferOptions * const options = 0) + const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -238,7 +238,7 @@ public: GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits, - const QOpenGLPixelTransferOptions * const options = 0) + const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -254,7 +254,7 @@ public: GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits, - const QOpenGLPixelTransferOptions * const options = 0) + const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -269,7 +269,7 @@ public: inline void glCompressedTextureImage1D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLenum internalFormat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits, - const QOpenGLPixelTransferOptions * const options = 0) + const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -284,7 +284,7 @@ public: inline void glCompressedTextureImage2D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLenum internalFormat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits, - const QOpenGLPixelTransferOptions * const options = 0) + const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { @@ -300,7 +300,7 @@ public: inline void glCompressedTextureImage3D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits, - const QOpenGLPixelTransferOptions * const options = 0) + const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); diff --git a/src/gui/opengl/qopengltextureuploader.cpp b/src/gui/opengl/qopengltextureuploader.cpp index 2428baed93..b8b532b3d0 100644 --- a/src/gui/opengl/qopengltextureuploader.cpp +++ b/src/gui/opengl/qopengltextureuploader.cpp @@ -104,7 +104,7 @@ qsizetype QOpenGLTextureUploader::textureImage(GLenum target, const QImage &imag const bool isOpenGLES3orBetter = context->isOpenGLES() && context->format().majorVersion() >= 3; const bool sRgbBinding = (options & SRgbBindOption); Q_ASSERT(isOpenGL12orBetter || context->isOpenGLES()); - Q_ASSERT((options & (SRgbBindOption | UseRedFor8BitBindOption)) != (SRgbBindOption | UseRedFor8BitBindOption)); + Q_ASSERT((options & (SRgbBindOption | UseRedForAlphaAndLuminanceBindOption)) != (SRgbBindOption | UseRedForAlphaAndLuminanceBindOption)); switch (image.format()) { case QImage::Format_RGB32: @@ -114,7 +114,19 @@ qsizetype QOpenGLTextureUploader::textureImage(GLenum target, const QImage &imag externalFormat = GL_BGRA; internalFormat = GL_RGBA; pixelType = GL_UNSIGNED_INT_8_8_8_8_REV; - } else if (funcs->hasOpenGLExtension(QOpenGLExtensions::TextureSwizzle) && false) { +#if Q_BYTE_ORDER == Q_LITTLE_ENDIAN + // Without GL_UNSIGNED_INT_8_8_8_8_REV, BGRA only matches ARGB on little endian: + } else if (funcs->hasOpenGLExtension(QOpenGLExtensions::BGRATextureFormat) && !sRgbBinding) { + // The GL_EXT_texture_format_BGRA8888 extension requires the internal format to match the external. + externalFormat = internalFormat = GL_BGRA; + pixelType = GL_UNSIGNED_BYTE; + } else if (context->isOpenGLES() && context->hasExtension(QByteArrayLiteral("GL_APPLE_texture_format_BGRA8888"))) { + // Is only allowed as an external format like OpenGL. + externalFormat = GL_BGRA; + internalFormat = GL_RGBA; + pixelType = GL_UNSIGNED_BYTE; +#endif + } else if (funcs->hasOpenGLExtension(QOpenGLExtensions::TextureSwizzle)) { #if Q_BYTE_ORDER == Q_LITTLE_ENDIAN GLint swizzle[4] = { GL_BLUE, GL_GREEN, GL_RED, GL_ALPHA }; funcs->glTexParameteriv(target, GL_TEXTURE_SWIZZLE_RGBA, swizzle); @@ -125,25 +137,8 @@ qsizetype QOpenGLTextureUploader::textureImage(GLenum target, const QImage &imag externalFormat = internalFormat = GL_RGBA; pixelType = GL_UNSIGNED_BYTE; } else { -#if Q_BYTE_ORDER == Q_LITTLE_ENDIAN - // Without GL_UNSIGNED_INT_8_8_8_8_REV, BGRA only matches ARGB on little endian. - if (funcs->hasOpenGLExtension(QOpenGLExtensions::BGRATextureFormat) && !sRgbBinding) { - // The GL_EXT_texture_format_BGRA8888 extension requires the internal format to match the external. - externalFormat = internalFormat = GL_BGRA; - pixelType = GL_UNSIGNED_BYTE; - } else if (context->isOpenGLES() && context->hasExtension(QByteArrayLiteral("GL_APPLE_texture_format_BGRA8888"))) { - // Is only allowed as an external format like OpenGL. - externalFormat = GL_BGRA; - internalFormat = GL_RGBA; - pixelType = GL_UNSIGNED_BYTE; - } else { - // No support for direct ARGB32 upload. - break; - } -#else - // Big endian requires GL_UNSIGNED_INT_8_8_8_8_REV for ARGB to match BGRA + // No support for direct ARGB32 upload. break; -#endif } targetFormat = image.format(); break; @@ -213,7 +208,7 @@ qsizetype QOpenGLTextureUploader::textureImage(GLenum target, const QImage &imag if (sRgbBinding) { // Always needs conversion break; - } else if (options & UseRedFor8BitBindOption) { + } else if (options & UseRedForAlphaAndLuminanceBindOption) { externalFormat = internalFormat = GL_RED; pixelType = GL_UNSIGNED_BYTE; targetFormat = image.format(); @@ -223,7 +218,7 @@ qsizetype QOpenGLTextureUploader::textureImage(GLenum target, const QImage &imag if (sRgbBinding) { // Always needs conversion break; - } else if (options & UseRedFor8BitBindOption) { + } else if (options & UseRedForAlphaAndLuminanceBindOption) { externalFormat = internalFormat = GL_RED; pixelType = GL_UNSIGNED_BYTE; targetFormat = image.format(); @@ -243,7 +238,7 @@ qsizetype QOpenGLTextureUploader::textureImage(GLenum target, const QImage &imag if (sRgbBinding) { // Always needs conversion break; - } else if (options & UseRedFor8BitBindOption) { + } else if (options & UseRedForAlphaAndLuminanceBindOption) { externalFormat = internalFormat = GL_RED; pixelType = GL_UNSIGNED_BYTE; targetFormat = image.format(); @@ -259,6 +254,26 @@ qsizetype QOpenGLTextureUploader::textureImage(GLenum target, const QImage &imag targetFormat = image.format(); } break; + case QImage::Format_Grayscale16: + if (sRgbBinding) { + // Always needs conversion + break; + } else if (options & UseRedForAlphaAndLuminanceBindOption) { + externalFormat = internalFormat = GL_RED; + pixelType = GL_UNSIGNED_SHORT; + targetFormat = image.format(); + } else if (context->isOpenGLES() || context->format().profile() != QSurfaceFormat::CoreProfile) { + externalFormat = internalFormat = GL_LUMINANCE; + pixelType = GL_UNSIGNED_SHORT; + targetFormat = image.format(); + } else if (funcs->hasOpenGLExtension(QOpenGLExtensions::TextureSwizzle)) { + GLint swizzle[4] = { GL_RED, GL_RED, GL_RED, GL_ONE }; + funcs->glTexParameteriv(GL_TEXTURE_2D, GL_TEXTURE_SWIZZLE_RGBA, swizzle); + externalFormat = internalFormat = GL_RED; + pixelType = GL_UNSIGNED_SHORT; + targetFormat = image.format(); + } + break; default: break; } diff --git a/src/gui/opengl/qopengltextureuploader_p.h b/src/gui/opengl/qopengltextureuploader_p.h index d758b3787b..0dcf709d7e 100644 --- a/src/gui/opengl/qopengltextureuploader_p.h +++ b/src/gui/opengl/qopengltextureuploader_p.h @@ -65,7 +65,7 @@ public: enum BindOption { NoBindOption = 0x0000, PremultipliedAlphaBindOption = 0x0001, - UseRedFor8BitBindOption = 0x0002, + UseRedForAlphaAndLuminanceBindOption = 0x0002, SRgbBindOption = 0x0004, PowerOfTwoBindOption = 0x0008 }; diff --git a/src/gui/opengl/qopenglversionfunctions.h b/src/gui/opengl/qopenglversionfunctions.h index 3af1ed0466..aa6e49b9ae 100644 --- a/src/gui/opengl/qopenglversionfunctions.h +++ b/src/gui/opengl/qopenglversionfunctions.h @@ -97,7 +97,7 @@ struct QOpenGLVersionStatus OpenGLStatus status; }; -inline uint qHash(const QOpenGLVersionStatus &v, uint seed = 0) Q_DECL_NOTHROW +inline uint qHash(const QOpenGLVersionStatus &v, uint seed = 0) noexcept { return qHash(static_cast<int>(v.status * 1000) + v.version.first * 100 + v.version.second * 10, seed); @@ -214,6 +214,7 @@ public: virtual bool initializeOpenGLFunctions(); + Q_DISABLE_COPY(QAbstractOpenGLFunctions) Q_DECLARE_PRIVATE(QAbstractOpenGLFunctions) protected: diff --git a/src/gui/opengl/qopenglvertexarrayobject.cpp b/src/gui/opengl/qopenglvertexarrayobject.cpp index 0262538250..f0837aff96 100644 --- a/src/gui/opengl/qopenglvertexarrayobject.cpp +++ b/src/gui/opengl/qopenglvertexarrayobject.cpp @@ -40,8 +40,10 @@ #include "qopenglvertexarrayobject.h" #include <QtCore/private/qobject_p.h> +#include <QtCore/qthread.h> #include <QtGui/qopenglcontext.h> #include <QtGui/qoffscreensurface.h> +#include <QtGui/qguiapplication.h> #include <QtGui/qopenglfunctions_3_0.h> #include <QtGui/qopenglfunctions_3_2_core.h> @@ -204,18 +206,25 @@ void QOpenGLVertexArrayObjectPrivate::destroy() if (context && context != ctx) { oldContext = ctx; oldContextSurface = ctx ? ctx->surface() : 0; - // Cannot just make the current surface current again with another context. - // The format may be incompatible and some platforms (iOS) may impose - // restrictions on using a window with different contexts. Create an - // offscreen surface (a pbuffer or a hidden window) instead to be safe. - offscreenSurface.reset(new QOffscreenSurface); - offscreenSurface->setFormat(context->format()); - offscreenSurface->create(); - if (context->makeCurrent(offscreenSurface.data())) { - ctx = context; - } else { - qWarning("QOpenGLVertexArrayObject::destroy() failed to make VAO's context current"); + // Before going through the effort of creating an offscreen surface + // check that we are on the GUI thread because otherwise many platforms + // will not able to create that offscreen surface. + if (QThread::currentThread() != qGuiApp->thread()) { ctx = 0; + } else { + // Cannot just make the current surface current again with another context. + // The format may be incompatible and some platforms (iOS) may impose + // restrictions on using a window with different contexts. Create an + // offscreen surface (a pbuffer or a hidden window) instead to be safe. + offscreenSurface.reset(new QOffscreenSurface); + offscreenSurface->setFormat(context->format()); + offscreenSurface->create(); + if (context->makeCurrent(offscreenSurface.data())) { + ctx = context; + } else { + qWarning("QOpenGLVertexArrayObject::destroy() failed to make VAO's context current"); + ctx = 0; + } } } @@ -224,7 +233,7 @@ void QOpenGLVertexArrayObjectPrivate::destroy() context = 0; } - if (vao) { + if (vao && ctx) { switch (vaoFuncsType) { #ifndef QT_OPENGL_ES_2 case Core_3_2: diff --git a/src/gui/painting/painting.pri b/src/gui/painting/painting.pri index c3585a4647..972cf387ff 100644 --- a/src/gui/painting/painting.pri +++ b/src/gui/painting/painting.pri @@ -8,7 +8,15 @@ HEADERS += \ painting/qbrush.h \ painting/qcolor.h \ painting/qcolor_p.h \ - painting/qcolorprofile_p.h \ + painting/qcolormatrix_p.h \ + painting/qcolorspace.h \ + painting/qcolorspace_p.h \ + painting/qcolortransferfunction_p.h \ + painting/qcolortransfertable_p.h \ + painting/qcolortransform.h \ + painting/qcolortransform_p.h \ + painting/qcolortrc_p.h \ + painting/qcolortrclut_p.h \ painting/qcosmeticstroker_p.h \ painting/qdatabuffer_p.h \ painting/qdrawhelper_p.h \ @@ -17,6 +25,7 @@ HEADERS += \ painting/qemulationpaintengine_p.h \ painting/qfixed_p.h \ painting/qgrayraster_p.h \ + painting/qicc_p.h \ painting/qmatrix.h \ painting/qmemrotate_p.h \ painting/qoutlinemapper_p.h \ @@ -64,12 +73,15 @@ SOURCES += \ painting/qblittable.cpp \ painting/qbrush.cpp \ painting/qcolor.cpp \ - painting/qcolorprofile.cpp \ + painting/qcolorspace.cpp \ + painting/qcolortransform.cpp \ + painting/qcolortrclut.cpp \ painting/qcompositionfunctions.cpp \ painting/qcosmeticstroker.cpp \ painting/qdrawhelper.cpp \ painting/qemulationpaintengine.cpp \ painting/qgrayraster.c \ + painting/qicc.cpp \ painting/qimagescale.cpp \ painting/qmatrix.cpp \ painting/qmemrotate.cpp \ @@ -131,9 +143,11 @@ ARCH_HASWELL_SOURCES += painting/qdrawhelper_avx2.cpp NEON_SOURCES += painting/qdrawhelper_neon.cpp painting/qimagescale_neon.cpp NEON_HEADERS += painting/qdrawhelper_neon_p.h -NEON_ASM += ../3rdparty/pixman/pixman-arm-neon-asm.S painting/qdrawhelper_neon_asm.S !uikit:!win32:contains(QT_ARCH, "arm"): CONFIG += no_clang_integrated_as -!uikit:!win32:!contains(QT_ARCH, "arm64"): DEFINES += ENABLE_PIXMAN_DRAWHELPERS +!uikit:!win32:!integrity:!contains(QT_ARCH, "arm64") { + NEON_ASM += ../3rdparty/pixman/pixman-arm-neon-asm.S painting/qdrawhelper_neon_asm.S + DEFINES += ENABLE_PIXMAN_DRAWHELPERS +} MIPS_DSP_SOURCES += painting/qdrawhelper_mips_dsp.cpp MIPS_DSP_HEADERS += painting/qdrawhelper_mips_dsp_p.h painting/qt_mips_asm_dsp_p.h diff --git a/src/gui/painting/qbackingstore.cpp b/src/gui/painting/qbackingstore.cpp index 8d71d1c3a9..3fab903c4d 100644 --- a/src/gui/painting/qbackingstore.cpp +++ b/src/gui/painting/qbackingstore.cpp @@ -62,7 +62,7 @@ public: } QWindow *window; - QPlatformBackingStore *platformBackingStore; + QPlatformBackingStore *platformBackingStore = nullptr; QScopedPointer<QImage> highDpiBackingstore; QRegion staticContents; QSize size; @@ -95,8 +95,6 @@ public: QBackingStore::QBackingStore(QWindow *window) : d_ptr(new QBackingStorePrivate(window)) { - d_ptr->platformBackingStore = QGuiApplicationPrivate::platformIntegration()->createPlatformBackingStore(window); - d_ptr->platformBackingStore->setBackingStore(this); } /*! @@ -131,7 +129,8 @@ void QBackingStore::beginPaint(const QRegion ®ion) d_ptr->highDpiBackingstore->devicePixelRatio() != d_ptr->window->devicePixelRatio()) resize(size()); - d_ptr->platformBackingStore->beginPaint(QHighDpi::toNativeLocalRegion(region, d_ptr->window)); + QPlatformBackingStore *platformBackingStore = handle(); + platformBackingStore->beginPaint(QHighDpi::toNativeLocalRegion(region, d_ptr->window)); // When QtGui is applying a high-dpi scale factor the backing store // creates a "large" backing store image. This image needs to be @@ -139,7 +138,7 @@ void QBackingStore::beginPaint(const QRegion ®ion) // devicePixelRatio. Do this on a separate image instance that shares // the image data to avoid having the new devicePixelRatio be propagated // back to the platform plugin. - QPaintDevice *device = d_ptr->platformBackingStore->paintDevice(); + QPaintDevice *device = platformBackingStore->paintDevice(); if (QHighDpiScaling::isActive() && device->devType() == QInternal::Image) { QImage *source = static_cast<QImage *>(device); const bool needsNewImage = d_ptr->highDpiBackingstore.isNull() @@ -168,7 +167,7 @@ void QBackingStore::beginPaint(const QRegion ®ion) */ QPaintDevice *QBackingStore::paintDevice() { - QPaintDevice *device = d_ptr->platformBackingStore->paintDevice(); + QPaintDevice *device = handle()->paintDevice(); if (QHighDpiScaling::isActive() && device->devType() == QInternal::Image) return d_ptr->highDpiBackingstore.data(); @@ -189,7 +188,18 @@ void QBackingStore::endPaint() if (paintDevice()->paintingActive()) qWarning() << "QBackingStore::endPaint() called with active painter on backingstore paint device"; - d_ptr->platformBackingStore->endPaint(); + handle()->endPaint(); +} + +static bool isRasterSurface(QWindow *window) +{ + switch (window->surfaceType()) { + case QSurface::RasterSurface: + case QSurface::RasterGLSurface: + return true; + default: + return false; + }; } /*! @@ -198,7 +208,7 @@ void QBackingStore::endPaint() The \a window must either be the top level window represented by this backingstore, or a non-transient child of that window. Passing - \c nullptr falls back to using the backingstore's top level window. + \nullptr falls back to using the backingstore's top level window. If the \a window is a child window, the \a region should be in child window coordinates, and the \a offset should be the child window's offset in relation @@ -220,6 +230,13 @@ void QBackingStore::flush(const QRegion ®ion, QWindow *window, const QPoint & return; } + if (!isRasterSurface(window)) { + qWarning() << "Attempted flush to non-raster surface" << window << "of type" << window->surfaceType() + << (window->inherits("QWidgetWindow") ? "(consider using Qt::WA_PaintOnScreen to exclude " + "from backingstore sync)" : ""); + return; + } + #ifdef QBACKINGSTORE_DEBUG if (window && window->isTopLevel() && !qt_window_private(window)->receivedExpose) { qWarning().nospace() << "QBackingStore::flush() called with non-exposed window " @@ -229,7 +246,7 @@ void QBackingStore::flush(const QRegion ®ion, QWindow *window, const QPoint & Q_ASSERT(window == topLevelWindow || topLevelWindow->isAncestorOf(window, QWindow::ExcludeTransients)); - d_ptr->platformBackingStore->flush(window, QHighDpi::toNativeLocalRegion(region, window), + handle()->flush(window, QHighDpi::toNativeLocalRegion(region, window), QHighDpi::toNativeLocalPosition(offset, window)); } @@ -241,7 +258,7 @@ void QBackingStore::flush(const QRegion ®ion, QWindow *window, const QPoint & void QBackingStore::resize(const QSize &size) { d_ptr->size = size; - d_ptr->platformBackingStore->resize(QHighDpi::toNativePixels(size, d_ptr->window), d_ptr->staticContents); + handle()->resize(QHighDpi::toNativePixels(size, d_ptr->window), d_ptr->staticContents); } /*! @@ -268,7 +285,7 @@ bool QBackingStore::scroll(const QRegion &area, int dx, int dy) if (qFloor(nativeDx) != nativeDx || qFloor(nativeDy) != nativeDy) return false; - return d_ptr->platformBackingStore->scroll(QHighDpi::toNativeLocalRegion(area, d_ptr->window), + return handle()->scroll(QHighDpi::toNativeLocalRegion(area, d_ptr->window), nativeDx, nativeDy); } @@ -349,6 +366,10 @@ void Q_GUI_EXPORT qt_scrollRectInImage(QImage &img, const QRect &rect, const QPo */ QPlatformBackingStore *QBackingStore::handle() const { + if (!d_ptr->platformBackingStore) { + d_ptr->platformBackingStore = QGuiApplicationPrivate::platformIntegration()->createPlatformBackingStore(d_ptr->window); + d_ptr->platformBackingStore->setBackingStore(const_cast<QBackingStore*>(this)); + } return d_ptr->platformBackingStore; } diff --git a/src/gui/painting/qbezier.cpp b/src/gui/painting/qbezier.cpp index a3dcb02e07..ddd1d997f2 100644 --- a/src/gui/painting/qbezier.cpp +++ b/src/gui/painting/qbezier.cpp @@ -333,7 +333,9 @@ static ShiftResult shift(const QBezier *orig, QBezier *shifted, qreal offset, qr *shifted = QBezier::fromPoints(points_shifted[map[0]], points_shifted[map[1]], points_shifted[map[2]], points_shifted[map[3]]); - return good_offset(orig, shifted, offset, threshold); + if (np > 2) + return good_offset(orig, shifted, offset, threshold); + return Ok; } // This value is used to determine the length of control point vectors @@ -432,7 +434,6 @@ redo: } else if (res == Ok) { ++o; --b; - continue; } else if (res == Circle && maxSegments - (o - curveSegments) >= 2) { // add semi circle if (addCircle(b, offset, o)) diff --git a/src/gui/painting/qblendfunctions.cpp b/src/gui/painting/qblendfunctions.cpp index 2dd5144e40..348eceb47f 100644 --- a/src/gui/painting/qblendfunctions.cpp +++ b/src/gui/painting/qblendfunctions.cpp @@ -187,19 +187,11 @@ void qt_blend_rgb16_on_rgb16(uchar *dst, int dbpl, #endif if (const_alpha == 256) { - if (w <= 64) { - while (h--) { - QT_MEMCPY_USHORT(dst, src, w); - dst += dbpl; - src += sbpl; - } - } else { - int length = w << 1; - while (h--) { - memcpy(dst, src, length); - dst += dbpl; - src += sbpl; - } + int length = w << 1; + while (h--) { + memcpy(dst, src, length); + dst += dbpl; + src += sbpl; } } else if (const_alpha != 0) { quint16 *d = (quint16 *) dst; diff --git a/src/gui/painting/qblendfunctions_p.h b/src/gui/painting/qblendfunctions_p.h index dc7a4dfe8c..5ea78cdde2 100644 --- a/src/gui/painting/qblendfunctions_p.h +++ b/src/gui/painting/qblendfunctions_p.h @@ -65,11 +65,11 @@ void qt_scale_image_16bit(uchar *destPixels, int dbpl, const QRect &clip, T blender) { - qreal sx = targetRect.width() / (qreal) srcRect.width(); - qreal sy = targetRect.height() / (qreal) srcRect.height(); + qreal sx = srcRect.width() / (qreal) targetRect.width(); + qreal sy = srcRect.height() / (qreal) targetRect.height(); - int ix = 0x00010000 / sx; - int iy = 0x00010000 / sy; + const int ix = 0x00010000 * sx; + const int iy = 0x00010000 * sy; // qDebug() << "scale:" << endl // << " - target" << targetRect << endl @@ -77,59 +77,30 @@ void qt_scale_image_16bit(uchar *destPixels, int dbpl, // << " - clip" << clip << endl // << " - sx=" << sx << " sy=" << sy << " ix=" << ix << " iy=" << iy; - int cx1 = clip.x(); - int cx2 = clip.x() + clip.width(); - int cy1 = clip.top(); - int cy2 = clip.y() + clip.height(); - - int tx1 = qRound(targetRect.left()); - int tx2 = qRound(targetRect.right()); - int ty1 = qRound(targetRect.top()); - int ty2 = qRound(targetRect.bottom()); - - if (tx2 < tx1) - qSwap(tx2, tx1); - - if (ty2 < ty1) - qSwap(ty2, ty1); - - if (tx1 < cx1) - tx1 = cx1; - - if (tx2 >= cx2) - tx2 = cx2; - - if (tx1 >= tx2) + QRect tr = targetRect.normalized().toRect(); + tr = tr.intersected(clip); + if (tr.isEmpty()) return; - - if (ty1 < cy1) - ty1 = cy1; - - if (ty2 >= cy2) - ty2 = cy2; - - if (ty1 >= ty2) - return; - - int h = ty2 - ty1; - int w = tx2 - tx1; - + const int tx1 = tr.left(); + const int ty1 = tr.top(); + int h = tr.height(); + int w = tr.width(); quint32 basex; quint32 srcy; if (sx < 0) { - int dstx = qFloor((tx1 + qreal(0.5) - targetRect.right()) * ix) + 1; + int dstx = qFloor((tx1 + qreal(0.5) - targetRect.right()) * sx * 65536) + 1; basex = quint32(srcRect.right() * 65536) + dstx; } else { - int dstx = qCeil((tx1 + qreal(0.5) - targetRect.left()) * ix) - 1; + int dstx = qCeil((tx1 + qreal(0.5) - targetRect.left()) * sx * 65536) - 1; basex = quint32(srcRect.left() * 65536) + dstx; } if (sy < 0) { - int dsty = qFloor((ty1 + qreal(0.5) - targetRect.bottom()) * iy) + 1; + int dsty = qFloor((ty1 + qreal(0.5) - targetRect.bottom()) * sy * 65536) + 1; srcy = quint32(srcRect.bottom() * 65536) + dsty; } else { - int dsty = qCeil((ty1 + qreal(0.5) - targetRect.top()) * iy) - 1; + int dsty = qCeil((ty1 + qreal(0.5) - targetRect.top()) * sy * 65536) - 1; srcy = quint32(srcRect.top() * 65536) + dsty; } @@ -185,11 +156,11 @@ template <typename T> void qt_scale_image_32bit(uchar *destPixels, int dbpl, const QRect &clip, T blender) { - qreal sx = targetRect.width() / (qreal) srcRect.width(); - qreal sy = targetRect.height() / (qreal) srcRect.height(); + qreal sx = srcRect.width() / (qreal) targetRect.width(); + qreal sy = srcRect.height() / (qreal) targetRect.height(); - int ix = 0x00010000 / sx; - int iy = 0x00010000 / sy; + const int ix = 0x00010000 * sx; + const int iy = 0x00010000 * sy; // qDebug() << "scale:" << endl // << " - target" << targetRect << endl @@ -197,60 +168,30 @@ template <typename T> void qt_scale_image_32bit(uchar *destPixels, int dbpl, // << " - clip" << clip << endl // << " - sx=" << sx << " sy=" << sy << " ix=" << ix << " iy=" << iy; - int cx1 = clip.x(); - int cx2 = clip.x() + clip.width(); - int cy1 = clip.top(); - int cy2 = clip.y() + clip.height(); - - int tx1 = qRound(targetRect.left()); - int tx2 = qRound(targetRect.right()); - int ty1 = qRound(targetRect.top()); - int ty2 = qRound(targetRect.bottom()); - - if (tx2 < tx1) - qSwap(tx2, tx1); - - if (ty2 < ty1) - qSwap(ty2, ty1); - - if (tx1 < cx1) - tx1 = cx1; - - if (tx2 >= cx2) - tx2 = cx2; - - if (tx1 >= tx2) - return; - - if (ty1 < cy1) - ty1 = cy1; - - if (ty2 >= cy2) - ty2 = cy2; - - if (ty1 >= ty2) - return; - - int h = ty2 - ty1; - int w = tx2 - tx1; - if (!w || !h) + QRect tr = targetRect.normalized().toRect(); + tr = tr.intersected(clip); + if (tr.isEmpty()) return; + const int tx1 = tr.left(); + const int ty1 = tr.top(); + int h = tr.height(); + int w = tr.width(); quint32 basex; quint32 srcy; if (sx < 0) { - int dstx = qFloor((tx1 + qreal(0.5) - targetRect.right()) * ix) + 1; + int dstx = qFloor((tx1 + qreal(0.5) - targetRect.right()) * sx * 65536) + 1; basex = quint32(srcRect.right() * 65536) + dstx; } else { - int dstx = qCeil((tx1 + qreal(0.5) - targetRect.left()) * ix) - 1; + int dstx = qCeil((tx1 + qreal(0.5) - targetRect.left()) * sx * 65536) - 1; basex = quint32(srcRect.left() * 65536) + dstx; } if (sy < 0) { - int dsty = qFloor((ty1 + qreal(0.5) - targetRect.bottom()) * iy) + 1; + int dsty = qFloor((ty1 + qreal(0.5) - targetRect.bottom()) * sy * 65536) + 1; srcy = quint32(srcRect.bottom() * 65536) + dsty; } else { - int dsty = qCeil((ty1 + qreal(0.5) - targetRect.top()) * iy) - 1; + int dsty = qCeil((ty1 + qreal(0.5) - targetRect.top()) * sy * 65536) - 1; srcy = quint32(srcRect.top() * 65536) + dsty; } diff --git a/src/gui/painting/qbrush.cpp b/src/gui/painting/qbrush.cpp index 860653cc4c..49b40aa756 100644 --- a/src/gui/painting/qbrush.cpp +++ b/src/gui/painting/qbrush.cpp @@ -111,7 +111,7 @@ Q_GUI_EXPORT QPixmap qt_pixmapForBrush(int brushStyle, bool invert) QString key = QLatin1String("$qt-brush$") % HexString<uint>(brushStyle) % QLatin1Char(invert ? '1' : '0'); - if (!QPixmapCache::find(key, pm)) { + if (!QPixmapCache::find(key, &pm)) { pm = QBitmap::fromData(QSize(8, 8), qt_patternForBrush(brushStyle, invert), QImage::Format_MonoLSB); QPixmapCache::insert(key, pm); @@ -545,9 +545,11 @@ QBrush::QBrush(const QBrush &other) */ QBrush::QBrush(const QGradient &gradient) { - Q_ASSERT_X(gradient.type() != QGradient::NoGradient, "QBrush::QBrush", - "QGradient should not be used directly, use the linear, radial\n" - "or conical gradients instead"); + if (Q_UNLIKELY(gradient.type() == QGradient::NoGradient)) { + d.reset(nullBrushInstance()); + d->ref.ref(); + return; + } const Qt::BrushStyle enum_table[] = { Qt::LinearGradientPattern, @@ -1138,11 +1140,11 @@ QDataStream &operator>>(QDataStream &s, QBrush &b) if (s.version() >= QDataStream::Qt_5_5) { QImage img; s >> img; - b.setTextureImage(qMove(img)); + b.setTextureImage(std::move(img)); } else { QPixmap pm; s >> pm; - b.setTexture(qMove(pm)); + b.setTexture(std::move(pm)); } } else if (style == Qt::LinearGradientPattern || style == Qt::RadialGradientPattern diff --git a/src/gui/painting/qbrush.h b/src/gui/painting/qbrush.h index aee51c526d..27d710eca6 100644 --- a/src/gui/painting/qbrush.h +++ b/src/gui/painting/qbrush.h @@ -80,10 +80,10 @@ public: ~QBrush(); QBrush &operator=(const QBrush &brush); #ifdef Q_COMPILER_RVALUE_REFS - inline QBrush &operator=(QBrush &&other) Q_DECL_NOEXCEPT + inline QBrush &operator=(QBrush &&other) noexcept { qSwap(d, other.d); return *this; } #endif - inline void swap(QBrush &other) Q_DECL_NOEXCEPT + inline void swap(QBrush &other) noexcept { qSwap(d, other.d); } operator QVariant() const; diff --git a/src/gui/painting/qcolor.cpp b/src/gui/painting/qcolor.cpp index ef3296a6d4..bb42660cf2 100644 --- a/src/gui/painting/qcolor.cpp +++ b/src/gui/painting/qcolor.cpp @@ -54,77 +54,77 @@ QT_BEGIN_NAMESPACE /*! \internal - If s[0..1] is a valid hex number, returns its integer value, + If s[0..n] is a valid hex number, returns its integer value, otherwise returns -1. */ -static inline int hex2int(const char *s) +static inline int hex2int(const char *s, int n) { - const int hi = QtMiscUtils::fromHex(s[0]); - if (hi < 0) + if (n < 0) return -1; - const int lo = QtMiscUtils::fromHex(s[1]); - if (lo < 0) - return -1; - return (hi << 4) | lo; -} - -/*! - \internal - If s is a valid hex digit, returns its integer value, - multiplied by 0x11, otherwise returns -1. - */ -static inline int hex2int(char s) -{ - const int h = QtMiscUtils::fromHex(s); - return h < 0 ? h : (h << 4) | h; + int result = 0; + for (; n > 0; --n) { + result = result * 16; + const int h = QtMiscUtils::fromHex(*s++); + if (h < 0) + return -1; + result += h; + } + return result; } -static bool get_hex_rgb(const char *name, size_t len, QRgb *rgb) +static bool get_hex_rgb(const char *name, size_t len, QRgba64 *rgb) { if (name[0] != '#') return false; name++; --len; int a, r, g, b; - a = 255; + a = 65535; if (len == 12) { - r = hex2int(name); - g = hex2int(name + 4); - b = hex2int(name + 8); + r = hex2int(name + 0, 4); + g = hex2int(name + 4, 4); + b = hex2int(name + 8, 4); } else if (len == 9) { - r = hex2int(name); - g = hex2int(name + 3); - b = hex2int(name + 6); + r = hex2int(name + 0, 3); + g = hex2int(name + 3, 3); + b = hex2int(name + 6, 3); + r = (r << 4) | (r >> 8); + g = (g << 4) | (g >> 8); + b = (b << 4) | (b >> 8); } else if (len == 8) { - a = hex2int(name); - r = hex2int(name + 2); - g = hex2int(name + 4); - b = hex2int(name + 6); + a = hex2int(name + 0, 2) * 0x101; + r = hex2int(name + 2, 2) * 0x101; + g = hex2int(name + 4, 2) * 0x101; + b = hex2int(name + 6, 2) * 0x101; } else if (len == 6) { - r = hex2int(name); - g = hex2int(name + 2); - b = hex2int(name + 4); + r = hex2int(name + 0, 2) * 0x101; + g = hex2int(name + 2, 2) * 0x101; + b = hex2int(name + 4, 2) * 0x101; } else if (len == 3) { - r = hex2int(name[0]); - g = hex2int(name[1]); - b = hex2int(name[2]); + r = hex2int(name + 0, 1) * 0x1111; + g = hex2int(name + 1, 1) * 0x1111; + b = hex2int(name + 2, 1) * 0x1111; } else { r = g = b = -1; } - if ((uint)r > 255 || (uint)g > 255 || (uint)b > 255 || (uint)a > 255) { + if ((uint)r > 65535 || (uint)g > 65535 || (uint)b > 65535 || (uint)a > 65535) { *rgb = 0; return false; } - *rgb = qRgba(r, g ,b, a); + *rgb = qRgba64(r, g ,b, a); return true; } bool qt_get_hex_rgb(const char *name, QRgb *rgb) { - return get_hex_rgb(name, qstrlen(name), rgb); + QRgba64 rgba64; + if (!get_hex_rgb(name, qstrlen(name), &rgba64)) + return false; + *rgb = rgba64.toArgb32(); + return true; } -static bool get_hex_rgb(const QChar *str, size_t len, QRgb *rgb) +static bool get_hex_rgb(const QChar *str, size_t len, QRgba64 *rgb) { if (len > 13) return false; @@ -541,7 +541,15 @@ static QStringList get_colornames() \section1 The HSL Color Model HSL is similar to HSV, however instead of the Value parameter, HSL - specifies a Lightness parameter. + specifies a Lightness parameter which maps somewhat differently to the + brightness of the color. + + Similarly, the HSL saturation value is not in general the same as the HSV + saturation value for the same color. hslSaturation() provides the color's + HSL saturation value, while saturation() and hsvSaturation() provides the + HSV saturation value. + + The hue value is defined to be the same in HSL and HSV. \section1 The CMYK Color Model @@ -645,7 +653,7 @@ static QStringList get_colornames() \sa isValid(), {QColor#Predefined Colors}{Predefined Colors} */ -QColor::QColor(Qt::GlobalColor color) Q_DECL_NOTHROW +QColor::QColor(Qt::GlobalColor color) noexcept { #define QRGB(r, g, b) \ QRgb(((0xffu << 24) | ((r & 0xff) << 16) | ((g & 0xff) << 8) | (b & 0xff))) @@ -720,7 +728,7 @@ QColor::QColor(Qt::GlobalColor color) Q_DECL_NOTHROW \sa fromRgb(), isValid() */ -QColor::QColor(QRgb color) Q_DECL_NOTHROW +QColor::QColor(QRgb color) noexcept { cspec = Rgb; ct.argb.alpha = 0xffff; @@ -738,7 +746,7 @@ QColor::QColor(QRgb color) Q_DECL_NOTHROW \sa fromRgba64() */ -QColor::QColor(QRgba64 rgba64) Q_DECL_NOTHROW +QColor::QColor(QRgba64 rgba64) noexcept { setRgba64(rgba64); } @@ -752,7 +760,7 @@ QColor::QColor(QRgba64 rgba64) Q_DECL_NOTHROW becomes a valid color by accident. */ -QColor::QColor(Spec spec) Q_DECL_NOTHROW +QColor::QColor(Spec spec) noexcept { switch (spec) { case Invalid: @@ -925,7 +933,7 @@ bool QColor::isValidColor(const QString &name) \overload \since 5.10 */ -bool QColor::isValidColor(QStringView name) Q_DECL_NOTHROW +bool QColor::isValidColor(QStringView name) noexcept { return name.size() && QColor().setColorFromString(name); } @@ -934,7 +942,7 @@ bool QColor::isValidColor(QStringView name) Q_DECL_NOTHROW \overload \since 5.8 */ -bool QColor::isValidColor(QLatin1String name) Q_DECL_NOTHROW +bool QColor::isValidColor(QLatin1String name) noexcept { return name.size() && QColor().setColorFromString(name); } @@ -948,9 +956,9 @@ bool QColor::setColorFromString(String name) } if (name[0] == QLatin1Char('#')) { - QRgb rgba; + QRgba64 rgba; if (get_hex_rgb(name.data(), name.size(), &rgba)) { - setRgba(rgba); + setRgba64(rgba); return true; } else { invalidate(); @@ -1098,7 +1106,7 @@ void QColor::setHsv(int h, int s, int v, int a) These components can be retrieved individually using the hslHueF(), hslSaturationF(), lightnessF() and alphaF() functions. - \sa setHsl() + \sa getHsl(), setHslF(), {QColor#The HSL Color Model}{The HSL Color Model} */ void QColor::getHslF(qreal *h, qreal *s, qreal *l, qreal *a) const { @@ -1128,7 +1136,7 @@ void QColor::getHslF(qreal *h, qreal *s, qreal *l, qreal *a) const These components can be retrieved individually using the hslHue(), hslSaturation(), lightness() and alpha() functions. - \sa setHsl() + \sa getHslF(), setHsl(), {QColor#The HSL Color Model}{The HSL Color Model} */ void QColor::getHsl(int *h, int *s, int *l, int *a) const { @@ -1322,7 +1330,7 @@ void QColor::setRgb(int r, int g, int b, int a) \sa setRgba(), rgb(), rgba64() */ -QRgb QColor::rgba() const Q_DECL_NOTHROW +QRgb QColor::rgba() const noexcept { if (cspec != Invalid && cspec != Rgb) return toRgb().rgba(); @@ -1334,7 +1342,7 @@ QRgb QColor::rgba() const Q_DECL_NOTHROW \sa rgba(), rgb(), setRgba64() */ -void QColor::setRgba(QRgb rgba) Q_DECL_NOTHROW +void QColor::setRgba(QRgb rgba) noexcept { cspec = Rgb; ct.argb.alpha = qAlpha(rgba) * 0x101; @@ -1354,7 +1362,7 @@ void QColor::setRgba(QRgb rgba) Q_DECL_NOTHROW \sa setRgba64(), rgba(), rgb() */ -QRgba64 QColor::rgba64() const Q_DECL_NOTHROW +QRgba64 QColor::rgba64() const noexcept { if (cspec != Invalid && cspec != Rgb) return toRgb().rgba64(); @@ -1366,9 +1374,9 @@ QRgba64 QColor::rgba64() const Q_DECL_NOTHROW Sets the RGB64 value to \a rgba, including its alpha. - \sa \setRgba(), rgba64() + \sa setRgba(), rgba64() */ -void QColor::setRgba64(QRgba64 rgba) Q_DECL_NOTHROW +void QColor::setRgba64(QRgba64 rgba) noexcept { cspec = Rgb; ct.argb.alpha = rgba.alpha(); @@ -1385,7 +1393,7 @@ void QColor::setRgba64(QRgba64 rgba) Q_DECL_NOTHROW \sa getRgb(), rgba() */ -QRgb QColor::rgb() const Q_DECL_NOTHROW +QRgb QColor::rgb() const noexcept { if (cspec != Invalid && cspec != Rgb) return toRgb().rgb(); @@ -1397,7 +1405,7 @@ QRgb QColor::rgb() const Q_DECL_NOTHROW Sets the RGB value to \a rgb. The alpha value is set to opaque. */ -void QColor::setRgb(QRgb rgb) Q_DECL_NOTHROW +void QColor::setRgb(QRgb rgb) noexcept { cspec = Rgb; ct.argb.alpha = 0xffff; @@ -1412,7 +1420,7 @@ void QColor::setRgb(QRgb rgb) Q_DECL_NOTHROW \sa setAlpha(), alphaF(), {QColor#Alpha-Blended Drawing}{Alpha-Blended Drawing} */ -int QColor::alpha() const Q_DECL_NOTHROW +int QColor::alpha() const noexcept { return ct.argb.alpha >> 8; } @@ -1434,7 +1442,7 @@ void QColor::setAlpha(int alpha) \sa setAlphaF(), alpha(), {QColor#Alpha-Blended Drawing}{Alpha-Blended Drawing} */ -qreal QColor::alphaF() const Q_DECL_NOTHROW +qreal QColor::alphaF() const noexcept { return ct.argb.alpha / qreal(USHRT_MAX); } /*! @@ -1457,7 +1465,7 @@ void QColor::setAlphaF(qreal alpha) \sa setRed(), redF(), getRgb() */ -int QColor::red() const Q_DECL_NOTHROW +int QColor::red() const noexcept { if (cspec != Invalid && cspec != Rgb) return toRgb().red(); @@ -1484,7 +1492,7 @@ void QColor::setRed(int red) \sa setGreen(), greenF(), getRgb() */ -int QColor::green() const Q_DECL_NOTHROW +int QColor::green() const noexcept { if (cspec != Invalid && cspec != Rgb) return toRgb().green(); @@ -1512,7 +1520,7 @@ void QColor::setGreen(int green) \sa setBlue(), blueF(), getRgb() */ -int QColor::blue() const Q_DECL_NOTHROW +int QColor::blue() const noexcept { if (cspec != Invalid && cspec != Rgb) return toRgb().blue(); @@ -1540,7 +1548,7 @@ void QColor::setBlue(int blue) \sa setRedF(), red(), getRgbF() */ -qreal QColor::redF() const Q_DECL_NOTHROW +qreal QColor::redF() const noexcept { if (cspec != Invalid && cspec != Rgb) return toRgb().redF(); @@ -1568,7 +1576,7 @@ void QColor::setRedF(qreal red) \sa setGreenF(), green(), getRgbF() */ -qreal QColor::greenF() const Q_DECL_NOTHROW +qreal QColor::greenF() const noexcept { if (cspec != Invalid && cspec != Rgb) return toRgb().greenF(); @@ -1596,7 +1604,7 @@ void QColor::setGreenF(qreal green) \sa setBlueF(), blue(), getRgbF() */ -qreal QColor::blueF() const Q_DECL_NOTHROW +qreal QColor::blueF() const noexcept { if (cspec != Invalid && cspec != Rgb) return toRgb().blueF(); @@ -1619,24 +1627,24 @@ void QColor::setBlueF(qreal blue) } /*! - Returns the hue color component of this color. + Returns the HSV hue color component of this color. The color is implicitly converted to HSV. - \sa hsvHue(), hueF(), getHsv(), {QColor#The HSV Color Model}{The HSV Color Model} + \sa hsvHue(), hslHue(), hueF(), getHsv(), {QColor#The HSV Color Model}{The HSV Color Model} */ -int QColor::hue() const Q_DECL_NOTHROW +int QColor::hue() const noexcept { return hsvHue(); } /*! - Returns the hue color component of this color. + Returns the HSV hue color component of this color. - \sa hueF(), getHsv(), {QColor#The HSV Color Model}{The HSV Color Model} + \sa hueF(), hslHue(), getHsv(), {QColor#The HSV Color Model}{The HSV Color Model} */ -int QColor::hsvHue() const Q_DECL_NOTHROW +int QColor::hsvHue() const noexcept { if (cspec != Invalid && cspec != Hsv) return toHsv().hue(); @@ -1644,25 +1652,25 @@ int QColor::hsvHue() const Q_DECL_NOTHROW } /*! - Returns the saturation color component of this color. + Returns the HSV saturation color component of this color. The color is implicitly converted to HSV. - \sa hsvSaturation(), saturationF(), getHsv(), {QColor#The HSV Color Model}{The HSV Color + \sa hsvSaturation(), hslSaturation(), saturationF(), getHsv(), {QColor#The HSV Color Model}{The HSV Color Model} */ -int QColor::saturation() const Q_DECL_NOTHROW +int QColor::saturation() const noexcept { return hsvSaturation(); } /*! - Returns the saturation color component of this color. + Returns the HSV saturation color component of this color. - \sa saturationF(), getHsv(), {QColor#The HSV Color Model}{The HSV Color Model} + \sa saturationF(), hslSaturation(), getHsv(), {QColor#The HSV Color Model}{The HSV Color Model} */ -int QColor::hsvSaturation() const Q_DECL_NOTHROW +int QColor::hsvSaturation() const noexcept { if (cspec != Invalid && cspec != Hsv) return toHsv().saturation(); @@ -1674,7 +1682,7 @@ int QColor::hsvSaturation() const Q_DECL_NOTHROW \sa valueF(), getHsv(), {QColor#The HSV Color Model}{The HSV Color Model} */ -int QColor::value() const Q_DECL_NOTHROW +int QColor::value() const noexcept { if (cspec != Invalid && cspec != Hsv) return toHsv().value(); @@ -1682,13 +1690,13 @@ int QColor::value() const Q_DECL_NOTHROW } /*! - Returns the hue color component of this color. + Returns the HSV hue color component of this color. The color is implicitly converted to HSV. - \sa hsvHueF(), hue(), getHsvF(), {QColor#The HSV Color Model}{The HSV Color Model} + \sa hsvHueF(), hslHueF(), hue(), getHsvF(), {QColor#The HSV Color Model}{The HSV Color Model} */ -qreal QColor::hueF() const Q_DECL_NOTHROW +qreal QColor::hueF() const noexcept { return hsvHueF(); } @@ -1696,10 +1704,10 @@ qreal QColor::hueF() const Q_DECL_NOTHROW /*! Returns the hue color component of this color. - \sa hue(), getHsvF(), {QColor#The HSV Color Model}{The HSV Color + \sa hue(), hslHueF(), getHsvF(), {QColor#The HSV Color Model}{The HSV Color Model} */ -qreal QColor::hsvHueF() const Q_DECL_NOTHROW +qreal QColor::hsvHueF() const noexcept { if (cspec != Invalid && cspec != Hsv) return toHsv().hueF(); @@ -1707,24 +1715,24 @@ qreal QColor::hsvHueF() const Q_DECL_NOTHROW } /*! - Returns the saturation color component of this color. + Returns the HSV saturation color component of this color. The color is implicitly converted to HSV. - \sa hsvSaturationF(), saturation(), getHsvF(), {QColor#The HSV Color Model}{The HSV Color + \sa hsvSaturationF(), hslSaturationF(), saturation(), getHsvF(), {QColor#The HSV Color Model}{The HSV Color Model} */ -qreal QColor::saturationF() const Q_DECL_NOTHROW +qreal QColor::saturationF() const noexcept { return hsvSaturationF(); } /*! - Returns the saturation color component of this color. + Returns the HSV saturation color component of this color. - \sa saturation(), getHsvF(), {QColor#The HSV Color Model}{The HSV Color Model} + \sa saturation(), hslSaturationF(), getHsvF(), {QColor#The HSV Color Model}{The HSV Color Model} */ -qreal QColor::hsvSaturationF() const Q_DECL_NOTHROW +qreal QColor::hsvSaturationF() const noexcept { if (cspec != Invalid && cspec != Hsv) return toHsv().saturationF(); @@ -1736,7 +1744,7 @@ qreal QColor::hsvSaturationF() const Q_DECL_NOTHROW \sa value(), getHsvF(), {QColor#The HSV Color Model}{The HSV Color Model} */ -qreal QColor::valueF() const Q_DECL_NOTHROW +qreal QColor::valueF() const noexcept { if (cspec != Invalid && cspec != Hsv) return toHsv().valueF(); @@ -1746,11 +1754,11 @@ qreal QColor::valueF() const Q_DECL_NOTHROW /*! \since 4.6 - Returns the hue color component of this color. + Returns the HSL hue color component of this color. - \sa getHslF(), getHsl() + \sa hslHueF(), hsvHue(), getHsl(), {QColor#The HSL Color Model}{The HSL Color Model} */ -int QColor::hslHue() const Q_DECL_NOTHROW +int QColor::hslHue() const noexcept { if (cspec != Invalid && cspec != Hsl) return toHsl().hslHue(); @@ -1760,11 +1768,11 @@ int QColor::hslHue() const Q_DECL_NOTHROW /*! \since 4.6 - Returns the saturation color component of this color. + Returns the HSL saturation color component of this color. - \sa saturationF(), getHsv(), {QColor#The HSV Color Model}{The HSV Color Model} + \sa hslSaturationF(), hsvSaturation(), getHsl(), {QColor#The HSL Color Model}{The HSL Color Model} */ -int QColor::hslSaturation() const Q_DECL_NOTHROW +int QColor::hslSaturation() const noexcept { if (cspec != Invalid && cspec != Hsl) return toHsl().hslSaturation(); @@ -1778,7 +1786,7 @@ int QColor::hslSaturation() const Q_DECL_NOTHROW \sa lightnessF(), getHsl() */ -int QColor::lightness() const Q_DECL_NOTHROW +int QColor::lightness() const noexcept { if (cspec != Invalid && cspec != Hsl) return toHsl().lightness(); @@ -1788,11 +1796,11 @@ int QColor::lightness() const Q_DECL_NOTHROW /*! \since 4.6 - Returns the hue color component of this color. + Returns the HSL hue color component of this color. - \sa hue(), getHslF() + \sa hslHue(), hsvHueF(), getHslF() */ -qreal QColor::hslHueF() const Q_DECL_NOTHROW +qreal QColor::hslHueF() const noexcept { if (cspec != Invalid && cspec != Hsl) return toHsl().hslHueF(); @@ -1802,11 +1810,11 @@ qreal QColor::hslHueF() const Q_DECL_NOTHROW /*! \since 4.6 - Returns the saturation color component of this color. + Returns the HSL saturation color component of this color. - \sa saturationF(), getHslF() + \sa hslSaturation(), hsvSaturationF(), getHslF(), {QColor#The HSL Color Model}{The HSL Color Model} */ -qreal QColor::hslSaturationF() const Q_DECL_NOTHROW +qreal QColor::hslSaturationF() const noexcept { if (cspec != Invalid && cspec != Hsl) return toHsl().hslSaturationF(); @@ -1820,7 +1828,7 @@ qreal QColor::hslSaturationF() const Q_DECL_NOTHROW \sa value(), getHslF() */ -qreal QColor::lightnessF() const Q_DECL_NOTHROW +qreal QColor::lightnessF() const noexcept { if (cspec != Invalid && cspec != Hsl) return toHsl().lightnessF(); @@ -1832,7 +1840,7 @@ qreal QColor::lightnessF() const Q_DECL_NOTHROW \sa cyanF(), getCmyk(), {QColor#The CMYK Color Model}{The CMYK Color Model} */ -int QColor::cyan() const Q_DECL_NOTHROW +int QColor::cyan() const noexcept { if (cspec != Invalid && cspec != Cmyk) return toCmyk().cyan(); @@ -1844,7 +1852,7 @@ int QColor::cyan() const Q_DECL_NOTHROW \sa magentaF(), getCmyk(), {QColor#The CMYK Color Model}{The CMYK Color Model} */ -int QColor::magenta() const Q_DECL_NOTHROW +int QColor::magenta() const noexcept { if (cspec != Invalid && cspec != Cmyk) return toCmyk().magenta(); @@ -1856,7 +1864,7 @@ int QColor::magenta() const Q_DECL_NOTHROW \sa yellowF(), getCmyk(), {QColor#The CMYK Color Model}{The CMYK Color Model} */ -int QColor::yellow() const Q_DECL_NOTHROW +int QColor::yellow() const noexcept { if (cspec != Invalid && cspec != Cmyk) return toCmyk().yellow(); @@ -1869,7 +1877,7 @@ int QColor::yellow() const Q_DECL_NOTHROW \sa blackF(), getCmyk(), {QColor#The CMYK Color Model}{The CMYK Color Model} */ -int QColor::black() const Q_DECL_NOTHROW +int QColor::black() const noexcept { if (cspec != Invalid && cspec != Cmyk) return toCmyk().black(); @@ -1881,7 +1889,7 @@ int QColor::black() const Q_DECL_NOTHROW \sa cyan(), getCmykF(), {QColor#The CMYK Color Model}{The CMYK Color Model} */ -qreal QColor::cyanF() const Q_DECL_NOTHROW +qreal QColor::cyanF() const noexcept { if (cspec != Invalid && cspec != Cmyk) return toCmyk().cyanF(); @@ -1893,7 +1901,7 @@ qreal QColor::cyanF() const Q_DECL_NOTHROW \sa magenta(), getCmykF(), {QColor#The CMYK Color Model}{The CMYK Color Model} */ -qreal QColor::magentaF() const Q_DECL_NOTHROW +qreal QColor::magentaF() const noexcept { if (cspec != Invalid && cspec != Cmyk) return toCmyk().magentaF(); @@ -1905,7 +1913,7 @@ qreal QColor::magentaF() const Q_DECL_NOTHROW \sa yellow(), getCmykF(), {QColor#The CMYK Color Model}{The CMYK Color Model} */ -qreal QColor::yellowF() const Q_DECL_NOTHROW +qreal QColor::yellowF() const noexcept { if (cspec != Invalid && cspec != Cmyk) return toCmyk().yellowF(); @@ -1917,7 +1925,7 @@ qreal QColor::yellowF() const Q_DECL_NOTHROW \sa black(), getCmykF(), {QColor#The CMYK Color Model}{The CMYK Color Model} */ -qreal QColor::blackF() const Q_DECL_NOTHROW +qreal QColor::blackF() const noexcept { if (cspec != Invalid && cspec != Cmyk) return toCmyk().blackF(); @@ -1929,7 +1937,7 @@ qreal QColor::blackF() const Q_DECL_NOTHROW \sa fromRgb(), convertTo(), isValid() */ -QColor QColor::toRgb() const Q_DECL_NOTHROW +QColor QColor::toRgb() const noexcept { if (!isValid() || cspec == Rgb) return *this; @@ -2075,7 +2083,7 @@ QColor QColor::toRgb() const Q_DECL_NOTHROW \sa fromHsv(), convertTo(), isValid(), {QColor#The HSV Color Model}{The HSV Color Model} */ -QColor QColor::toHsv() const Q_DECL_NOTHROW +QColor QColor::toHsv() const noexcept { if (!isValid() || cspec == Hsv) return *this; @@ -2124,9 +2132,9 @@ QColor QColor::toHsv() const Q_DECL_NOTHROW /*! Creates and returns an HSL QColor based on this color. - \sa fromHsl(), convertTo(), isValid() + \sa fromHsl(), convertTo(), isValid(), {QColor#The HSL Color Model}{The HSL Color Model} */ -QColor QColor::toHsl() const Q_DECL_NOTHROW +QColor QColor::toHsl() const noexcept { if (!isValid() || cspec == Hsl) return *this; @@ -2182,7 +2190,7 @@ QColor QColor::toHsl() const Q_DECL_NOTHROW \sa fromCmyk(), convertTo(), isValid(), {QColor#The CMYK Color Model}{The CMYK Color Model} */ -QColor QColor::toCmyk() const Q_DECL_NOTHROW +QColor QColor::toCmyk() const noexcept { if (!isValid() || cspec == Cmyk) return *this; @@ -2193,32 +2201,37 @@ QColor QColor::toCmyk() const Q_DECL_NOTHROW color.cspec = Cmyk; color.ct.acmyk.alpha = ct.argb.alpha; - // rgb -> cmy - const qreal r = ct.argb.red / qreal(USHRT_MAX); - const qreal g = ct.argb.green / qreal(USHRT_MAX); - const qreal b = ct.argb.blue / qreal(USHRT_MAX); - qreal c = qreal(1.0) - r; - qreal m = qreal(1.0) - g; - qreal y = qreal(1.0) - b; - - // cmy -> cmyk - const qreal k = qMin(c, qMin(m, y)); - - if (!qFuzzyIsNull(k - 1)) { + if (!ct.argb.red && !ct.argb.green && !ct.argb.blue) { + // Avoid div-by-0 below + color.ct.acmyk.cyan = 0; + color.ct.acmyk.magenta = 0; + color.ct.acmyk.yellow = 0; + color.ct.acmyk.black = USHRT_MAX; + } else { + // rgb -> cmy + const qreal r = ct.argb.red / qreal(USHRT_MAX); + const qreal g = ct.argb.green / qreal(USHRT_MAX); + const qreal b = ct.argb.blue / qreal(USHRT_MAX); + qreal c = qreal(1.0) - r; + qreal m = qreal(1.0) - g; + qreal y = qreal(1.0) - b; + + // cmy -> cmyk + const qreal k = qMin(c, qMin(m, y)); c = (c - k) / (qreal(1.0) - k); m = (m - k) / (qreal(1.0) - k); y = (y - k) / (qreal(1.0) - k); - } - color.ct.acmyk.cyan = qRound(c * USHRT_MAX); - color.ct.acmyk.magenta = qRound(m * USHRT_MAX); - color.ct.acmyk.yellow = qRound(y * USHRT_MAX); - color.ct.acmyk.black = qRound(k * USHRT_MAX); + color.ct.acmyk.cyan = qRound(c * USHRT_MAX); + color.ct.acmyk.magenta = qRound(m * USHRT_MAX); + color.ct.acmyk.yellow = qRound(y * USHRT_MAX); + color.ct.acmyk.black = qRound(k * USHRT_MAX); + } return color; } -QColor QColor::convertTo(QColor::Spec colorSpec) const Q_DECL_NOTHROW +QColor QColor::convertTo(QColor::Spec colorSpec) const noexcept { if (colorSpec == cspec) return *this; @@ -2249,7 +2262,7 @@ QColor QColor::convertTo(QColor::Spec colorSpec) const Q_DECL_NOTHROW \sa fromRgba(), fromRgbF(), toRgb(), isValid() */ -QColor QColor::fromRgb(QRgb rgb) Q_DECL_NOTHROW +QColor QColor::fromRgb(QRgb rgb) noexcept { return fromRgb(qRed(rgb), qGreen(rgb), qBlue(rgb)); } @@ -2265,7 +2278,7 @@ QColor QColor::fromRgb(QRgb rgb) Q_DECL_NOTHROW \sa fromRgb(), fromRgba64(), isValid() */ -QColor QColor::fromRgba(QRgb rgba) Q_DECL_NOTHROW +QColor QColor::fromRgba(QRgb rgba) noexcept { return fromRgb(qRed(rgba), qGreen(rgba), qBlue(rgba), qAlpha(rgba)); } @@ -2338,7 +2351,7 @@ QColor QColor::fromRgbF(qreal r, qreal g, qreal b, qreal a) \sa fromRgb(), fromRgbF(), toRgb(), isValid() */ -QColor QColor::fromRgba64(ushort r, ushort g, ushort b, ushort a) Q_DECL_NOTHROW +QColor QColor::fromRgba64(ushort r, ushort g, ushort b, ushort a) noexcept { QColor color; color.setRgba64(qRgba64(r, g, b, a)); @@ -2353,7 +2366,7 @@ QColor QColor::fromRgba64(ushort r, ushort g, ushort b, ushort a) Q_DECL_NOTHROW \sa fromRgb(), fromRgbF(), toRgb(), isValid() */ -QColor QColor::fromRgba64(QRgba64 rgba64) Q_DECL_NOTHROW +QColor QColor::fromRgba64(QRgba64 rgba64) noexcept { QColor color; color.setRgba64(rgba64); @@ -2431,7 +2444,7 @@ QColor QColor::fromHsvF(qreal h, qreal s, qreal v, qreal a) The value of \a s, \a l, and \a a must all be in the range 0-255; the value of \a h must be in the range 0-359. - \sa toHsl(), fromHslF(), isValid() + \sa toHsl(), fromHslF(), isValid(), {QColor#The HSL Color Model}{The HSL Color Model} */ QColor QColor::fromHsl(int h, int s, int l, int a) { @@ -2463,7 +2476,7 @@ QColor QColor::fromHsl(int h, int s, int l, int a) All the values must be in the range 0.0-1.0. - \sa toHsl(), fromHsl(), isValid() + \sa toHsl(), fromHsl(), isValid(), {QColor#The HSL Color Model}{The HSL Color Model} */ QColor QColor::fromHslF(qreal h, qreal s, qreal l, qreal a) { @@ -2695,18 +2708,13 @@ QColor QColor::fromCmykF(qreal c, qreal m, qreal y, qreal k, qreal a) recommend using the darker() function for this purpose. If the \a factor is 0 or negative, the return value is unspecified. - The function converts the current RGB color to HSV, multiplies the value - (V) component by \a factor and converts the color back to RGB. + The function converts the current color to HSV, multiplies the value + (V) component by \a factor and converts the color back to it's original + color spec. \sa darker(), isValid() */ - -/*! - \obsolete - - Use lighter(\a factor) instead. -*/ -QColor QColor::light(int factor) const Q_DECL_NOTHROW +QColor QColor::lighter(int factor) const noexcept { if (factor <= 0) // invalid lightness factor return *this; @@ -2745,18 +2753,13 @@ QColor QColor::light(int factor) const Q_DECL_NOTHROW but we recommend using the lighter() function for this purpose. If the \a factor is 0 or negative, the return value is unspecified. - The function converts the current RGB color to HSV, divides the value (V) - component by \a factor and converts the color back to RGB. + The function converts the current color to HSV, divides the value (V) + component by \a factor and converts the color back to it's original + color spec. \sa lighter(), isValid() */ - -/*! - \obsolete - - Use darker(\a factor) instead. -*/ -QColor QColor::dark(int factor) const Q_DECL_NOTHROW +QColor QColor::darker(int factor) const noexcept { if (factor <= 0) // invalid darkness factor return *this; @@ -2770,11 +2773,33 @@ QColor QColor::dark(int factor) const Q_DECL_NOTHROW return hsv.convertTo(cspec); } +#if QT_DEPRECATED_SINCE(5, 13) +/*! + \obsolete + + Use lighter(\a factor) instead. +*/ +QColor QColor::light(int factor) const noexcept +{ + return lighter(factor); +} + +/*! + \obsolete + + Use darker(\a factor) instead. +*/ +QColor QColor::dark(int factor) const noexcept +{ + return darker(factor); +} +#endif + #if QT_VERSION < QT_VERSION_CHECK(6,0,0) /*! Assigns a copy of \a color to this color, and returns a reference to it. */ -QColor &QColor::operator=(const QColor &color) Q_DECL_NOTHROW +QColor &QColor::operator=(const QColor &color) noexcept { cspec = color.cspec; ct.argb = color.ct.argb; @@ -2785,7 +2810,7 @@ QColor &QColor::operator=(const QColor &color) Q_DECL_NOTHROW /*! \overload Assigns a copy of \a color and returns a reference to this color. */ -QColor &QColor::operator=(Qt::GlobalColor color) Q_DECL_NOTHROW +QColor &QColor::operator=(Qt::GlobalColor color) noexcept { return operator=(QColor(color)); } @@ -2794,7 +2819,7 @@ QColor &QColor::operator=(Qt::GlobalColor color) Q_DECL_NOTHROW Returns \c true if this color has the same RGB and alpha values as \a color; otherwise returns \c false. */ -bool QColor::operator==(const QColor &color) const Q_DECL_NOTHROW +bool QColor::operator==(const QColor &color) const noexcept { if (cspec == Hsl && cspec == color.cspec) { return (ct.argb.alpha == color.ct.argb.alpha @@ -2821,7 +2846,7 @@ bool QColor::operator==(const QColor &color) const Q_DECL_NOTHROW Returns \c true if this color has a different RGB and alpha values from \a color; otherwise returns \c false. */ -bool QColor::operator!=(const QColor &color) const Q_DECL_NOTHROW +bool QColor::operator!=(const QColor &color) const noexcept { return !operator==(color); } @@ -2838,7 +2863,7 @@ QColor::operator QVariant() const Marks the color as invalid and sets all components to zero (alpha is set to fully opaque for compatibility with Qt 3). */ -void QColor::invalidate() Q_DECL_NOTHROW +void QColor::invalidate() noexcept { cspec = Invalid; ct.argb.alpha = USHRT_MAX; diff --git a/src/gui/painting/qcolor.h b/src/gui/painting/qcolor.h index a9b05ae7e3..cbc8b98f9c 100644 --- a/src/gui/painting/qcolor.h +++ b/src/gui/painting/qcolor.h @@ -67,32 +67,32 @@ public: enum Spec { Invalid, Rgb, Hsv, Cmyk, Hsl }; enum NameFormat { HexRgb, HexArgb }; - inline QColor() Q_DECL_NOTHROW; - QColor(Qt::GlobalColor color) Q_DECL_NOTHROW; + inline QColor() noexcept; + QColor(Qt::GlobalColor color) noexcept; inline QColor(int r, int g, int b, int a = 255); - QColor(QRgb rgb) Q_DECL_NOTHROW; - QColor(QRgba64 rgba64) Q_DECL_NOTHROW; + QColor(QRgb rgb) noexcept; + QColor(QRgba64 rgba64) noexcept; #if QT_STRINGVIEW_LEVEL < 2 inline QColor(const QString& name); #endif explicit inline QColor(QStringView name); inline QColor(const char *aname) : QColor(QLatin1String(aname)) {} inline QColor(QLatin1String name); - QColor(Spec spec) Q_DECL_NOTHROW; + QColor(Spec spec) noexcept; #if QT_VERSION < QT_VERSION_CHECK(6,0,0) - inline QColor(const QColor &color) Q_DECL_NOTHROW; // ### Qt 6: remove all of these, the trivial ones are fine. + inline QColor(const QColor &color) noexcept; // ### Qt 6: remove all of these, the trivial ones are fine. # ifdef Q_COMPILER_RVALUE_REFS - QColor(QColor &&other) Q_DECL_NOTHROW : cspec(other.cspec), ct(other.ct) {} - QColor &operator=(QColor &&other) Q_DECL_NOTHROW + QColor(QColor &&other) noexcept : cspec(other.cspec), ct(other.ct) {} + QColor &operator=(QColor &&other) noexcept { cspec = other.cspec; ct = other.ct; return *this; } # endif - QColor &operator=(const QColor &) Q_DECL_NOTHROW; + QColor &operator=(const QColor &) noexcept; #endif // Qt < 6 - QColor &operator=(Qt::GlobalColor color) Q_DECL_NOTHROW; + QColor &operator=(Qt::GlobalColor color) noexcept; - bool isValid() const Q_DECL_NOTHROW; + bool isValid() const noexcept; // ### Qt 6: merge overloads QString name() const; @@ -106,25 +106,25 @@ public: static QStringList colorNames(); - inline Spec spec() const Q_DECL_NOTHROW + inline Spec spec() const noexcept { return cspec; } - int alpha() const Q_DECL_NOTHROW; + int alpha() const noexcept; void setAlpha(int alpha); - qreal alphaF() const Q_DECL_NOTHROW; + qreal alphaF() const noexcept; void setAlphaF(qreal alpha); - int red() const Q_DECL_NOTHROW; - int green() const Q_DECL_NOTHROW; - int blue() const Q_DECL_NOTHROW; + int red() const noexcept; + int green() const noexcept; + int blue() const noexcept; void setRed(int red); void setGreen(int green); void setBlue(int blue); - qreal redF() const Q_DECL_NOTHROW; - qreal greenF() const Q_DECL_NOTHROW; - qreal blueF() const Q_DECL_NOTHROW; + qreal redF() const noexcept; + qreal greenF() const noexcept; + qreal blueF() const noexcept; void setRedF(qreal red); void setGreenF(qreal green); void setBlueF(qreal blue); @@ -135,26 +135,26 @@ public: void getRgbF(qreal *r, qreal *g, qreal *b, qreal *a = nullptr) const; void setRgbF(qreal r, qreal g, qreal b, qreal a = 1.0); - QRgba64 rgba64() const Q_DECL_NOTHROW; - void setRgba64(QRgba64 rgba) Q_DECL_NOTHROW; + QRgba64 rgba64() const noexcept; + void setRgba64(QRgba64 rgba) noexcept; - QRgb rgba() const Q_DECL_NOTHROW; - void setRgba(QRgb rgba) Q_DECL_NOTHROW; + QRgb rgba() const noexcept; + void setRgba(QRgb rgba) noexcept; - QRgb rgb() const Q_DECL_NOTHROW; - void setRgb(QRgb rgb) Q_DECL_NOTHROW; + QRgb rgb() const noexcept; + void setRgb(QRgb rgb) noexcept; - int hue() const Q_DECL_NOTHROW; // 0 <= hue < 360 - int saturation() const Q_DECL_NOTHROW; - int hsvHue() const Q_DECL_NOTHROW; // 0 <= hue < 360 - int hsvSaturation() const Q_DECL_NOTHROW; - int value() const Q_DECL_NOTHROW; + int hue() const noexcept; // 0 <= hue < 360 + int saturation() const noexcept; + int hsvHue() const noexcept; // 0 <= hue < 360 + int hsvSaturation() const noexcept; + int value() const noexcept; - qreal hueF() const Q_DECL_NOTHROW; // 0.0 <= hueF < 360.0 - qreal saturationF() const Q_DECL_NOTHROW; - qreal hsvHueF() const Q_DECL_NOTHROW; // 0.0 <= hueF < 360.0 - qreal hsvSaturationF() const Q_DECL_NOTHROW; - qreal valueF() const Q_DECL_NOTHROW; + qreal hueF() const noexcept; // 0.0 <= hueF < 360.0 + qreal saturationF() const noexcept; + qreal hsvHueF() const noexcept; // 0.0 <= hueF < 360.0 + qreal hsvSaturationF() const noexcept; + qreal valueF() const noexcept; void getHsv(int *h, int *s, int *v, int *a = nullptr) const; void setHsv(int h, int s, int v, int a = 255); @@ -162,15 +162,15 @@ public: void getHsvF(qreal *h, qreal *s, qreal *v, qreal *a = nullptr) const; void setHsvF(qreal h, qreal s, qreal v, qreal a = 1.0); - int cyan() const Q_DECL_NOTHROW; - int magenta() const Q_DECL_NOTHROW; - int yellow() const Q_DECL_NOTHROW; - int black() const Q_DECL_NOTHROW; + int cyan() const noexcept; + int magenta() const noexcept; + int yellow() const noexcept; + int black() const noexcept; - qreal cyanF() const Q_DECL_NOTHROW; - qreal magentaF() const Q_DECL_NOTHROW; - qreal yellowF() const Q_DECL_NOTHROW; - qreal blackF() const Q_DECL_NOTHROW; + qreal cyanF() const noexcept; + qreal magentaF() const noexcept; + qreal yellowF() const noexcept; + qreal blackF() const noexcept; void getCmyk(int *c, int *m, int *y, int *k, int *a = nullptr); // ### Qt 6: remove void getCmyk(int *c, int *m, int *y, int *k, int *a = nullptr) const; @@ -180,13 +180,13 @@ public: void getCmykF(qreal *c, qreal *m, qreal *y, qreal *k, qreal *a = nullptr) const; void setCmykF(qreal c, qreal m, qreal y, qreal k, qreal a = 1.0); - int hslHue() const Q_DECL_NOTHROW; // 0 <= hue < 360 - int hslSaturation() const Q_DECL_NOTHROW; - int lightness() const Q_DECL_NOTHROW; + int hslHue() const noexcept; // 0 <= hue < 360 + int hslSaturation() const noexcept; + int lightness() const noexcept; - qreal hslHueF() const Q_DECL_NOTHROW; // 0.0 <= hueF < 360.0 - qreal hslSaturationF() const Q_DECL_NOTHROW; - qreal lightnessF() const Q_DECL_NOTHROW; + qreal hslHueF() const noexcept; // 0.0 <= hueF < 360.0 + qreal hslSaturationF() const noexcept; + qreal lightnessF() const noexcept; void getHsl(int *h, int *s, int *l, int *a = nullptr) const; void setHsl(int h, int s, int l, int a = 255); @@ -194,21 +194,21 @@ public: void getHslF(qreal *h, qreal *s, qreal *l, qreal *a = nullptr) const; void setHslF(qreal h, qreal s, qreal l, qreal a = 1.0); - QColor toRgb() const Q_DECL_NOTHROW; - QColor toHsv() const Q_DECL_NOTHROW; - QColor toCmyk() const Q_DECL_NOTHROW; - QColor toHsl() const Q_DECL_NOTHROW; + QColor toRgb() const noexcept; + QColor toHsv() const noexcept; + QColor toCmyk() const noexcept; + QColor toHsl() const noexcept; - Q_REQUIRED_RESULT QColor convertTo(Spec colorSpec) const Q_DECL_NOTHROW; + Q_REQUIRED_RESULT QColor convertTo(Spec colorSpec) const noexcept; - static QColor fromRgb(QRgb rgb) Q_DECL_NOTHROW; - static QColor fromRgba(QRgb rgba) Q_DECL_NOTHROW; + static QColor fromRgb(QRgb rgb) noexcept; + static QColor fromRgba(QRgb rgba) noexcept; static QColor fromRgb(int r, int g, int b, int a = 255); static QColor fromRgbF(qreal r, qreal g, qreal b, qreal a = 1.0); - static QColor fromRgba64(ushort r, ushort g, ushort b, ushort a = USHRT_MAX) Q_DECL_NOTHROW; - static QColor fromRgba64(QRgba64 rgba) Q_DECL_NOTHROW; + static QColor fromRgba64(ushort r, ushort g, ushort b, ushort a = USHRT_MAX) noexcept; + static QColor fromRgba64(QRgba64 rgba) noexcept; static QColor fromHsv(int h, int s, int v, int a = 255); static QColor fromHsvF(qreal h, qreal s, qreal v, qreal a = 1.0); @@ -219,25 +219,29 @@ public: static QColor fromHsl(int h, int s, int l, int a = 255); static QColor fromHslF(qreal h, qreal s, qreal l, qreal a = 1.0); - Q_REQUIRED_RESULT QColor light(int f = 150) const Q_DECL_NOTHROW; - Q_REQUIRED_RESULT QColor lighter(int f = 150) const Q_DECL_NOTHROW; - Q_REQUIRED_RESULT QColor dark(int f = 200) const Q_DECL_NOTHROW; - Q_REQUIRED_RESULT QColor darker(int f = 200) const Q_DECL_NOTHROW; +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use QColor::lighter() instead") + Q_REQUIRED_RESULT QColor light(int f = 150) const noexcept; + QT_DEPRECATED_X("Use QColor::darker() instead") + Q_REQUIRED_RESULT QColor dark(int f = 200) const noexcept; +#endif + Q_REQUIRED_RESULT QColor lighter(int f = 150) const noexcept; + Q_REQUIRED_RESULT QColor darker(int f = 200) const noexcept; - bool operator==(const QColor &c) const Q_DECL_NOTHROW; - bool operator!=(const QColor &c) const Q_DECL_NOTHROW; + bool operator==(const QColor &c) const noexcept; + bool operator!=(const QColor &c) const noexcept; operator QVariant() const; #if QT_STRINGVIEW_LEVEL < 2 static bool isValidColor(const QString &name); #endif - static bool isValidColor(QStringView) Q_DECL_NOTHROW; - static bool isValidColor(QLatin1String) Q_DECL_NOTHROW; + static bool isValidColor(QStringView) noexcept; + static bool isValidColor(QLatin1String) noexcept; private: - void invalidate() Q_DECL_NOTHROW; + void invalidate() noexcept; template <typename String> bool setColorFromString(String name); @@ -282,7 +286,7 @@ private: }; Q_DECLARE_TYPEINFO(QColor, QT_VERSION >= QT_VERSION_CHECK(6,0,0) ? Q_MOVABLE_TYPE : Q_RELOCATABLE_TYPE); -inline QColor::QColor() Q_DECL_NOTHROW +inline QColor::QColor() noexcept { invalidate(); } inline QColor::QColor(int r, int g, int b, int a) @@ -300,20 +304,14 @@ inline QColor::QColor(const QString& aname) #endif #if QT_VERSION < QT_VERSION_CHECK(6,0,0) -inline QColor::QColor(const QColor &acolor) Q_DECL_NOTHROW +inline QColor::QColor(const QColor &acolor) noexcept : cspec(acolor.cspec) { ct.argb = acolor.ct.argb; } #endif -inline bool QColor::isValid() const Q_DECL_NOTHROW +inline bool QColor::isValid() const noexcept { return cspec != Invalid; } -inline QColor QColor::lighter(int f) const Q_DECL_NOTHROW -{ return light(f); } - -inline QColor QColor::darker(int f) const Q_DECL_NOTHROW -{ return dark(f); } - QT_END_NAMESPACE #endif // QCOLOR_H diff --git a/src/gui/painting/qcolormatrix_p.h b/src/gui/painting/qcolormatrix_p.h new file mode 100644 index 0000000000..3d1dca6222 --- /dev/null +++ b/src/gui/painting/qcolormatrix_p.h @@ -0,0 +1,214 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QCOLORMATRIX_H +#define QCOLORMATRIX_H + +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// + +#include <QtGui/qtguiglobal.h> +#include <cmath> + +QT_BEGIN_NAMESPACE + +// An abstract 3 value color +class QColorVector +{ +public: + QColorVector() = default; + constexpr QColorVector(float x, float y, float z) : x(x), y(y), z(z), _unused(0.0f) { } + float x; // X, x or red + float y; // Y, y or green + float z; // Z, Y or blue + float _unused; + + friend inline bool operator==(const QColorVector &v1, const QColorVector &v2); + friend inline bool operator!=(const QColorVector &v1, const QColorVector &v2); + + static constexpr QColorVector null() { return QColorVector(0.0f, 0.0f, 0.0f); } + // Common whitepoints on normalized XYZ form: + static constexpr QColorVector D50() { return QColorVector(0.96421f, 1.0f, 0.82519f); } + static constexpr QColorVector D65() { return QColorVector(0.95043f, 1.0f, 1.08890f); } +}; + +inline bool operator==(const QColorVector &v1, const QColorVector &v2) +{ + return (std::abs(v1.x - v2.x) < (1.0f / 2048.0f)) + && (std::abs(v1.y - v2.y) < (1.0f / 2048.0f)) + && (std::abs(v1.z - v2.z) < (1.0f / 2048.0f)); +} + +inline bool operator!=(const QColorVector &v1, const QColorVector &v2) +{ + return !(v1 == v2); +} + + +// A matrix mapping 3 value colors. +// Not using QMatrix because only floats are needed and performance is critical. +class QColorMatrix +{ +public: + // We are storing the matrix transposed as that is more convenient: + QColorVector r; + QColorVector g; + QColorVector b; + + friend inline bool operator==(const QColorMatrix &m1, const QColorMatrix &m2); + friend inline bool operator!=(const QColorMatrix &m1, const QColorMatrix &m2); + + bool isValid() const + { + // A color matrix must be invertible + float det = r.x * (b.z * g.y - g.z * b.y) - + r.y * (b.z * g.x - g.z * b.x) + + r.z * (b.y * g.x - g.y * b.x); + return !qFuzzyIsNull(det); + } + + QColorMatrix inverted() const + { + float det = r.x * (b.z * g.y - g.z * b.y) - + r.y * (b.z * g.x - g.z * b.x) + + r.z * (b.y * g.x - g.y * b.x); + det = 1.0f / det; + QColorMatrix inv; + inv.r.x = (g.y * b.z - b.y * g.z) * det; + inv.r.y = (b.y * r.z - r.y * b.z) * det; + inv.r.z = (r.y * g.z - g.y * r.z) * det; + inv.g.x = (b.x * g.z - g.x * b.z) * det; + inv.g.y = (r.x * b.z - b.x * r.z) * det; + inv.g.z = (g.x * r.z - r.x * g.z) * det; + inv.b.x = (g.x * b.y - b.x * g.y) * det; + inv.b.y = (b.x * r.y - r.x * b.y) * det; + inv.b.z = (r.x * g.y - g.x * r.y) * det; + return inv; + } + QColorMatrix operator*(const QColorMatrix &o) const + { + QColorMatrix comb; + comb.r.x = r.x * o.r.x + g.x * o.r.y + b.x * o.r.z; + comb.g.x = r.x * o.g.x + g.x * o.g.y + b.x * o.g.z; + comb.b.x = r.x * o.b.x + g.x * o.b.y + b.x * o.b.z; + + comb.r.y = r.y * o.r.x + g.y * o.r.y + b.y * o.r.z; + comb.g.y = r.y * o.g.x + g.y * o.g.y + b.y * o.g.z; + comb.b.y = r.y * o.b.x + g.y * o.b.y + b.y * o.b.z; + + comb.r.z = r.z * o.r.x + g.z * o.r.y + b.z * o.r.z; + comb.g.z = r.z * o.g.x + g.z * o.g.y + b.z * o.g.z; + comb.b.z = r.z * o.b.x + g.z * o.b.y + b.z * o.b.z; + return comb; + + } + QColorVector map(const QColorVector &c) const + { + return QColorVector { c.x * r.x + c.y * g.x + c.z * b.x, + c.x * r.y + c.y * g.y + c.z * b.y, + c.x * r.z + c.y * g.z + c.z * b.z }; + } + QColorMatrix transposed() const + { + return QColorMatrix { { r.x, g.x, b.x }, + { r.y, g.y, b.y }, + { r.z, g.z, b.z } }; + } + + static QColorMatrix null() + { + return { QColorVector::null(), QColorVector::null(), QColorVector::null() }; + } + static QColorMatrix identity() + { + return { { 1.0f, 0.0f, 0.0f }, { 0.0f, 1.0f, 0.0f }, { 0.0f, 0.0f, 1.0f } }; + } + static QColorMatrix toXyzFromSRgb() + { + return QColorMatrix { { 0.4360217452f, 0.2224751115f, 0.0139281144f }, + { 0.3851087987f, 0.7169067264f, 0.0971015394f }, + { 0.1430812478f, 0.0606181994f, 0.7141585946f } }; + } + static QColorMatrix toXyzFromAdobeRgb() + { + return QColorMatrix { { 0.6097189188f, 0.3111021519f, 0.0194766335f }, + { 0.2052682191f, 0.6256770492f, 0.0608891509f }, + { 0.1492247432f, 0.0632209629f, 0.7448224425f } }; + } + static QColorMatrix toXyzFromDciP3D65() + { + return QColorMatrix { { 0.5150973201f, 0.2411795557f, -0.0010491034f }, + { 0.2919696569f, 0.6922441125f, 0.0418830328f }, + { 0.1571449190f, 0.0665764511f, 0.7843542695f } }; + } + static QColorMatrix toXyzFromProPhotoRgb() + { + return QColorMatrix { { 0.7976672649f, 0.2880374491f, 0.0000000000f }, + { 0.1351922452f, 0.7118769884f, 0.0000000000f }, + { 0.0313525312f, 0.0000856627f, 0.8251883388f } }; + } + static QColorMatrix toXyzFromBt2020() + { + return QColorMatrix { { 0.6506130099f, 0.2695676684f, -0.0018652577f }, + { 0.1865101457f, 0.6840794086f, 0.0172256753f }, + { 0.1270887405f, 0.0463530831f, 0.8098278046f } }; + } +}; + +inline bool operator==(const QColorMatrix &m1, const QColorMatrix &m2) +{ + return (m1.r == m2.r) && (m1.g == m2.g) && (m1.b == m2.b); +} + +inline bool operator!=(const QColorMatrix &m1, const QColorMatrix &m2) +{ + return !(m1 == m2); +} + +QT_END_NAMESPACE + +#endif // QCOLORMATRIX_P_H diff --git a/src/gui/painting/qcolorspace.cpp b/src/gui/painting/qcolorspace.cpp new file mode 100644 index 0000000000..24785f7b61 --- /dev/null +++ b/src/gui/painting/qcolorspace.cpp @@ -0,0 +1,633 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#include "qcolorspace.h" +#include "qcolorspace_p.h" + +#include "qcolortransform.h" +#include "qcolormatrix_p.h" +#include "qcolortransferfunction_p.h" +#include "qcolortransform_p.h" +#include "qicc_p.h" + +#include <qmath.h> +#include <qtransform.h> + +#include <qdebug.h> + +QT_BEGIN_NAMESPACE + +QColorSpacePrivate::QColorSpacePrivate() + : id(QColorSpace::Unknown) + , gamut(QColorSpace::Gamut::Custom) + , transferFunction(QColorSpace::TransferFunction::Custom) + , gamma(0.0f) + , whitePoint(QColorVector::null()) + , toXyz(QColorMatrix::null()) +{ +} + +QColorSpacePrivate::QColorSpacePrivate(QColorSpace::ColorSpaceId colorSpaceId) + : id(colorSpaceId) +{ + switch (colorSpaceId) { + case QColorSpace::Undefined: + gamut = QColorSpace::Gamut::Custom; + transferFunction = QColorSpace::TransferFunction::Custom; + gamma = 0.0f; + description = QStringLiteral("Undefined"); + break; + case QColorSpace::SRgb: + gamut = QColorSpace::Gamut::SRgb; + transferFunction = QColorSpace::TransferFunction::SRgb; + gamma = 2.31f; // ? + description = QStringLiteral("sRGB"); + break; + case QColorSpace::SRgbLinear: + gamut = QColorSpace::Gamut::SRgb; + transferFunction = QColorSpace::TransferFunction::Linear; + gamma = 1.0f; + description = QStringLiteral("Linear sRGB"); + break; + case QColorSpace::AdobeRgb: + gamut = QColorSpace::Gamut::AdobeRgb; + transferFunction = QColorSpace::TransferFunction::Gamma; + gamma = 2.19921875f; // Not quite 2.2, see https://www.adobe.com/digitalimag/pdfs/AdobeRGB1998.pdf + description = QStringLiteral("Adobe RGB"); + break; + case QColorSpace::DisplayP3: + gamut = QColorSpace::Gamut::DciP3D65; + transferFunction = QColorSpace::TransferFunction::SRgb; + gamma = 2.31f; // ? + description = QStringLiteral("Display P3"); + break; + case QColorSpace::ProPhotoRgb: + gamut = QColorSpace::Gamut::ProPhotoRgb; + transferFunction = QColorSpace::TransferFunction::ProPhotoRgb; + gamma = 1.8f; + description = QStringLiteral("ProPhoto RGB"); + break; + case QColorSpace::Bt2020: + gamut = QColorSpace::Gamut::Bt2020; + transferFunction = QColorSpace::TransferFunction::Bt2020; + gamma = 2.1f; // ? + description = QStringLiteral("BT.2020"); + break; + case QColorSpace::Unknown: + qWarning("Can not create an unknown color space"); + Q_FALLTHROUGH(); + default: + Q_UNREACHABLE(); + } + initialize(); +} + +QColorSpacePrivate::QColorSpacePrivate(QColorSpace::Gamut gamut, QColorSpace::TransferFunction fun, float gamma) + : gamut(gamut) + , transferFunction(fun) + , gamma(gamma) +{ + if (!identifyColorSpace()) + id = QColorSpace::Unknown; + initialize(); +} + +bool QColorSpacePrivate::identifyColorSpace() +{ + switch (gamut) { + case QColorSpace::Gamut::SRgb: + if (transferFunction == QColorSpace::TransferFunction::SRgb) { + id = QColorSpace::SRgb; + description = QStringLiteral("sRGB"); + return true; + } + if (transferFunction == QColorSpace::TransferFunction::Linear) { + id = QColorSpace::SRgbLinear; + description = QStringLiteral("Linear sRGB"); + return true; + } + break; + case QColorSpace::Gamut::AdobeRgb: + if (transferFunction == QColorSpace::TransferFunction::Gamma) { + if (qAbs(gamma - 2.19921875f) < (1/1024.0f)) { + id = QColorSpace::AdobeRgb; + description = QStringLiteral("Adobe RGB"); + return true; + } + } + break; + case QColorSpace::Gamut::DciP3D65: + if (transferFunction == QColorSpace::TransferFunction::SRgb) { + id = QColorSpace::DisplayP3; + description = QStringLiteral("Display P3"); + return true; + } + break; + case QColorSpace::Gamut::ProPhotoRgb: + if (transferFunction == QColorSpace::TransferFunction::ProPhotoRgb) { + id = QColorSpace::ProPhotoRgb; + description = QStringLiteral("ProPhoto RGB"); + return true; + } + if (transferFunction == QColorSpace::TransferFunction::Gamma) { + // ProPhoto RGB's curve is effectively gamma 1.8 for 8bit precision. + if (qAbs(gamma - 1.8f) < (1/1024.0f)) { + id = QColorSpace::ProPhotoRgb; + description = QStringLiteral("ProPhoto RGB"); + return true; + } + } + break; + case QColorSpace::Gamut::Bt2020: + if (transferFunction == QColorSpace::TransferFunction::Bt2020) { + id = QColorSpace::Bt2020; + description = QStringLiteral("BT.2020"); + return true; + } + break; + default: + break; + } + return false; +} + +void QColorSpacePrivate::initialize() +{ + setToXyzMatrix(); + setTransferFunction(); +} + +void QColorSpacePrivate::setToXyzMatrix() +{ + switch (gamut) { + case QColorSpace::Gamut::SRgb: + toXyz = QColorMatrix::toXyzFromSRgb(); + whitePoint = QColorVector::D65(); + return; + case QColorSpace::Gamut::AdobeRgb: + toXyz = QColorMatrix::toXyzFromAdobeRgb(); + whitePoint = QColorVector::D65(); + return; + case QColorSpace::Gamut::DciP3D65: + toXyz = QColorMatrix::toXyzFromDciP3D65(); + whitePoint = QColorVector::D65(); + return; + case QColorSpace::Gamut::ProPhotoRgb: + toXyz = QColorMatrix::toXyzFromProPhotoRgb(); + whitePoint = QColorVector::D50(); + return; + case QColorSpace::Gamut::Bt2020: + toXyz = QColorMatrix::toXyzFromBt2020(); + whitePoint = QColorVector::D65(); + return; + case QColorSpace::Gamut::Custom: + toXyz = QColorMatrix::null(); + whitePoint = QColorVector::D50(); + return; + } + Q_UNREACHABLE(); +} + +void QColorSpacePrivate::setTransferFunction() +{ + switch (transferFunction) { + case QColorSpace::TransferFunction::Linear: + trc[0].m_type = QColorTrc::Type::Function; + trc[0].m_fun = QColorTransferFunction(); + break; + case QColorSpace::TransferFunction::Gamma: + trc[0].m_type = QColorTrc::Type::Function; + trc[0].m_fun = QColorTransferFunction::fromGamma(gamma); + break; + case QColorSpace::TransferFunction::SRgb: + trc[0].m_type = QColorTrc::Type::Function; + trc[0].m_fun = QColorTransferFunction::fromSRgb(); + break; + case QColorSpace::TransferFunction::ProPhotoRgb: + trc[0].m_type = QColorTrc::Type::Function; + trc[0].m_fun = QColorTransferFunction::fromProPhotoRgb(); + break; + case QColorSpace::TransferFunction::Bt2020: + trc[0].m_type = QColorTrc::Type::Function; + trc[0].m_fun = QColorTransferFunction::fromBt2020(); + break; + case QColorSpace::TransferFunction::Custom: + break; + default: + Q_UNREACHABLE(); + break; + } + trc[1] = trc[0]; + trc[2] = trc[0]; +} + +QColorTransform QColorSpacePrivate::transformationToColorSpace(const QColorSpacePrivate *out) const +{ + Q_ASSERT(out); + QColorTransform combined; + combined.d_ptr.reset(new QColorTransformPrivate); + combined.d_ptr->colorSpaceIn = this; + combined.d_ptr->colorSpaceOut = out; + combined.d_ptr->colorMatrix = out->toXyz.inverted() * toXyz; + return combined; +} + +/*! + \class QColorSpace + \brief The QColorSpace class provides a color space abstraction. + \since 5.14 + + \ingroup painting + \ingroup appearance + \inmodule QtGui + + Color values can be interpreted in different ways, and based on the interpretation + can live in different spaces. We call this \e {color spaces}. + + QColorSpace provides access to creating several predefined color spaces and + can generate QColorTransforms for converting colors from one color space to + another. + + QColorSpace can also represent color spaces defined by ICC profiles or embedded + in images, that do not otherwise fit the predefined color spaces. + + A color space can generally speaking be conceived as a combination of a transfer + function and a gamut. The gamut defines which colors the color space can represent. + A color space that can represent a wider range of colors is also known as a + wide-gamut color space. The gamut is defined by three primary colors that represent + exactly how red, green, and blue look in this particular color space, and a white + color that represents where and how bright pure white is. + + The transfer function or gamma curve determines how each component in the + color space is encoded. These are used because human perception does not operate + linearly, and the transfer functions try to ensure that colors will seem evenly + spaced to human eyes. +*/ + + +/*! + \enum QColorSpace::ColorSpaceId + + Predefined color spaces. + + \value Undefined An empty, invalid or unsupported color space. + \value Unknown A valid color space that doesn't match any of the predefined color spaces. + \value SRgb The sRGB color space, which Qt operates in by default. It is a close approximation + of how most classic monitors operate, and a mode most software and hardware support. + \l{http://www.color.org/chardata/rgb/srgb.xalter}{ICC registration of sRGB}. + \value SRgbLinear The sRGB color space with linear gamma. Useful for gamma-corrected blending. + \value AdobeRgb The Adobe RGB color space is a classic wide-gamut color space, using a gamma of 2.2. + \l{http://www.color.org/chardata/rgb/adobergb.xalter}{ICC registration of Adobe RGB (1998)} + \value DisplayP3 A color-space using the primaries of DCI-P3, but with the whitepoint and transfer + function of sRGB. Common in modern wide-gamut screens. + \l{http://www.color.org/chardata/rgb/DCIP3.xalter}{ICC registration of DCI-P3} + \value ProPhotoRgb The Pro Photo RGB color space, also known as ROMM RGB is a very wide gamut color space. + \l{http://www.color.org/chardata/rgb/rommrgb.xalter}{ICC registration of ROMM RGB} + \value Bt2020 BT.2020 also known as Rec.2020 is the color space of HDR TVs. + \l{http://www.color.org/chardata/rgb/BT2020.xalter}{ICC registration of BT.2020} +*/ + +/*! + \enum QColorSpace::Gamut + + Predefined gamuts, or sets of primary colors. + + \value Custom The gamut is undefined or does not match any predefined sets. + \value SRgb The sRGB gamut + \value AdobeRgb The Adobe RGB gamut + \value DciP3D65 The DCI-P3 gamut with the D65 whitepoint + \value ProPhotoRgb The ProPhoto RGB gamut with the D50 whitepoint + \value Bt2020 The BT.2020 gamut +*/ + +/*! + \enum QColorSpace::TransferFunction + + Predefined transfer functions or gamma curves. + + \value Custom The custom or null transfer function + \value Linear The linear transfer functions + \value Gamma A transfer function that is a real gamma curve based on the value of gamma() + \value SRgb The sRGB transfer function, composed of linear and gamma parts + \value ProPhotoRgb The ProPhoto RGB transfer function, composed of linear and gamma parts + \value Bt2020 The BT.2020 transfer function, composed of linear and gamma parts +*/ + +/*! + Creates a new colorspace object that represents \a colorSpaceId. + */ +QColorSpace::QColorSpace(QColorSpace::ColorSpaceId colorSpaceId) +{ + static QExplicitlySharedDataPointer<QColorSpacePrivate> predefinedColorspacePrivates[QColorSpace::Bt2020]; + if (colorSpaceId <= QColorSpace::Unknown) { + if (!predefinedColorspacePrivates[0]) + predefinedColorspacePrivates[0] = new QColorSpacePrivate(QColorSpace::Undefined); + d_ptr = predefinedColorspacePrivates[0]; // unknown and undefined both returns the static undefined colorspace. + } else { + if (!predefinedColorspacePrivates[colorSpaceId - 1]) + predefinedColorspacePrivates[colorSpaceId - 1] = new QColorSpacePrivate(colorSpaceId); + d_ptr = predefinedColorspacePrivates[colorSpaceId - 1]; + } + + Q_ASSERT(colorSpaceId == QColorSpace::Undefined || isValid()); +} + +/*! + Creates a custom color space with the gamut \a gamut, using the transfer function \a fun and + optionally \a gamma. + */ +QColorSpace::QColorSpace(QColorSpace::Gamut gamut, QColorSpace::TransferFunction fun, float gamma) + : d_ptr(new QColorSpacePrivate(gamut, fun, gamma)) +{ +} + +/*! + Creates a custom color space with the gamut \a gamut, using a gamma transfer function of + \a gamma. + */ +QColorSpace::QColorSpace(QColorSpace::Gamut gamut, float gamma) + : d_ptr(new QColorSpacePrivate(gamut, TransferFunction::Gamma, gamma)) +{ +} + +QColorSpace::~QColorSpace() +{ +} + +QColorSpace::QColorSpace(QColorSpace &&colorSpace) + : d_ptr(std::move(colorSpace.d_ptr)) +{ +} + +QColorSpace::QColorSpace(const QColorSpace &colorSpace) + : d_ptr(colorSpace.d_ptr) +{ +} + +QColorSpace &QColorSpace::operator=(QColorSpace &&colorSpace) +{ + d_ptr = std::move(colorSpace.d_ptr); + return *this; +} + +QColorSpace &QColorSpace::operator=(const QColorSpace &colorSpace) +{ + d_ptr = colorSpace.d_ptr; + return *this; +} + +/*! + Returns the id of the predefined color space this object + represents or \c Unknown if it doesn't match any of them. +*/ +QColorSpace::ColorSpaceId QColorSpace::colorSpaceId() const noexcept +{ + return d_ptr->id; +} + +/*! + Returns the predefined gamut of the color space + or \c Gamut::Custom if it doesn't match any of them. +*/ +QColorSpace::Gamut QColorSpace::gamut() const noexcept +{ + return d_ptr->gamut; +} + +/*! + Returns the predefined transfer function of the color space + or \c TransferFunction::Custom if it doesn't match any of them. + + \sa gamma() +*/ +QColorSpace::TransferFunction QColorSpace::transferFunction() const noexcept +{ + return d_ptr->transferFunction; +} + +/*! + Returns the gamma value of color spaces with \c TransferFunction::Gamma, + an approximate gamma value for other predefined color spaces, or + 0.0 if no approximate gamma is known. + + \sa transferFunction() +*/ +float QColorSpace::gamma() const noexcept +{ + return d_ptr->gamma; +} + +/*! + Returns an ICC profile representing the color space. + + If the color space was generated from an ICC profile, that profile + is returned, otherwise one is generated. + + \note Even invalid color spaces may return the ICC profile if they + were generated from one, to allow applications to implement wider + support themselves. + + \sa fromIccProfile() +*/ +QByteArray QColorSpace::iccProfile() const +{ + if (!d_ptr->iccProfile.isEmpty()) + return d_ptr->iccProfile; + if (!isValid()) + return QByteArray(); + return QIcc::toIccProfile(*this); +} + +/*! + Creates a QColorSpace from ICC profile \a iccProfile. + + \note Not all ICC profiles are supported. QColorSpace only supports + RGB-XYZ ICC profiles that are three-component matrix-based. + + If the ICC profile is not supported an invalid QColorSpace is returned + where you can still read the original ICC profile using iccProfile(). + + \sa iccProfile() +*/ +QColorSpace QColorSpace::fromIccProfile(const QByteArray &iccProfile) +{ + QColorSpace colorSpace; + if (QIcc::fromIccProfile(iccProfile, &colorSpace)) + return colorSpace; + colorSpace.d_ptr->id = QColorSpace::Undefined; + colorSpace.d_ptr->iccProfile = iccProfile; + return colorSpace; +} + +/*! + Returns \c true if the color space is valid. +*/ +bool QColorSpace::isValid() const noexcept +{ + return d_ptr->id != QColorSpace::Undefined && d_ptr->toXyz.isValid() + && d_ptr->trc[0].isValid() && d_ptr->trc[1].isValid() && d_ptr->trc[2].isValid(); +} + +/*! + \relates QColorSpace + Returns \c true if colorspace \a colorSpace1 is equal to colorspace \a colorSpace2; + otherwise returns \c false +*/ +bool operator==(const QColorSpace &colorSpace1, const QColorSpace &colorSpace2) +{ + if (colorSpace1.d_ptr == colorSpace2.d_ptr) + return true; + + if (colorSpace1.colorSpaceId() == QColorSpace::Undefined && colorSpace2.colorSpaceId() == QColorSpace::Undefined) + return colorSpace1.d_ptr->iccProfile == colorSpace2.d_ptr->iccProfile; + + if (colorSpace1.colorSpaceId() != QColorSpace::Unknown && colorSpace2.colorSpaceId() != QColorSpace::Unknown) + return colorSpace1.colorSpaceId() == colorSpace2.colorSpaceId(); + + if (colorSpace1.gamut() != QColorSpace::Gamut::Custom && colorSpace2.gamut() != QColorSpace::Gamut::Custom) { + if (colorSpace1.gamut() != colorSpace2.gamut()) + return false; + } else { + if (colorSpace1.d_ptr->toXyz != colorSpace2.d_ptr->toXyz) + return false; + } + + if (colorSpace1.transferFunction() != QColorSpace::TransferFunction::Custom && + colorSpace2.transferFunction() != QColorSpace::TransferFunction::Custom) { + if (colorSpace1.transferFunction() != colorSpace2.transferFunction()) + return false; + if (colorSpace1.transferFunction() == QColorSpace::TransferFunction::Gamma) + return colorSpace1.gamma() == colorSpace2.gamma(); + return true; + } + + if (colorSpace1.d_ptr->trc[0] != colorSpace2.d_ptr->trc[0] || + colorSpace1.d_ptr->trc[1] != colorSpace2.d_ptr->trc[1] || + colorSpace1.d_ptr->trc[2] != colorSpace2.d_ptr->trc[2]) + return false; + + return true; +} + +/*! + \fn bool operator!=(const QColorSpace &colorSpace1, const QColorSpace &colorSpace2) + \relates QColorSpace + + Returns \c true if colorspace \a colorspace1 is not equal to colorspace \a colorspace2; + otherwise returns \c false +*/ + +/*! + Generates and returns a color space transformation from this color space to + \a colorspace. +*/ +QColorTransform QColorSpace::transformationToColorSpace(const QColorSpace &colorspace) const +{ + if (!isValid() || !colorspace.isValid()) + return QColorTransform(); + + return d_ptr->transformationToColorSpace(colorspace.d_ptr.constData()); +} + +/*! + \internal +*/ +QColorSpacePrivate *QColorSpace::d_func() +{ + d_ptr.detach(); + return d_ptr.data(); +} + +/*! + \fn const QColorSpacePrivate* QColorSpacePrivate::d_func() const + \internal +*/ + +/***************************************************************************** + QColorSpace stream functions + *****************************************************************************/ +#if !defined(QT_NO_DATASTREAM) +/*! + \fn QDataStream &operator<<(QDataStream &stream, const QColorSpace &colorSpace) + \relates QColorSpace + + Writes the given \a colorSpace to the given \a stream as an ICC profile. + + \sa QColorSpace::iccProfile(), {Serializing Qt Data Types} +*/ + +QDataStream &operator<<(QDataStream &s, const QColorSpace &image) +{ + s << image.iccProfile(); + return s; +} + +/*! + \fn QDataStream &operator>>(QDataStream &stream, QColorSpace &colorSpace) + \relates QColorSpace + + Reads a color space from the given \a stream and stores it in the given + \a colorSpace. + + \sa QColorSpace::fromIccProfile(), {Serializing Qt Data Types} +*/ + +QDataStream &operator>>(QDataStream &s, QColorSpace &colorSpace) +{ + QByteArray iccProfile; + s >> iccProfile; + colorSpace = QColorSpace::fromIccProfile(iccProfile); + return s; +} +#endif // QT_NO_DATASTREAM + +#ifndef QT_NO_DEBUG_STREAM +QDebug operator<<(QDebug dbg, const QColorSpace &colorSpace) +{ + QDebugStateSaver saver(dbg); + dbg.nospace(); + dbg << "QColorSpace("; + dbg << colorSpace.colorSpaceId() << ", " << colorSpace.gamut() << ", " << colorSpace.transferFunction(); + dbg << ", gamma=" << colorSpace.gamma(); + dbg << ')'; + return dbg; +} +#endif + +QT_END_NAMESPACE diff --git a/src/gui/painting/qcolorspace.h b/src/gui/painting/qcolorspace.h new file mode 100644 index 0000000000..923546ec6f --- /dev/null +++ b/src/gui/painting/qcolorspace.h @@ -0,0 +1,136 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QCOLORSPACE_H +#define QCOLORSPACE_H + +#include <QtGui/qtguiglobal.h> +#include <QtGui/qcolortransform.h> +#include <QtCore/qshareddata.h> + +QT_BEGIN_NAMESPACE + +class QColorSpacePrivate; + +class Q_GUI_EXPORT QColorSpace +{ + Q_GADGET +public: + enum ColorSpaceId { + Undefined = 0, + Unknown = 1, + SRgb, + SRgbLinear, + AdobeRgb, + DisplayP3, + ProPhotoRgb, + Bt2020, + }; + Q_ENUM(ColorSpaceId) + enum class Gamut { + Custom = 0, + SRgb, + AdobeRgb, + DciP3D65, + ProPhotoRgb, + Bt2020, + }; + Q_ENUM(Gamut) + enum class TransferFunction { + Custom = 0, + Linear, + Gamma, + SRgb, + ProPhotoRgb, + Bt2020, + }; + Q_ENUM(TransferFunction) + + QColorSpace(ColorSpaceId colorSpaceId = Undefined); + QColorSpace(Gamut gamut, TransferFunction fun, float gamma = 0.0f); + QColorSpace(Gamut gamut, float gamma); + ~QColorSpace(); + + QColorSpace(QColorSpace &&colorSpace); + QColorSpace(const QColorSpace &colorSpace); + QColorSpace &operator=(QColorSpace &&colorSpace); + QColorSpace &operator=(const QColorSpace &colorSpace); + + ColorSpaceId colorSpaceId() const noexcept; + Gamut gamut() const noexcept; + TransferFunction transferFunction() const noexcept; + float gamma() const noexcept; + + bool isValid() const noexcept; + + friend Q_GUI_EXPORT bool operator==(const QColorSpace &colorSpace1, const QColorSpace &colorSpace2); + friend inline bool operator!=(const QColorSpace &colorSpace1, const QColorSpace &colorSpace2); + + static QColorSpace fromIccProfile(const QByteArray &iccProfile); + QByteArray iccProfile() const; + + QColorTransform transformationToColorSpace(const QColorSpace &colorspace) const; + + QColorSpacePrivate *d_func(); + inline const QColorSpacePrivate *d_func() const { return d_ptr.constData(); } + +private: + friend class QColorSpacePrivate; + QExplicitlySharedDataPointer<QColorSpacePrivate> d_ptr; +}; + +bool Q_GUI_EXPORT operator==(const QColorSpace &colorSpace1, const QColorSpace &colorSpace2); +inline bool operator!=(const QColorSpace &colorSpace1, const QColorSpace &colorSpace2) +{ + return !(colorSpace1 == colorSpace2); +} + +// QColorSpace stream functions +#if !defined(QT_NO_DATASTREAM) +Q_GUI_EXPORT QDataStream &operator<<(QDataStream &, const QColorSpace &); +Q_GUI_EXPORT QDataStream &operator>>(QDataStream &, QColorSpace &); +#endif + +#ifndef QT_NO_DEBUG_STREAM +Q_GUI_EXPORT QDebug operator<<(QDebug, const QColorSpace &); +#endif + +QT_END_NAMESPACE + +#endif // QCOLORSPACE_P_H diff --git a/src/gui/painting/qcolorspace_p.h b/src/gui/painting/qcolorspace_p.h new file mode 100644 index 0000000000..91107a9a89 --- /dev/null +++ b/src/gui/painting/qcolorspace_p.h @@ -0,0 +1,96 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QCOLORSPACE_P_H +#define QCOLORSPACE_P_H + +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// + +#include "qcolorspace.h" +#include "qcolormatrix_p.h" +#include "qcolortrc_p.h" +#include "qcolortrclut_p.h" + +#include <QtCore/qshareddata.h> + +QT_BEGIN_NAMESPACE + +class QColorSpacePrivate : public QSharedData +{ +public: + QColorSpacePrivate(); + QColorSpacePrivate(QColorSpace::ColorSpaceId colorSpaceId); + QColorSpacePrivate(QColorSpace::Gamut gamut, QColorSpace::TransferFunction fun, float gamma); + QColorSpacePrivate(const QColorSpacePrivate &other) = default; + QColorSpacePrivate &operator=(const QColorSpacePrivate &other) = default; + + void initialize(); + void setToXyzMatrix(); + void setTransferFunction(); + bool identifyColorSpace(); + QColorTransform transformationToColorSpace(const QColorSpacePrivate *out) const; + + QColorSpace::ColorSpaceId id; + QColorSpace::Gamut gamut; + QColorSpace::TransferFunction transferFunction; + float gamma; + QColorVector whitePoint; + + QColorTrc trc[3]; + QColorMatrix toXyz; + + QString description; + QByteArray iccProfile; + + mutable QSharedPointer<QColorTrcLut> lut[3]; + mutable QAtomicInt lutsGenerated; +}; + +QT_END_NAMESPACE + +#endif // QCOLORSPACE_P_H diff --git a/src/gui/painting/qcolortransferfunction_p.h b/src/gui/painting/qcolortransferfunction_p.h new file mode 100644 index 0000000000..fd7cfa2b2b --- /dev/null +++ b/src/gui/painting/qcolortransferfunction_p.h @@ -0,0 +1,207 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QCOLORTRANSFERFUNCTION_P_H +#define QCOLORTRANSFERFUNCTION_P_H + +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// + +#include <QtGui/private/qtguiglobal_p.h> + +#include <cmath> + +QT_BEGIN_NAMESPACE + +// Defines a ICC parametric curve type 4 +class Q_GUI_EXPORT QColorTransferFunction +{ +public: + QColorTransferFunction() noexcept + : m_a(1.0f), m_b(0.0f), m_c(1.0f), m_d(0.0f), m_e(0.0f), m_f(0.0f), m_g(1.0f), m_flags(0) + { } + QColorTransferFunction(float a, float b, float c, float d, float e, float f, float g) noexcept + : m_a(a), m_b(b), m_c(c), m_d(d), m_e(e), m_f(f), m_g(g), m_flags(0) + { } + + bool isGamma() const + { + updateHints(); + return m_flags & quint32(Hints::IsGamma); + } + bool isLinear() const + { + updateHints(); + return m_flags & quint32(Hints::IsLinear); + } + bool isSRgb() const + { + updateHints(); + return m_flags & quint32(Hints::IsSRgb); + } + + float apply(float x) const + { + if (x < m_d) + return m_c * x + m_f; + else + return std::pow(m_a * x + m_b, m_g) + m_e; + } + + QColorTransferFunction inverted() const + { + float a, b, c, d, e, f, g; + + d = m_c * m_d + m_f; + + if (!qFuzzyIsNull(m_c)) { + c = 1.0f / m_c; + f = -m_f / m_c; + } else { + c = 0.0f; + f = 0.0f; + } + + if (!qFuzzyIsNull(m_a) && !qFuzzyIsNull(m_g)) { + a = std::pow(1.0f / m_a, m_g); + b = -a * m_e; + e = -m_b / m_a; + g = 1.0f / m_g; + } else { + a = 0.0f; + b = 0.0f; + e = 1.0f; + g = 1.0f; + } + + return QColorTransferFunction(a, b, c, d, e, f, g); + } + + // A few predefined curves: + static QColorTransferFunction fromGamma(float gamma) + { + return QColorTransferFunction(1.0f, 0.0f, 0.0f, 0.0f, 0.0f, 0.0f, gamma); + } + static QColorTransferFunction fromSRgb() + { + return QColorTransferFunction(1.0f / 1.055f, 0.055f / 1.055f, 1.0f / 12.92f, 0.04045f, 0.0f, 0.0f, 2.4f); + } + static QColorTransferFunction fromBt2020() + { + return QColorTransferFunction(1.0f / 1.0993f, 0.0993f / 1.0993f, 1.0f / 4.5f, 0.08145f, 0.0f, 0.0f, 2.2f); + } + static QColorTransferFunction fromProPhotoRgb() + { + return QColorTransferFunction(1.0f, 0.0f, 1.0f / 16.0f, 16.0f / 512.0f, 0.0f, 0.0f, 1.8f); + } + bool matches(const QColorTransferFunction &o) const + { + return paramCompare(m_a, o.m_a) && paramCompare(m_b, o.m_b) + && paramCompare(m_c, o.m_c) && paramCompare(m_d, o.m_d) + && paramCompare(m_e, o.m_e) && paramCompare(m_f, o.m_f) + && paramCompare(m_g, o.m_g); + } + friend inline bool operator==(const QColorTransferFunction &f1, const QColorTransferFunction &f2); + friend inline bool operator!=(const QColorTransferFunction &f1, const QColorTransferFunction &f2); + + float m_a; + float m_b; + float m_c; + float m_d; + float m_e; + float m_f; + float m_g; + +private: + static inline bool paramCompare(float p1, float p2) + { + // Much fuzzier than fuzzy compare. + // It tries match parameters that has been passed through a 8.8 + // fixed point form. + return (qAbs(p1 - p2) <= (1.0f / 512.0f)); + } + + void updateHints() const + { + if (m_flags & quint32(Hints::Calculated)) + return; + // We do not consider the case with m_d = 1.0f linear or simple, + // since it wouldn't be linear for applyExtended(). + bool simple = paramCompare(m_a, 1.0f) && paramCompare(m_b, 0.0f) + && paramCompare(m_d, 0.0f) + && paramCompare(m_e, 0.0f); + if (simple) { + m_flags |= quint32(Hints::IsGamma); + if (qFuzzyCompare(m_g, 1.0f)) + m_flags |= quint32(Hints::IsLinear); + } else { + if (*this == fromSRgb()) + m_flags |= quint32(Hints::IsSRgb); + } + m_flags |= quint32(Hints::Calculated); + } + enum class Hints : quint32 { + Calculated = 1, + IsGamma = 2, + IsLinear = 4, + IsSRgb = 8 + }; + mutable quint32 m_flags; +}; + +inline bool operator==(const QColorTransferFunction &f1, const QColorTransferFunction &f2) +{ + return f1.matches(f2); +} +inline bool operator!=(const QColorTransferFunction &f1, const QColorTransferFunction &f2) +{ + return !f1.matches(f2); +} + +QT_END_NAMESPACE + +#endif // QCOLORTRANSFERFUNCTION_P_H diff --git a/src/gui/painting/qcolortransfertable_p.h b/src/gui/painting/qcolortransfertable_p.h new file mode 100644 index 0000000000..c8b2f7bd92 --- /dev/null +++ b/src/gui/painting/qcolortransfertable_p.h @@ -0,0 +1,245 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QCOLORTRANSFERTABLE_P_H +#define QCOLORTRANSFERTABLE_P_H + +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// + +#include <QtGui/private/qtguiglobal_p.h> +#include "qcolortransferfunction_p.h" + +#include <QVector> +#include <cmath> + +QT_BEGIN_NAMESPACE + +// Defines either an ICC TRC 'curve' or a lut8/lut16 A or B table +class Q_GUI_EXPORT QColorTransferTable +{ +public: + QColorTransferTable() noexcept + : m_tableSize(0) + { } + QColorTransferTable(uint32_t size, const QVector<uint8_t> &table) noexcept + : m_tableSize(size) + , m_table8(table) + { } + QColorTransferTable(uint32_t size, const QVector<uint16_t> &table) noexcept + : m_tableSize(size) + , m_table16(table) + { } + + bool isValid() const + { + if (m_tableSize < 2) + return false; + +#if !defined(QT_NO_DEBUG) + // The table must describe an injective curve: + if (!m_table8.isEmpty()) { + uint8_t val = 0; + for (uint i = 0; i < m_tableSize; ++i) { + Q_ASSERT(m_table8[i] >= val); + val = m_table8[i]; + } + } + if (!m_table16.isEmpty()) { + uint16_t val = 0; + for (uint i = 0; i < m_tableSize; ++i) { + Q_ASSERT(m_table16[i] >= val); + val = m_table16[i]; + } + } +#endif + return !m_table8.isEmpty() || !m_table16.isEmpty(); + } + + float apply(float x) const + { + x = std::min(std::max(x, 0.0f), 1.0f); + x *= m_tableSize - 1; + uint32_t lo = (int)std::floor(x); + uint32_t hi = std::min(lo + 1, m_tableSize); + float frac = x - lo; + if (!m_table16.isEmpty()) + return (m_table16[lo] * (1.0f - frac) + m_table16[hi] * frac) * (1.0f/65535.0f); + if (!m_table8.isEmpty()) + return (m_table8[lo] * (1.0f - frac) + m_table8[hi] * frac) * (1.0f/255.0f); + return x; + } + + // Apply inverse, optimized by giving a previous result a value < x. + float applyInverse(float x, float resultLargerThan = 0.0f) const + { + Q_ASSERT(resultLargerThan >= 0.0f && resultLargerThan <= 1.0f); + if (x <= 0.0f) + return 0.0f; + if (x >= 1.0f) + return 1.0f; + if (!m_table16.isEmpty()) { + float v = x * 65535.0f; + uint i = std::floor(resultLargerThan * (m_tableSize - 1)) + 1; + for ( ; i < m_tableSize; ++i) { + if (m_table16[i] > v) + break; + } + if (i >= m_tableSize - 1) + return 1.0f; + float y1 = m_table16[i - 1]; + float y2 = m_table16[i]; + Q_ASSERT(x >= y1 && x < y2); + float fr = (v - y1) / (y2 - y1); + return (i + fr) * (1.0f / (m_tableSize - 1)); + + } + if (!m_table8.isEmpty()) { + float v = x * 255.0f; + uint i = std::floor(resultLargerThan * (m_tableSize - 1)) + 1; + for ( ; i < m_tableSize; ++i) { + if (m_table8[i] > v) + break; + } + if (i >= m_tableSize - 1) + return 1.0f; + float y1 = m_table8[i - 1]; + float y2 = m_table8[i]; + Q_ASSERT(x >= y1 && x < y2); + float fr = (v - y1) / (y2 - y1); + return (i + fr) * (1.0f / (m_tableSize - 1)); + } + return x; + } + + bool asColorTransferFunction(QColorTransferFunction *transferFn) + { + Q_ASSERT(isValid()); + Q_ASSERT(transferFn); + if (!m_table8.isEmpty() && (m_table8[0] != 0 || m_table8[m_tableSize - 1] != 255)) + return false; + if (!m_table16.isEmpty() && (m_table16[0] != 0 || m_table16[m_tableSize - 1] != 65535)) + return false; + if (m_tableSize == 2) { + *transferFn = QColorTransferFunction(); // Linear + return true; + } + // The following heuristics are based on those from Skia: + if (m_tableSize == 26 && !m_table16.isEmpty()) { + // code.facebook.com/posts/411525055626587/under-the-hood-improving-facebook-photos + if (m_table16[6] != 3062) + return false; + if (m_table16[12] != 12824) + return false; + if (m_table16[18] != 31237) + return false; + *transferFn = QColorTransferFunction::fromSRgb(); + return true; + } + if (m_tableSize == 1024 && !m_table16.isEmpty()) { + // HP and Canon sRGB gamma tables: + if (m_table16[257] != 3366) + return false; + if (m_table16[513] != 14116) + return false; + if (m_table16[768] != 34318) + return false; + *transferFn = QColorTransferFunction::fromSRgb(); + return true; + } + if (m_tableSize == 4096 && !m_table16.isEmpty()) { + // Nikon, Epson, and lcms2 sRGB gamma tables: + if (m_table16[515] != 960) + return false; + if (m_table16[1025] != 3342) + return false; + if (m_table16[2051] != 14079) + return false; + *transferFn = QColorTransferFunction::fromSRgb(); + return true; + } + return false; + } + friend inline bool operator!=(const QColorTransferTable &t1, const QColorTransferTable &t2); + friend inline bool operator==(const QColorTransferTable &t1, const QColorTransferTable &t2); + + uint32_t m_tableSize; + QVector<uint8_t> m_table8; + QVector<uint16_t> m_table16; +}; + +inline bool operator!=(const QColorTransferTable &t1, const QColorTransferTable &t2) +{ + if (t1.m_tableSize != t2.m_tableSize) + return true; + if (t1.m_table8.isEmpty() != t2.m_table8.isEmpty()) + return true; + if (t1.m_table16.isEmpty() != t2.m_table16.isEmpty()) + return true; + if (!t1.m_table8.isEmpty()) { + for (quint32 i = 0; i < t1.m_tableSize; ++i) { + if (t1.m_table8[i] != t2.m_table8[i]) + return true; + } + } + if (!t1.m_table16.isEmpty()) { + for (quint32 i = 0; i < t1.m_tableSize; ++i) { + if (t1.m_table16[i] != t2.m_table16[i]) + return true; + } + } + return false; +} + +inline bool operator==(const QColorTransferTable &t1, const QColorTransferTable &t2) +{ + return !(t1 != t2); +} + +QT_END_NAMESPACE + +#endif // QCOLORTRANSFERTABLE_P_H diff --git a/src/gui/painting/qcolortransform.cpp b/src/gui/painting/qcolortransform.cpp new file mode 100644 index 0000000000..b677c4b36b --- /dev/null +++ b/src/gui/painting/qcolortransform.cpp @@ -0,0 +1,679 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + + +#include "qcolortransform.h" +#include "qcolortransform_p.h" + +#include "qcolormatrix_p.h" +#include "qcolorspace_p.h" +#include "qcolortrc_p.h" +#include "qcolortrclut_p.h" + +#include <QtCore/qatomic.h> +#include <QtCore/qmath.h> +#include <QtGui/qcolor.h> +#include <QtGui/qtransform.h> +#include <QtCore/private/qsimd_p.h> + +#include <qdebug.h> + +QT_BEGIN_NAMESPACE + +QColorTrcLut *lutFromTrc(const QColorTrc &trc) +{ + if (trc.m_type == QColorTrc::Type::Table) + return QColorTrcLut::fromTransferTable(trc.m_table); + if (trc.m_type == QColorTrc::Type::Function) + return QColorTrcLut::fromTransferFunction(trc.m_fun); + qWarning() << "TRC uninitialized"; + return nullptr; +} + +void QColorTransformPrivate::updateLutsIn() const +{ + if (colorSpaceIn->lutsGenerated.loadAcquire()) + return; + for (int i = 0; i < 3; ++i) { + if (!colorSpaceIn->trc[i].isValid()) + return; + } + + if (colorSpaceIn->trc[0] == colorSpaceIn->trc[1] && colorSpaceIn->trc[0] == colorSpaceIn->trc[2]) { + colorSpaceIn->lut[0].reset(lutFromTrc(colorSpaceIn->trc[0])); + colorSpaceIn->lut[1] = colorSpaceIn->lut[0]; + colorSpaceIn->lut[2] = colorSpaceIn->lut[0]; + } else { + for (int i = 0; i < 3; ++i) + colorSpaceIn->lut[i].reset(lutFromTrc(colorSpaceIn->trc[i])); + } + + colorSpaceIn->lutsGenerated.storeRelease(1); +} + +void QColorTransformPrivate::updateLutsOut() const +{ + if (colorSpaceOut->lutsGenerated.loadAcquire()) + return; + for (int i = 0; i < 3; ++i) { + if (!colorSpaceOut->trc[i].isValid()) + return; + } + + if (colorSpaceOut->trc[0] == colorSpaceOut->trc[1] && colorSpaceOut->trc[0] == colorSpaceOut->trc[2]) { + colorSpaceOut->lut[0].reset(lutFromTrc(colorSpaceOut->trc[0])); + colorSpaceOut->lut[1] = colorSpaceOut->lut[0]; + colorSpaceOut->lut[2] = colorSpaceOut->lut[0]; + } else { + for (int i = 0; i < 3; ++i) + colorSpaceOut->lut[i].reset(lutFromTrc(colorSpaceOut->trc[i])); + } + + colorSpaceOut->lutsGenerated.storeRelease(1); +} + +/*! + \class QColorTransform + \brief The QColorTransform class is a transformation between color spaces. + \since 5.14 + + \ingroup painting + \ingroup appearance + \inmodule QtGui + + QColorTransform is an instantiation of a transformation between color spaces. + It can be applied on color and pixels to convert them from one color space to + another. + + Setting up a QColorTransform takes some preprocessing, so keeping around + QColorTransforms that you need often is recommended, instead of generating + them on the fly. +*/ + + +QColorTransform::~QColorTransform() noexcept +{ +} + +/*! + Applies the color transformation on the QRgb value \a argb. + + The input should be opaque or unpremultiplied. +*/ +QRgb QColorTransform::map(const QRgb &argb) const +{ + if (!d_ptr) + return argb; + Q_D(const QColorTransform); + constexpr float f = 1.0f / 255.0f; + QColorVector c = { qRed(argb) * f, qGreen(argb) * f, qBlue(argb) * f }; + c.x = d->colorSpaceIn->trc[0].apply(c.x); + c.y = d->colorSpaceIn->trc[1].apply(c.y); + c.z = d->colorSpaceIn->trc[2].apply(c.z); + c = d->colorMatrix.map(c); + c.x = std::max(0.0f, std::min(1.0f, c.x)); + c.y = std::max(0.0f, std::min(1.0f, c.y)); + c.z = std::max(0.0f, std::min(1.0f, c.z)); + if (d->colorSpaceOut->lutsGenerated.loadAcquire()) { + c.x = d->colorSpaceOut->lut[0]->fromLinear(c.x); + c.y = d->colorSpaceOut->lut[1]->fromLinear(c.y); + c.z = d->colorSpaceOut->lut[2]->fromLinear(c.z); + } else { + c.x = d->colorSpaceOut->trc[0].applyInverse(c.x); + c.y = d->colorSpaceOut->trc[1].applyInverse(c.y); + c.z = d->colorSpaceOut->trc[2].applyInverse(c.z); + } + + return qRgba(c.x * 255 + 0.5f, c.y * 255 + 0.5f, c.z * 255 + 0.5f, qAlpha(argb)); +} + +/*! + Applies the color transformation on the QRgba64 value \a rgba64. + + The input should be opaque or unpremultiplied. +*/ +QRgba64 QColorTransform::map(const QRgba64 &rgba64) const +{ + if (!d_ptr) + return rgba64; + Q_D(const QColorTransform); + constexpr float f = 1.0f / 65535.0f; + QColorVector c = { rgba64.red() * f, rgba64.green() * f, rgba64.blue() * f }; + c.x = d->colorSpaceIn->trc[0].apply(c.x); + c.y = d->colorSpaceIn->trc[1].apply(c.y); + c.z = d->colorSpaceIn->trc[2].apply(c.z); + c = d->colorMatrix.map(c); + c.x = std::max(0.0f, std::min(1.0f, c.x)); + c.y = std::max(0.0f, std::min(1.0f, c.y)); + c.z = std::max(0.0f, std::min(1.0f, c.z)); + if (d->colorSpaceOut->lutsGenerated.loadAcquire()) { + c.x = d->colorSpaceOut->lut[0]->fromLinear(c.x); + c.y = d->colorSpaceOut->lut[1]->fromLinear(c.y); + c.z = d->colorSpaceOut->lut[2]->fromLinear(c.z); + } else { + c.x = d->colorSpaceOut->trc[0].applyInverse(c.x); + c.y = d->colorSpaceOut->trc[1].applyInverse(c.y); + c.z = d->colorSpaceOut->trc[2].applyInverse(c.z); + } + + return QRgba64::fromRgba64(c.x * 65535, c.y * 65535, c.z * 65535, rgba64.alpha()); +} + +/*! + Applies the color transformation on the QColor value \a color. + +*/ +QColor QColorTransform::map(const QColor &color) const +{ + if (!d_ptr) + return color; + Q_D(const QColorTransform); + QColorVector c = { (float)color.redF(), (float)color.greenF(), (float)color.blueF() }; + c.x = d->colorSpaceIn->trc[0].apply(c.x); + c.y = d->colorSpaceIn->trc[1].apply(c.y); + c.z = d->colorSpaceIn->trc[2].apply(c.z); + c = d->colorMatrix.map(c); + if (d_ptr->colorSpaceOut->lutsGenerated.loadAcquire()) { + c.x = d->colorSpaceOut->lut[0]->fromLinear(c.x); + c.y = d->colorSpaceOut->lut[1]->fromLinear(c.y); + c.z = d->colorSpaceOut->lut[2]->fromLinear(c.z); + } else { + c.x = d->colorSpaceOut->trc[0].applyInverse(c.x); + c.y = d->colorSpaceOut->trc[1].applyInverse(c.y); + c.z = d->colorSpaceOut->trc[2].applyInverse(c.z); + } + QColor out; + out.setRgbF(c.x, c.y, c.z, color.alphaF()); + return out; +} + +// Optimized sub-routines for fast block based conversion: + +static void applyMatrix(QColorVector *buffer, const qsizetype len, const QColorMatrix &colorMatrix) +{ +#if defined(__SSE2__) + const __m128 minV = _mm_set1_ps(0.0f); + const __m128 maxV = _mm_set1_ps(1.0f); + const __m128 xMat = _mm_loadu_ps(&colorMatrix.r.x); + const __m128 yMat = _mm_loadu_ps(&colorMatrix.g.x); + const __m128 zMat = _mm_loadu_ps(&colorMatrix.b.x); + for (qsizetype j = 0; j < len; ++j) { + __m128 c = _mm_loadu_ps(&buffer[j].x); + __m128 cx = _mm_shuffle_ps(c, c, _MM_SHUFFLE(0, 0, 0, 0)); + __m128 cy = _mm_shuffle_ps(c, c, _MM_SHUFFLE(1, 1, 1, 1)); + __m128 cz = _mm_shuffle_ps(c, c, _MM_SHUFFLE(2, 2, 2, 2)); + cx = _mm_mul_ps(cx, xMat); + cy = _mm_mul_ps(cy, yMat); + cz = _mm_mul_ps(cz, zMat); + cx = _mm_add_ps(cx, cy); + cx = _mm_add_ps(cx, cz); + // Clamp: + cx = _mm_min_ps(cx, maxV); + cx = _mm_max_ps(cx, minV); + _mm_storeu_ps(&buffer[j].x, cx); + } +#else + for (int j = 0; j < len; ++j) { + const QColorVector cv = colorMatrix.map(buffer[j]); + buffer[j].x = std::max(0.0f, std::min(1.0f, cv.x)); + buffer[j].y = std::max(0.0f, std::min(1.0f, cv.y)); + buffer[j].z = std::max(0.0f, std::min(1.0f, cv.z)); + } +#endif +} + +template<typename T> +static void loadPremultiplied(QColorVector *buffer, const T *src, const qsizetype len, const QColorTransformPrivate *d_ptr); +template<typename T> +static void loadUnpremultiplied(QColorVector *buffer, const T *src, const qsizetype len, const QColorTransformPrivate *d_ptr); + +#if defined(__SSE2__) +// Load to [0-alpha] in 4x32 SIMD +template<typename T> +static inline void loadP(const T &p, __m128i &v); + +template<> +inline void loadP<QRgb>(const QRgb &p, __m128i &v) +{ + v = _mm_cvtsi32_si128(p); +#if defined(__SSE4_1__) + v = _mm_cvtepu8_epi32(v); +#else + v = _mm_unpacklo_epi8(v, _mm_setzero_si128()); + v = _mm_unpacklo_epi16(v, _mm_setzero_si128()); +#endif +} + +template<> +inline void loadP<QRgba64>(const QRgba64 &p, __m128i &v) +{ + v = _mm_loadl_epi64((const __m128i *)&p); +#if defined(__SSE4_1__) + v = _mm_cvtepu16_epi32(v); +#else + v = _mm_unpacklo_epi16(v, _mm_setzero_si128()); +#endif + // Shuffle to ARGB as the template below expects it + v = _mm_shuffle_epi32(v, _MM_SHUFFLE(3, 0, 1, 2)); +} + +template<typename T> +static void loadPremultiplied(QColorVector *buffer, const T *src, const qsizetype len, const QColorTransformPrivate *d_ptr) +{ + const __m128 v4080 = _mm_set1_ps(4080.f); + const __m128 iFF00 = _mm_set1_ps(1.0f / (255 * 256)); + for (qsizetype i = 0; i < len; ++i) { + __m128i v; + loadP<T>(src[i], v); + __m128 vf = _mm_cvtepi32_ps(v); + // Approximate 1/a: + __m128 va = _mm_shuffle_ps(vf, vf, _MM_SHUFFLE(3, 3, 3, 3)); + __m128 via = _mm_rcp_ps(va); + via = _mm_sub_ps(_mm_add_ps(via, via), _mm_mul_ps(via, _mm_mul_ps(via, va))); + // v * (1/a) + vf = _mm_mul_ps(vf, via); + + // Handle zero alpha + __m128 vAlphaMask = _mm_cmpeq_ps(va, _mm_set1_ps(0.0f)); + vf = _mm_andnot_ps(vAlphaMask, vf); + + // LUT + v = _mm_cvtps_epi32(_mm_mul_ps(vf, v4080)); + const int ridx = _mm_extract_epi16(v, 4); + const int gidx = _mm_extract_epi16(v, 2); + const int bidx = _mm_extract_epi16(v, 0); + v = _mm_insert_epi16(v, d_ptr->colorSpaceIn->lut[0]->m_toLinear[ridx], 0); + v = _mm_insert_epi16(v, d_ptr->colorSpaceIn->lut[1]->m_toLinear[gidx], 2); + v = _mm_insert_epi16(v, d_ptr->colorSpaceIn->lut[2]->m_toLinear[bidx], 4); + vf = _mm_mul_ps(_mm_cvtepi32_ps(v), iFF00); + + _mm_storeu_ps(&buffer[i].x, vf); + } +} + +// Load to [0-4080] in 4x32 SIMD +template<typename T> +static inline void loadPU(const T &p, __m128i &v); + +template<> +inline void loadPU<QRgb>(const QRgb &p, __m128i &v) +{ + v = _mm_cvtsi32_si128(p); +#if defined(__SSE4_1__) + v = _mm_cvtepu8_epi32(v); +#else + v = _mm_unpacklo_epi8(v, _mm_setzero_si128()); + v = _mm_unpacklo_epi16(v, _mm_setzero_si128()); +#endif + v = _mm_slli_epi32(v, 4); +} + +template<> +inline void loadPU<QRgba64>(const QRgba64 &p, __m128i &v) +{ + v = _mm_loadl_epi64((const __m128i *)&p); + v = _mm_sub_epi16(v, _mm_srli_epi16(v, 8)); +#if defined(__SSE4_1__) + v = _mm_cvtepu16_epi32(v); +#else + v = _mm_unpacklo_epi16(v, _mm_setzero_si128()); +#endif + v = _mm_srli_epi32(v, 4); + // Shuffle to ARGB as the template below expects it + v = _mm_shuffle_epi32(v, _MM_SHUFFLE(3, 0, 1, 2)); +} + +template<typename T> +void loadUnpremultiplied(QColorVector *buffer, const T *src, const qsizetype len, const QColorTransformPrivate *d_ptr) +{ + const __m128 iFF00 = _mm_set1_ps(1.0f / (255 * 256)); + for (qsizetype i = 0; i < len; ++i) { + __m128i v; + loadPU<T>(src[i], v); + const int ridx = _mm_extract_epi16(v, 4); + const int gidx = _mm_extract_epi16(v, 2); + const int bidx = _mm_extract_epi16(v, 0); + v = _mm_insert_epi16(v, d_ptr->colorSpaceIn->lut[0]->m_toLinear[ridx], 0); + v = _mm_insert_epi16(v, d_ptr->colorSpaceIn->lut[1]->m_toLinear[gidx], 2); + v = _mm_insert_epi16(v, d_ptr->colorSpaceIn->lut[2]->m_toLinear[bidx], 4); + __m128 vf = _mm_mul_ps(_mm_cvtepi32_ps(v), iFF00); + _mm_storeu_ps(&buffer[i].x, vf); + } +} + +#else +template<> +void loadPremultiplied<QRgb>(QColorVector *buffer, const QRgb *src, const qsizetype len, const QColorTransformPrivate *d_ptr) +{ + for (qsizetype i = 0; i < len; ++i) { + const uint p = src[i]; + const int a = qAlpha(p); + if (a) { + const float ia = 4080.0f / a; + const int ridx = int(qRed(p) * ia + 0.5f); + const int gidx = int(qGreen(p) * ia + 0.5f); + const int bidx = int(qBlue(p) * ia + 0.5f); + buffer[i].x = d_ptr->colorSpaceIn->lut[0]->m_toLinear[ridx] * (1.0f / (255 * 256)); + buffer[i].y = d_ptr->colorSpaceIn->lut[1]->m_toLinear[gidx] * (1.0f / (255 * 256)); + buffer[i].z = d_ptr->colorSpaceIn->lut[2]->m_toLinear[bidx] * (1.0f / (255 * 256)); + } else { + buffer[i].x = buffer[i].y = buffer[i].z = 0.0f; + } + } +} + +template<> +void loadPremultiplied<QRgba64>(QColorVector *buffer, const QRgba64 *src, const qsizetype len, const QColorTransformPrivate *d_ptr) +{ + for (qsizetype i = 0; i < len; ++i) { + const QRgba64 &p = src[i]; + const int a = p.alpha(); + if (a) { + const float ia = 4080.0f / a; + const int ridx = int(p.red() * ia + 0.5f); + const int gidx = int(p.green() * ia + 0.5f); + const int bidx = int(p.blue() * ia + 0.5f); + buffer[i].x = d_ptr->colorSpaceIn->lut[0]->m_toLinear[ridx] * (1.0f / (255 * 256)); + buffer[i].y = d_ptr->colorSpaceIn->lut[1]->m_toLinear[gidx] * (1.0f / (255 * 256)); + buffer[i].z = d_ptr->colorSpaceIn->lut[2]->m_toLinear[bidx] * (1.0f / (255 * 256)); + } else { + buffer[i].x = buffer[i].y = buffer[i].z = 0.0f; + } + } +} + +template<> +void loadUnpremultiplied<QRgb>(QColorVector *buffer, const QRgb *src, const qsizetype len, const QColorTransformPrivate *d_ptr) +{ + for (qsizetype i = 0; i < len; ++i) { + const uint p = src[i]; + buffer[i].x = d_ptr->colorSpaceIn->lut[0]->u8ToLinearF32(qRed(p)); + buffer[i].y = d_ptr->colorSpaceIn->lut[1]->u8ToLinearF32(qGreen(p)); + buffer[i].z = d_ptr->colorSpaceIn->lut[2]->u8ToLinearF32(qBlue(p)); + } +} + +template<> +void loadUnpremultiplied<QRgba64>(QColorVector *buffer, const QRgba64 *src, const qsizetype len, const QColorTransformPrivate *d_ptr) +{ + for (qsizetype i = 0; i < len; ++i) { + const QRgba64 &p = src[i]; + buffer[i].x = d_ptr->colorSpaceIn->lut[0]->u16ToLinearF32(p.red()); + buffer[i].y = d_ptr->colorSpaceIn->lut[1]->u16ToLinearF32(p.green()); + buffer[i].z = d_ptr->colorSpaceIn->lut[2]->u16ToLinearF32(p.blue()); + } +} +#endif + +static void storePremultiplied(QRgb *dst, const QRgb *src, const QColorVector *buffer, const qsizetype len, + const QColorTransformPrivate *d_ptr) +{ +#if defined(__SSE2__) + const __m128 v4080 = _mm_set1_ps(4080.f); + const __m128 iFF00 = _mm_set1_ps(1.0f / (255 * 256)); + for (qsizetype i = 0; i < len; ++i) { + const int a = qAlpha(src[i]); + __m128 vf = _mm_loadu_ps(&buffer[i].x); + __m128i v = _mm_cvtps_epi32(_mm_mul_ps(vf, v4080)); + __m128 va = _mm_set1_ps(a); + va = _mm_mul_ps(va, iFF00); + const int ridx = _mm_extract_epi16(v, 0); + const int gidx = _mm_extract_epi16(v, 2); + const int bidx = _mm_extract_epi16(v, 4); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[0]->m_fromLinear[ridx], 4); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[1]->m_fromLinear[gidx], 2); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[2]->m_fromLinear[bidx], 0); + vf = _mm_cvtepi32_ps(v); + vf = _mm_mul_ps(vf, va); + v = _mm_cvtps_epi32(vf); + v = _mm_packs_epi32(v, v); + v = _mm_insert_epi16(v, a, 3); + v = _mm_packus_epi16(v, v); + dst[i] = _mm_cvtsi128_si32(v); + } +#else + for (qsizetype i = 0; i < len; ++i) { + const int a = qAlpha(src[i]); + const float fa = a / (255.0f * 256.0f); + const float r = d_ptr->colorSpaceOut->lut[0]->m_fromLinear[int(buffer[i].x * 4080.0f + 0.5f)]; + const float g = d_ptr->colorSpaceOut->lut[1]->m_fromLinear[int(buffer[i].y * 4080.0f + 0.5f)]; + const float b = d_ptr->colorSpaceOut->lut[2]->m_fromLinear[int(buffer[i].z * 4080.0f + 0.5f)]; + dst[i] = qRgba(r * fa + 0.5f, g * fa + 0.5f, b * fa + 0.5f, a); + } +#endif +} + +static void storeUnpremultiplied(QRgb *dst, const QRgb *src, const QColorVector *buffer, const qsizetype len, + const QColorTransformPrivate *d_ptr) +{ +#if defined(__SSE2__) + const __m128 v4080 = _mm_set1_ps(4080.f); + for (qsizetype i = 0; i < len; ++i) { + const int a = qAlpha(src[i]); + __m128 vf = _mm_loadu_ps(&buffer[i].x); + __m128i v = _mm_cvtps_epi32(_mm_mul_ps(vf, v4080)); + const int ridx = _mm_extract_epi16(v, 0); + const int gidx = _mm_extract_epi16(v, 2); + const int bidx = _mm_extract_epi16(v, 4); + v = _mm_setzero_si128(); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[0]->m_fromLinear[ridx], 2); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[1]->m_fromLinear[gidx], 1); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[2]->m_fromLinear[bidx], 0); + v = _mm_add_epi16(v, _mm_set1_epi16(0x80)); + v = _mm_srli_epi16(v, 8); + v = _mm_insert_epi16(v, a, 3); + v = _mm_packus_epi16(v, v); + dst[i] = _mm_cvtsi128_si32(v); + } +#else + for (qsizetype i = 0; i < len; ++i) { + const int r = d_ptr->colorSpaceOut->lut[0]->u8FromLinearF32(buffer[i].x); + const int g = d_ptr->colorSpaceOut->lut[1]->u8FromLinearF32(buffer[i].y); + const int b = d_ptr->colorSpaceOut->lut[2]->u8FromLinearF32(buffer[i].z); + dst[i] = (src[i] & 0xff000000) | (r << 16) | (g << 8) | (b << 0); + } +#endif +} + +static void storeOpaque(QRgb *dst, const QRgb *src, const QColorVector *buffer, const qsizetype len, + const QColorTransformPrivate *d_ptr) +{ + Q_UNUSED(src); +#if defined(__SSE2__) + const __m128 v4080 = _mm_set1_ps(4080.f); + for (qsizetype i = 0; i < len; ++i) { + __m128 vf = _mm_loadu_ps(&buffer[i].x); + __m128i v = _mm_cvtps_epi32(_mm_mul_ps(vf, v4080)); + const int ridx = _mm_extract_epi16(v, 0); + const int gidx = _mm_extract_epi16(v, 2); + const int bidx = _mm_extract_epi16(v, 4); + v = _mm_setzero_si128(); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[0]->m_fromLinear[ridx], 2); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[1]->m_fromLinear[gidx], 1); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[2]->m_fromLinear[bidx], 0); + v = _mm_add_epi16(v, _mm_set1_epi16(0x80)); + v = _mm_srli_epi16(v, 8); + v = _mm_insert_epi16(v, 255, 3); + v = _mm_packus_epi16(v, v); + dst[i] = _mm_cvtsi128_si32(v); + } +#else + for (qsizetype i = 0; i < len; ++i) { + const int r = d_ptr->colorSpaceOut->lut[0]->u8FromLinearF32(buffer[i].x); + const int g = d_ptr->colorSpaceOut->lut[1]->u8FromLinearF32(buffer[i].y); + const int b = d_ptr->colorSpaceOut->lut[2]->u8FromLinearF32(buffer[i].z); + dst[i] = 0xff000000 | (r << 16) | (g << 8) | (b << 0); + } +#endif +} + +static void storePremultiplied(QRgba64 *dst, const QRgba64 *src, const QColorVector *buffer, const qsizetype len, + const QColorTransformPrivate *d_ptr) +{ + for (qsizetype i = 0; i < len; ++i) { + const int a = src[i].alpha(); + const float fa = a / (255.0f * 256.0f); + const float r = d_ptr->colorSpaceOut->lut[0]->m_fromLinear[int(buffer[i].x * 4080.0f + 0.5f)]; + const float g = d_ptr->colorSpaceOut->lut[1]->m_fromLinear[int(buffer[i].y * 4080.0f + 0.5f)]; + const float b = d_ptr->colorSpaceOut->lut[2]->m_fromLinear[int(buffer[i].z * 4080.0f + 0.5f)]; + dst[i] = qRgba64(r * fa + 0.5f, g * fa + 0.5f, b * fa + 0.5f, a); + } +} + +static void storeUnpremultiplied(QRgba64 *dst, const QRgba64 *src, const QColorVector *buffer, const qsizetype len, + const QColorTransformPrivate *d_ptr) +{ + for (qsizetype i = 0; i < len; ++i) { + const int r = d_ptr->colorSpaceOut->lut[0]->u16FromLinearF32(buffer[i].x); + const int g = d_ptr->colorSpaceOut->lut[1]->u16FromLinearF32(buffer[i].y); + const int b = d_ptr->colorSpaceOut->lut[2]->u16FromLinearF32(buffer[i].z); + dst[i] = qRgba64(r, g, b, src[i].alpha()); + } +} + +static void storeOpaque(QRgba64 *dst, const QRgba64 *src, const QColorVector *buffer, const qsizetype len, + const QColorTransformPrivate *d_ptr) +{ + Q_UNUSED(src); + for (qsizetype i = 0; i < len; ++i) { + const int r = d_ptr->colorSpaceOut->lut[0]->u16FromLinearF32(buffer[i].x); + const int g = d_ptr->colorSpaceOut->lut[1]->u16FromLinearF32(buffer[i].y); + const int b = d_ptr->colorSpaceOut->lut[2]->u16FromLinearF32(buffer[i].z); + dst[i] = qRgba64(r, g, b, 0xFFFF); + } +} + +static constexpr qsizetype WorkBlockSize = 256; + +template<typename T> +void QColorTransformPrivate::apply(T *dst, const T *src, qsizetype count, TransformFlags flags) const +{ + if (!colorMatrix.isValid()) + return; + + updateLutsIn(); + updateLutsOut(); + + bool doApplyMatrix = (colorMatrix != QColorMatrix::identity()); + + QColorVector buffer[WorkBlockSize]; + qsizetype i = 0; + while (i < count) { + const qsizetype len = qMin(count - i, WorkBlockSize); + if (flags & InputPremultiplied) + loadPremultiplied(buffer, src + i, len, this); + else + loadUnpremultiplied(buffer, src + i, len, this); + + if (doApplyMatrix) + applyMatrix(buffer, len, colorMatrix); + + if (flags & InputOpaque) + storeOpaque(dst + i, src + i, buffer, len, this); + else if (flags & OutputPremultiplied) + storePremultiplied(dst + i, src + i, buffer, len, this); + else + storeUnpremultiplied(dst + i, src + i, buffer, len, this); + + i += len; + } +} + +/*! + \internal + \enum QColorTransformPrivate::TransformFlag + + Defines how the transform is to be applied. + + \value Unpremultiplied The input and output should both be unpremultiplied. + \value InputOpaque The input is guaranteed to be opaque. + \value InputPremultiplied The input is premultiplied. + \value OutputPremultiplied The output should be premultiplied. + \value Premultiplied Both input and output should both be premultiplied. +*/ + +/*! + \internal + Prepares a color transformation for fast application. You do not need to + call this explicitly as it will be called implicitly on the first transforms, but + if you want predictable performance on the first transforms, you can perform it + in advance. + + \sa QColorTransform::map(), apply() +*/ +void QColorTransformPrivate::prepare() +{ + updateLutsIn(); + updateLutsOut(); +} + +/*! + \internal + Applies the color transformation on \a count QRgb pixels starting from + \a src and stores the result in \a dst. + + Thread-safe if prepare() has been called first. + + Assumes unpremultiplied data by default. Set \a flags to change defaults. + + \sa prepare() +*/ +void QColorTransformPrivate::apply(QRgb *dst, const QRgb *src, qsizetype count, TransformFlags flags) const +{ + apply<QRgb>(dst, src, count, flags); +} + +/*! + \internal + Applies the color transformation on \a count QRgba64 pixels starting from + \a src and stores the result in \a dst. + + Thread-safe if prepare() has been called first. + + Assumes unpremultiplied data by default. Set \a flags to change defaults. + + \sa prepare() +*/ +void QColorTransformPrivate::apply(QRgba64 *dst, const QRgba64 *src, qsizetype count, TransformFlags flags) const +{ + apply<QRgba64>(dst, src, count, flags); +} + + +QT_END_NAMESPACE diff --git a/src/gui/painting/qcolortransform.h b/src/gui/painting/qcolortransform.h new file mode 100644 index 0000000000..9274387b97 --- /dev/null +++ b/src/gui/painting/qcolortransform.h @@ -0,0 +1,93 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QCOLORTRANSFORM_H +#define QCOLORTRANSFORM_H + +#include <QtGui/qtguiglobal.h> +#include <QtCore/qsharedpointer.h> +#include <QtGui/qrgb.h> + +QT_BEGIN_NAMESPACE + +class QColor; +class QRgba64; +class QColorSpacePrivate; +class QColorTransformPrivate; + +class Q_GUI_EXPORT QColorTransform +{ +public: + QColorTransform() noexcept : d_ptr(nullptr) { } + ~QColorTransform() noexcept; + QColorTransform(const QColorTransform &colorTransform) noexcept + : d_ptr(colorTransform.d_ptr) + { } + QColorTransform(QColorTransform &&colorTransform) noexcept + : d_ptr(std::move(colorTransform.d_ptr)) + { } + QColorTransform &operator=(const QColorTransform &other) noexcept + { + d_ptr = other.d_ptr; + return *this; + } + QColorTransform &operator=(QColorTransform &&other) noexcept + { + d_ptr = std::move(other.d_ptr); + return *this; + } + + bool isNull() const { return d_ptr.isNull(); } + + QRgb map(const QRgb &argb) const; + QRgba64 map(const QRgba64 &rgba64) const; + QColor map(const QColor &color) const; + +private: + friend class QColorSpace; + friend class QColorSpacePrivate; + friend class QImage; + + Q_DECLARE_PRIVATE(QColorTransform) + QSharedPointer<QColorTransformPrivate> d_ptr; +}; + +QT_END_NAMESPACE + +#endif // QCOLORTRANSFORM_H diff --git a/src/gui/painting/qcolortransform_p.h b/src/gui/painting/qcolortransform_p.h new file mode 100644 index 0000000000..74a1e7fe0a --- /dev/null +++ b/src/gui/painting/qcolortransform_p.h @@ -0,0 +1,89 @@ +/**************************************************************************** +** +** Copyright (C) 2019 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QCOLORTRANSFORM_P_H +#define QCOLORTRANSFORM_P_H + +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// + +#include "qcolormatrix_p.h" +#include "qcolorspace_p.h" + +QT_BEGIN_NAMESPACE + +class QColorTransformPrivate +{ +public: + QColorMatrix colorMatrix; + QExplicitlySharedDataPointer<const QColorSpacePrivate> colorSpaceIn; + QExplicitlySharedDataPointer<const QColorSpacePrivate> colorSpaceOut; + + void updateLutsIn() const; + void updateLutsOut() const; + bool simpleGammaCorrection() const; + + void prepare(); + enum TransformFlag { + Unpremultiplied = 0, + InputOpaque = 1, + InputPremultiplied = 2, + OutputPremultiplied = 4, + Premultiplied = (InputPremultiplied | OutputPremultiplied) + }; + Q_DECLARE_FLAGS(TransformFlags, TransformFlag) + + void apply(QRgb *dst, const QRgb *src, qsizetype count, TransformFlags flags = Unpremultiplied) const; + void apply(QRgba64 *dst, const QRgba64 *src, qsizetype count, TransformFlags flags = Unpremultiplied) const; + + template<typename T> + void apply(T *dst, const T *src, qsizetype count, TransformFlags flags) const; +}; + +QT_END_NAMESPACE + +#endif // QCOLORTRANSFORM_P_H diff --git a/src/gui/painting/qcolortrc_p.h b/src/gui/painting/qcolortrc_p.h new file mode 100644 index 0000000000..3a649f3756 --- /dev/null +++ b/src/gui/painting/qcolortrc_p.h @@ -0,0 +1,129 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QCOLORTRC_P_H +#define QCOLORTRC_P_H + +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// + +#include <QtGui/private/qtguiglobal_p.h> +#include "qcolortransferfunction_p.h" +#include "qcolortransfertable_p.h" + +QT_BEGIN_NAMESPACE + + +// Defines an ICC TRC (Tone Reproduction Curve) +class Q_GUI_EXPORT QColorTrc +{ +public: + QColorTrc() noexcept : m_type(Type::Uninitialized) + { } + QColorTrc(const QColorTransferFunction &fun) : m_type(Type::Function), m_fun(fun) + { } + QColorTrc(const QColorTransferTable &table) : m_type(Type::Table), m_table(table) + { } + + enum class Type { + Uninitialized, + Function, + Table + }; + + bool isLinear() const + { + return m_type == Type::Uninitialized || (m_type == Type::Function && m_fun.isLinear()); + } + bool isValid() const + { + return m_type != Type::Uninitialized; + } + float apply(float x) const + { + if (m_type == Type::Table) + return m_table.apply(x); + if (m_type == Type::Function) + return m_fun.apply(x); + return x; + } + + float applyInverse(float x) const + { + if (m_type == Type::Table) + return m_table.applyInverse(x); + if (m_type == Type::Function) + return m_fun.inverted().apply(x); + return x; + } + + friend inline bool operator!=(const QColorTrc &o1, const QColorTrc &o2); + friend inline bool operator==(const QColorTrc &o1, const QColorTrc &o2); + + Type m_type; + QColorTransferFunction m_fun; + QColorTransferTable m_table; +}; + +inline bool operator!=(const QColorTrc &o1, const QColorTrc &o2) +{ + if (o1.m_type != o2.m_type) + return true; + if (o1.m_type == QColorTrc::Type::Function) + return o1.m_fun != o2.m_fun; + if (o1.m_type == QColorTrc::Type::Table) + return o1.m_table != o2.m_table; + return false; +} +inline bool operator==(const QColorTrc &o1, const QColorTrc &o2) +{ + return !(o1 != o2); +} + +QT_END_NAMESPACE + +#endif // QCOLORTRC diff --git a/src/gui/painting/qcolorprofile.cpp b/src/gui/painting/qcolortrclut.cpp index 3b7b0a248b..268d7252b4 100644 --- a/src/gui/painting/qcolorprofile.cpp +++ b/src/gui/painting/qcolortrclut.cpp @@ -37,14 +37,16 @@ ** ****************************************************************************/ -#include "qcolorprofile_p.h" +#include "qcolortrclut_p.h" +#include "qcolortransferfunction_p.h" +#include "qcolortransfertable_p.h" #include <qmath.h> QT_BEGIN_NAMESPACE -QColorProfile *QColorProfile::fromGamma(qreal gamma) +QColorTrcLut *QColorTrcLut::fromGamma(qreal gamma) { - QColorProfile *cp = new QColorProfile; + QColorTrcLut *cp = new QColorTrcLut; for (int i = 0; i <= (255 * 16); ++i) { cp->m_toLinear[i] = ushort(qRound(qPow(i / qreal(255 * 16), gamma) * (255 * 256))); @@ -54,31 +56,28 @@ QColorProfile *QColorProfile::fromGamma(qreal gamma) return cp; } -static qreal srgbToLinear(qreal v) +QColorTrcLut *QColorTrcLut::fromTransferFunction(const QColorTransferFunction &fun) { - const qreal a = 0.055; - if (v <= qreal(0.04045)) - return v / qreal(12.92); - else - return qPow((v + a) / (qreal(1) + a), qreal(2.4)); -} + QColorTrcLut *cp = new QColorTrcLut; + QColorTransferFunction inv = fun.inverted(); -static qreal linearToSrgb(qreal v) -{ - const qreal a = 0.055; - if (v <= qreal(0.0031308)) - return v * qreal(12.92); - else - return (qreal(1) + a) * qPow(v, qreal(1.0 / 2.4)) - a; + for (int i = 0; i <= (255 * 16); ++i) { + cp->m_toLinear[i] = ushort(qRound(fun.apply(i / qreal(255 * 16)) * (255 * 256))); + cp->m_fromLinear[i] = ushort(qRound(inv.apply(i / qreal(255 * 16)) * (255 * 256))); + } + + return cp; } -QColorProfile *QColorProfile::fromSRgb() +QColorTrcLut *QColorTrcLut::fromTransferTable(const QColorTransferTable &table) { - QColorProfile *cp = new QColorProfile; + QColorTrcLut *cp = new QColorTrcLut; + float minInverse = 0.0f; for (int i = 0; i <= (255 * 16); ++i) { - cp->m_toLinear[i] = ushort(qRound(srgbToLinear(i / qreal(255 * 16)) * (255 * 256))); - cp->m_fromLinear[i] = ushort(qRound(linearToSrgb(i / qreal(255 * 16)) * (255 * 256))); + cp->m_toLinear[i] = ushort(qBound(0, qRound(table.apply(i / qreal(255 * 16)) * (255 * 256)), 65280)); + minInverse = table.applyInverse(i / qreal(255 * 16), minInverse); + cp->m_fromLinear[i] = ushort(qBound(0, qRound(minInverse * (255 * 256)), 65280)); } return cp; diff --git a/src/gui/painting/qcolorprofile_p.h b/src/gui/painting/qcolortrclut_p.h index 425e9abace..76a6a60803 100644 --- a/src/gui/painting/qcolorprofile_p.h +++ b/src/gui/painting/qcolortrclut_p.h @@ -37,8 +37,8 @@ ** ****************************************************************************/ -#ifndef QCOLORPROFILE_P_H -#define QCOLORPROFILE_P_H +#ifndef QCOLORTRCLUT_P_H +#define QCOLORTRCLUT_P_H // // W A R N I N G @@ -52,21 +52,29 @@ // #include <QtGui/private/qtguiglobal_p.h> +#include <QtCore/qsharedpointer.h> #include <QtGui/qrgb.h> #include <QtGui/qrgba64.h> +#include <cmath> + #if defined(__SSE2__) #include <emmintrin.h> #elif defined(__ARM_NEON__) || defined(__ARM_NEON) #include <arm_neon.h> #endif + QT_BEGIN_NAMESPACE -class Q_GUI_EXPORT QColorProfile +class QColorTransferFunction; +class QColorTransferTable; + +class Q_GUI_EXPORT QColorTrcLut : public QEnableSharedFromThis<QColorTrcLut> { public: - static QColorProfile *fromGamma(qreal gamma); - static QColorProfile *fromSRgb(); + static QColorTrcLut *fromGamma(qreal gamma); + static QColorTrcLut *fromTransferFunction(const QColorTransferFunction &transfn); + static QColorTrcLut *fromTransferTable(const QColorTransferTable &transTable); // The following methods all convert opaque or unpremultiplied colors: @@ -121,6 +129,25 @@ public: return convertWithTable(rgb64, m_toLinear); } + float u8ToLinearF32(int c) const + { + ushort v = m_toLinear[c << 4]; + return v * (1.0f / (255*256)); + } + + float u16ToLinearF32(int c) const + { + c -= (c >> 8); + ushort v = m_toLinear[c >> 4]; + return v * (1.0f / (255*256)); + } + + float toLinear(float f) const + { + ushort v = m_toLinear[(int)(f * (255 * 16) + 0.5f)]; + return v * (1.0f / (255*256)); + } + QRgb fromLinear64(QRgba64 rgb64) const { #if defined(__SSE2__) @@ -176,8 +203,31 @@ public: return convertWithTable(rgb64, m_fromLinear); } + int u8FromLinearF32(float f) const + { + ushort v = m_fromLinear[(int)(f * (255 * 16) + 0.5f)]; + return (v + 0x80) >> 8; + } + int u16FromLinearF32(float f) const + { + ushort v = m_fromLinear[(int)(f * (255 * 16) + 0.5f)]; + return v + (v >> 8); + } + float fromLinear(float f) const + { + ushort v = m_fromLinear[(int)(f * (255 * 16) + 0.5f)]; + return v * (1.0f / (255*256)); + } + + // We translate to 0-65280 (255*256) instead to 0-65535 to make simple + // shifting an accurate conversion. + // We translate from 0-4080 (255*16) for the same speed up, and to keep + // the tables small enough to fit in most inner caches. + ushort m_toLinear[(255 * 16) + 1]; // [0-4080] -> [0-65280] + ushort m_fromLinear[(255 * 16) + 1]; // [0-4080] -> [0-65280] + private: - QColorProfile() { } + QColorTrcLut() { } Q_ALWAYS_INLINE static QRgb convertWithTable(QRgb rgb32, const ushort *table) { @@ -230,16 +280,8 @@ private: return QRgba64::fromRgba64(r, g, b, rgb64.alpha()); #endif } - - // We translate to 0-65280 (255*256) instead to 0-65535 to make simple - // shifting an accurate conversion. - // We translate from 0-4080 (255*16) for the same speed up, and to keep - // the tables small enough to fit in most inner caches. - ushort m_toLinear[(255 * 16) + 1]; // [0-4080] -> [0-65280] - ushort m_fromLinear[(255 * 16) + 1]; // [0-4080] -> [0-65280] - }; QT_END_NAMESPACE -#endif // QCOLORPROFILE_P_H +#endif // QCOLORTRCLUT_P_H diff --git a/src/gui/painting/qcompositionfunctions.cpp b/src/gui/painting/qcompositionfunctions.cpp index 027bf23115..06a849e790 100644 --- a/src/gui/painting/qcompositionfunctions.cpp +++ b/src/gui/painting/qcompositionfunctions.cpp @@ -137,6 +137,7 @@ struct Rgba64OperationsBase { ::memcpy(dest, src, len * sizeof(Type)); } }; +#if QT_CONFIG(raster_64bit) const Rgba64OperationsBase::Type Rgba64OperationsBase::clear = QRgba64::fromRgba64(0); struct Rgba64OperationsC : public Rgba64OperationsBase @@ -309,10 +310,8 @@ struct Rgba64OperationsNEON : public Rgba64OperationsBase return interpolate65535(x, a1, y, a2); } }; - #endif -typedef Argb32OperationsC Argb32Operations; #if defined(__SSE2__) typedef Rgba64OperationsSSE2 Rgba64Operations; #elif defined(__ARM_NEON__) @@ -320,6 +319,9 @@ typedef Rgba64OperationsNEON Rgba64Operations; #else typedef Rgba64OperationsC Rgba64Operations; #endif +#endif // QT_CONFIG(raster_64bit) + +typedef Argb32OperationsC Argb32Operations; /* result = 0 @@ -343,20 +345,23 @@ void QT_FASTCALL comp_func_solid_Clear(uint *dest, int length, uint, uint const_ comp_func_Clear_template<Argb32Operations>(dest, length, const_alpha); } -void QT_FASTCALL comp_func_solid_Clear_rgb64(QRgba64 *dest, int length, QRgba64, uint const_alpha) +void QT_FASTCALL comp_func_Clear(uint *dest, const uint *, int length, uint const_alpha) { - comp_func_Clear_template<Rgba64Operations>(dest, length, const_alpha); + comp_func_Clear_template<Argb32Operations>(dest, length, const_alpha); } -void QT_FASTCALL comp_func_Clear(uint *dest, const uint *, int length, uint const_alpha) +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_Clear_rgb64(QRgba64 *dest, int length, QRgba64, uint const_alpha) { - comp_func_Clear_template<Argb32Operations>(dest, length, const_alpha); + comp_func_Clear_template<Rgba64Operations>(dest, length, const_alpha); } void QT_FASTCALL comp_func_Clear_rgb64(QRgba64 *dest, const QRgba64 *, int length, uint const_alpha) { comp_func_Clear_template<Rgba64Operations>(dest, length, const_alpha); } +#endif + /* result = s @@ -399,36 +404,40 @@ void QT_FASTCALL comp_func_solid_Source(uint *dest, int length, uint color, uint comp_func_solid_Source_template<Argb32Operations>(dest, length, color, const_alpha); } -void QT_FASTCALL comp_func_solid_Source_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) +void QT_FASTCALL comp_func_Source(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) { - comp_func_solid_Source_template<Rgba64Operations>(dest, length, color, const_alpha); + comp_func_Source_template<Argb32Operations>(dest, src, length, const_alpha); } -void QT_FASTCALL comp_func_Source(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_Source_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { - comp_func_Source_template<Argb32Operations>(dest, src, length, const_alpha); + comp_func_solid_Source_template<Rgba64Operations>(dest, length, color, const_alpha); } void QT_FASTCALL comp_func_Source_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { comp_func_Source_template<Rgba64Operations>(dest, src, length, const_alpha); } +#endif void QT_FASTCALL comp_func_solid_Destination(uint *, int, uint, uint) { } -void QT_FASTCALL comp_func_solid_Destination_rgb64(QRgba64 *, int, QRgba64, uint) +void QT_FASTCALL comp_func_Destination(uint *, const uint *, int, uint) { } -void QT_FASTCALL comp_func_Destination(uint *, const uint *, int, uint) +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_Destination_rgb64(QRgba64 *, int, QRgba64, uint) { } void QT_FASTCALL comp_func_Destination_rgb64(QRgba64 *, const QRgba64 *, int, uint) { } +#endif /* result = s + d * sia @@ -483,20 +492,22 @@ void QT_FASTCALL comp_func_solid_SourceOver(uint *dest, int length, uint color, comp_func_solid_SourceOver_template<Argb32Operations>(dest, length, color, const_alpha); } -void QT_FASTCALL comp_func_solid_SourceOver_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) +void QT_FASTCALL comp_func_SourceOver(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) { - comp_func_solid_SourceOver_template<Rgba64Operations>(dest, length, color, const_alpha); + comp_func_SourceOver_template<Argb32Operations>(dest, src, length, const_alpha); } -void QT_FASTCALL comp_func_SourceOver(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_SourceOver_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { - comp_func_SourceOver_template<Argb32Operations>(dest, src, length, const_alpha); + comp_func_solid_SourceOver_template<Rgba64Operations>(dest, length, color, const_alpha); } void QT_FASTCALL comp_func_SourceOver_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { comp_func_SourceOver_template<Rgba64Operations>(dest, src, length, const_alpha); } +#endif /* result = d + s * dia @@ -542,20 +553,22 @@ void QT_FASTCALL comp_func_solid_DestinationOver(uint *dest, int length, uint co comp_func_solid_DestinationOver_template<Argb32Operations>(dest, length, color, const_alpha); } -void QT_FASTCALL comp_func_solid_DestinationOver_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) +void QT_FASTCALL comp_func_DestinationOver(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) { - comp_func_solid_DestinationOver_template<Rgba64Operations>(dest, length, color, const_alpha); + comp_func_DestinationOver_template<Argb32Operations>(dest, src, length, const_alpha); } -void QT_FASTCALL comp_func_DestinationOver(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_DestinationOver_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { - comp_func_DestinationOver_template<Argb32Operations>(dest, src, length, const_alpha); + comp_func_solid_DestinationOver_template<Rgba64Operations>(dest, length, color, const_alpha); } void QT_FASTCALL comp_func_DestinationOver_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { comp_func_DestinationOver_template<Rgba64Operations>(dest, src, length, const_alpha); } +#endif /* result = s * da @@ -606,20 +619,22 @@ void QT_FASTCALL comp_func_solid_SourceIn(uint *dest, int length, uint color, ui comp_func_solid_SourceIn_template<Argb32Operations>(dest, length, color, const_alpha); } -void QT_FASTCALL comp_func_solid_SourceIn_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) +void QT_FASTCALL comp_func_SourceIn(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) { - comp_func_solid_SourceIn_template<Rgba64Operations>(dest, length, color, const_alpha); + comp_func_SourceIn_template<Argb32Operations>(dest, src, length, const_alpha); } -void QT_FASTCALL comp_func_SourceIn(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_SourceIn_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { - comp_func_SourceIn_template<Argb32Operations>(dest, src, length, const_alpha); + comp_func_solid_SourceIn_template<Rgba64Operations>(dest, length, color, const_alpha); } void QT_FASTCALL comp_func_SourceIn_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { comp_func_SourceIn_template<Rgba64Operations>(dest, src, length, const_alpha); } +#endif /* result = d * sa @@ -665,20 +680,22 @@ void QT_FASTCALL comp_func_solid_DestinationIn(uint *dest, int length, uint colo comp_func_solid_DestinationIn_template<Argb32Operations>(dest, length, color, const_alpha); } -void QT_FASTCALL comp_func_solid_DestinationIn_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) +void QT_FASTCALL comp_func_DestinationIn(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) { - comp_func_solid_DestinationIn_template<Rgba64Operations>(dest, length, color, const_alpha); + comp_func_DestinationIn_template<Argb32Operations>(dest, src, length, const_alpha); } -void QT_FASTCALL comp_func_DestinationIn(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_DestinationIn_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { - comp_func_DestinationIn_template<Argb32Operations>(dest, src, length, const_alpha); + comp_func_solid_DestinationIn_template<Rgba64Operations>(dest, length, color, const_alpha); } void QT_FASTCALL comp_func_DestinationIn_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { comp_func_DestinationIn_template<Rgba64Operations>(dest, src, length, const_alpha); } +#endif /* result = s * dia @@ -727,20 +744,22 @@ void QT_FASTCALL comp_func_solid_SourceOut(uint *dest, int length, uint color, u comp_func_solid_SourceOut_template<Argb32Operations>(dest, length, color, const_alpha); } -void QT_FASTCALL comp_func_solid_SourceOut_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) +void QT_FASTCALL comp_func_SourceOut(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) { - comp_func_solid_SourceOut_template<Rgba64Operations>(dest, length, color, const_alpha); + comp_func_SourceOut_template<Argb32Operations>(dest, src, length, const_alpha); } -void QT_FASTCALL comp_func_SourceOut(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_SourceOut_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { - comp_func_SourceOut_template<Argb32Operations>(dest, src, length, const_alpha); + comp_func_solid_SourceOut_template<Rgba64Operations>(dest, length, color, const_alpha); } void QT_FASTCALL comp_func_SourceOut_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { comp_func_SourceOut_template<Rgba64Operations>(dest, src, length, const_alpha); } +#endif /* result = d * sia @@ -786,20 +805,22 @@ void QT_FASTCALL comp_func_solid_DestinationOut(uint *dest, int length, uint col comp_func_solid_DestinationOut_template<Argb32Operations>(dest, length, color, const_alpha); } -void QT_FASTCALL comp_func_solid_DestinationOut_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) +void QT_FASTCALL comp_func_DestinationOut(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) { - comp_func_solid_DestinationOut_template<Rgba64Operations>(dest, length, color, const_alpha); + comp_func_DestinationOut_template<Argb32Operations>(dest, src, length, const_alpha); } -void QT_FASTCALL comp_func_DestinationOut(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_DestinationOut_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { - comp_func_DestinationOut_template<Argb32Operations>(dest, src, length, const_alpha); + comp_func_solid_DestinationOut_template<Rgba64Operations>(dest, length, color, const_alpha); } void QT_FASTCALL comp_func_DestinationOut_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { comp_func_DestinationOut_template<Rgba64Operations>(dest, src, length, const_alpha); } +#endif /* result = s*da + d*sia @@ -845,20 +866,22 @@ void QT_FASTCALL comp_func_solid_SourceAtop(uint *dest, int length, uint color, comp_func_solid_SourceAtop_template<Argb32Operations>(dest, length, color, const_alpha); } -void QT_FASTCALL comp_func_solid_SourceAtop_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) +void QT_FASTCALL comp_func_SourceAtop(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) { - comp_func_solid_SourceAtop_template<Rgba64Operations>(dest, length, color, const_alpha); + comp_func_SourceAtop_template<Argb32Operations>(dest, src, length, const_alpha); } -void QT_FASTCALL comp_func_SourceAtop(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_SourceAtop_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { - comp_func_SourceAtop_template<Argb32Operations>(dest, src, length, const_alpha); + comp_func_solid_SourceAtop_template<Rgba64Operations>(dest, length, color, const_alpha); } void QT_FASTCALL comp_func_SourceAtop_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { comp_func_SourceAtop_template<Rgba64Operations>(dest, src, length, const_alpha); } +#endif /* result = d*sa + s*dia @@ -909,20 +932,22 @@ void QT_FASTCALL comp_func_solid_DestinationAtop(uint *dest, int length, uint co comp_func_solid_DestinationAtop_template<Argb32Operations>(dest, length, color, const_alpha); } -void QT_FASTCALL comp_func_solid_DestinationAtop_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) +void QT_FASTCALL comp_func_DestinationAtop(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) { - comp_func_solid_DestinationAtop_template<Rgba64Operations>(dest, length, color, const_alpha); + comp_func_DestinationAtop_template<Argb32Operations>(dest, src, length, const_alpha); } -void QT_FASTCALL comp_func_DestinationAtop(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_DestinationAtop_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { - comp_func_DestinationAtop_template<Argb32Operations>(dest, src, length, const_alpha); + comp_func_solid_DestinationAtop_template<Rgba64Operations>(dest, length, color, const_alpha); } void QT_FASTCALL comp_func_DestinationAtop_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { comp_func_DestinationAtop_template<Rgba64Operations>(dest, src, length, const_alpha); } +#endif /* result = d*sia + s*dia @@ -969,20 +994,22 @@ void QT_FASTCALL comp_func_solid_XOR(uint *dest, int length, uint color, uint co comp_func_solid_XOR_template<Argb32Operations>(dest, length, color, const_alpha); } -void QT_FASTCALL comp_func_solid_XOR_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) +void QT_FASTCALL comp_func_XOR(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) { - comp_func_solid_XOR_template<Rgba64Operations>(dest, length, color, const_alpha); + comp_func_XOR_template<Argb32Operations>(dest, src, length, const_alpha); } -void QT_FASTCALL comp_func_XOR(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_XOR_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { - comp_func_XOR_template<Argb32Operations>(dest, src, length, const_alpha); + comp_func_solid_XOR_template<Rgba64Operations>(dest, length, color, const_alpha); } void QT_FASTCALL comp_func_XOR_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { comp_func_XOR_template<Rgba64Operations>(dest, src, length, const_alpha); } +#endif struct QFullCoverage { inline void store(uint *dest, const uint src) const @@ -1078,20 +1105,22 @@ void QT_FASTCALL comp_func_solid_Plus(uint *dest, int length, uint color, uint c comp_func_solid_Plus_template<Argb32Operations>(dest, length, color, const_alpha); } -void QT_FASTCALL comp_func_solid_Plus_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) +void QT_FASTCALL comp_func_Plus(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) { - comp_func_solid_Plus_template<Rgba64Operations>(dest, length, color, const_alpha); + comp_func_Plus_template<Argb32Operations>(dest, src, length, const_alpha); } -void QT_FASTCALL comp_func_Plus(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_Plus_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { - comp_func_Plus_template<Argb32Operations>(dest, src, length, const_alpha); + comp_func_solid_Plus_template<Rgba64Operations>(dest, length, color, const_alpha); } void QT_FASTCALL comp_func_Plus_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { comp_func_Plus_template<Rgba64Operations>(dest, src, length, const_alpha); } +#endif /* Dca' = Sca.Dca + Sca.(1 - Da) + Dca.(1 - Sa) @@ -1101,13 +1130,8 @@ static inline int multiply_op(int dst, int src, int da, int sa) return qt_div_255(src * dst + src * (255 - da) + dst * (255 - sa)); } -static inline uint multiply_op_rgb64(uint dst, uint src, uint da, uint sa) -{ - return qt_div_65535(src * dst + src * (65535 - da) + dst * (65535 - sa)); -} - template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Multiply_impl(uint *dest, int length, uint color, const T &coverage) +static inline void comp_func_solid_Multiply_impl(uint *dest, int length, uint color, const T &coverage) { int sa = qAlpha(color); int sr = qRed(color); @@ -1129,8 +1153,22 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Multiply_impl(uint *dest, } } +void QT_FASTCALL comp_func_solid_Multiply(uint *dest, int length, uint color, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_solid_Multiply_impl(dest, length, color, QFullCoverage()); + else + comp_func_solid_Multiply_impl(dest, length, color, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) +static inline uint multiply_op_rgb64(uint dst, uint src, uint da, uint sa) +{ + return qt_div_65535(src * dst + src * (65535 - da) + dst * (65535 - sa)); +} + template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Multiply_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) +static inline void comp_func_solid_Multiply_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) { uint sa = color.alpha(); uint sr = color.red(); @@ -1152,14 +1190,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Multiply_impl(QRgba64 *de } } -void QT_FASTCALL comp_func_solid_Multiply(uint *dest, int length, uint color, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_solid_Multiply_impl(dest, length, color, QFullCoverage()); - else - comp_func_solid_Multiply_impl(dest, length, color, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_solid_Multiply_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { if (const_alpha == 255) @@ -1167,9 +1197,10 @@ void QT_FASTCALL comp_func_solid_Multiply_rgb64(QRgba64 *dest, int length, QRgba else comp_func_solid_Multiply_impl(dest, length, color, QPartialCoverage(const_alpha)); } +#endif template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Multiply_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Multiply_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { uint d = dest[i]; @@ -1189,8 +1220,17 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Multiply_impl(uint *Q_DECL_REST } } +void QT_FASTCALL comp_func_Multiply(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_Multiply_impl(dest, src, length, QFullCoverage()); + else + comp_func_Multiply_impl(dest, src, length, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Multiply_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Multiply_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { QRgba64 d = dest[i]; @@ -1210,14 +1250,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Multiply_impl(QRgba64 *Q_DECL_R } } -void QT_FASTCALL comp_func_Multiply(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_Multiply_impl(dest, src, length, QFullCoverage()); - else - comp_func_Multiply_impl(dest, src, length, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_Multiply_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { if (const_alpha == 255) @@ -1225,13 +1257,14 @@ void QT_FASTCALL comp_func_Multiply_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const Q else comp_func_Multiply_impl(dest, src, length, QPartialCoverage(const_alpha)); } +#endif /* Dca' = (Sca.Da + Dca.Sa - Sca.Dca) + Sca.(1 - Da) + Dca.(1 - Sa) = Sca + Dca - Sca.Dca */ template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Screen_impl(uint *dest, int length, uint color, const T &coverage) +static inline void comp_func_solid_Screen_impl(uint *dest, int length, uint color, const T &coverage) { int sa = qAlpha(color); int sr = qRed(color); @@ -1253,8 +1286,17 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Screen_impl(uint *dest, i } } +void QT_FASTCALL comp_func_solid_Screen(uint *dest, int length, uint color, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_solid_Screen_impl(dest, length, color, QFullCoverage()); + else + comp_func_solid_Screen_impl(dest, length, color, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Screen_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) +static inline void comp_func_solid_Screen_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) { uint sa = color.alpha(); uint sr = color.red(); @@ -1276,14 +1318,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Screen_impl(QRgba64 *dest } } -void QT_FASTCALL comp_func_solid_Screen(uint *dest, int length, uint color, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_solid_Screen_impl(dest, length, color, QFullCoverage()); - else - comp_func_solid_Screen_impl(dest, length, color, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_solid_Screen_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { if (const_alpha == 255) @@ -1291,9 +1325,10 @@ void QT_FASTCALL comp_func_solid_Screen_rgb64(QRgba64 *dest, int length, QRgba64 else comp_func_solid_Screen_impl(dest, length, color, QPartialCoverage(const_alpha)); } +#endif template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Screen_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Screen_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { uint d = dest[i]; @@ -1313,8 +1348,17 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Screen_impl(uint *Q_DECL_RESTRI } } +void QT_FASTCALL comp_func_Screen(uint *dest, const uint *src, int length, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_Screen_impl(dest, src, length, QFullCoverage()); + else + comp_func_Screen_impl(dest, src, length, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Screen_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Screen_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { QRgba64 d = dest[i]; @@ -1334,14 +1378,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Screen_impl(QRgba64 *Q_DECL_RES } } -void QT_FASTCALL comp_func_Screen(uint *dest, const uint *src, int length, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_Screen_impl(dest, src, length, QFullCoverage()); - else - comp_func_Screen_impl(dest, src, length, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_Screen_rgb64(QRgba64 *dest, const QRgba64 *src, int length, uint const_alpha) { if (const_alpha == 255) @@ -1349,6 +1385,7 @@ void QT_FASTCALL comp_func_Screen_rgb64(QRgba64 *dest, const QRgba64 *src, int l else comp_func_Screen_impl(dest, src, length, QPartialCoverage(const_alpha)); } +#endif /* if 2.Dca < Da @@ -1365,17 +1402,8 @@ static inline int overlay_op(int dst, int src, int da, int sa) return qt_div_255(sa * da - 2 * (da - dst) * (sa - src) + temp); } -static inline uint overlay_op_rgb64(uint dst, uint src, uint da, uint sa) -{ - const uint temp = src * (65535 - da) + dst * (65535 - sa); - if (2 * dst < da) - return qt_div_65535(2 * src * dst + temp); - else - return qt_div_65535(sa * da - 2 * (da - dst) * (sa - src) + temp); -} - template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Overlay_impl(uint *dest, int length, uint color, const T &coverage) +static inline void comp_func_solid_Overlay_impl(uint *dest, int length, uint color, const T &coverage) { int sa = qAlpha(color); int sr = qRed(color); @@ -1397,8 +1425,26 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Overlay_impl(uint *dest, } } +void QT_FASTCALL comp_func_solid_Overlay(uint *dest, int length, uint color, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_solid_Overlay_impl(dest, length, color, QFullCoverage()); + else + comp_func_solid_Overlay_impl(dest, length, color, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) +static inline uint overlay_op_rgb64(uint dst, uint src, uint da, uint sa) +{ + const uint temp = src * (65535 - da) + dst * (65535 - sa); + if (2 * dst < da) + return qt_div_65535(2 * src * dst + temp); + else + return qt_div_65535(sa * da - 2 * (da - dst) * (sa - src) + temp); +} + template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Overlay_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) +static inline void comp_func_solid_Overlay_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) { uint sa = color.alpha(); uint sr = color.red(); @@ -1420,14 +1466,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Overlay_impl(QRgba64 *des } } -void QT_FASTCALL comp_func_solid_Overlay(uint *dest, int length, uint color, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_solid_Overlay_impl(dest, length, color, QFullCoverage()); - else - comp_func_solid_Overlay_impl(dest, length, color, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_solid_Overlay_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { if (const_alpha == 255) @@ -1435,9 +1473,10 @@ void QT_FASTCALL comp_func_solid_Overlay_rgb64(QRgba64 *dest, int length, QRgba6 else comp_func_solid_Overlay_impl(dest, length, color, QPartialCoverage(const_alpha)); } +#endif template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Overlay_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Overlay_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { uint d = dest[i]; @@ -1457,8 +1496,17 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Overlay_impl(uint *Q_DECL_RESTR } } +void QT_FASTCALL comp_func_Overlay(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_Overlay_impl(dest, src, length, QFullCoverage()); + else + comp_func_Overlay_impl(dest, src, length, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Overlay_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Overlay_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { QRgba64 d = dest[i]; @@ -1478,14 +1526,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Overlay_impl(QRgba64 *Q_DECL_RE } } -void QT_FASTCALL comp_func_Overlay(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_Overlay_impl(dest, src, length, QFullCoverage()); - else - comp_func_Overlay_impl(dest, src, length, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_Overlay_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { if (const_alpha == 255) @@ -1493,6 +1533,7 @@ void QT_FASTCALL comp_func_Overlay_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QR else comp_func_Overlay_impl(dest, src, length, QPartialCoverage(const_alpha)); } +#endif /* Dca' = min(Sca.Da, Dca.Sa) + Sca.(1 - Da) + Dca.(1 - Sa) @@ -1503,13 +1544,8 @@ static inline int darken_op(int dst, int src, int da, int sa) return qt_div_255(qMin(src * da, dst * sa) + src * (255 - da) + dst * (255 - sa)); } -static inline uint darken_op_rgb64(uint dst, uint src, uint da, uint sa) -{ - return qt_div_65535(qMin(src * da, dst * sa) + src * (65535 - da) + dst * (65535 - sa)); -} - template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Darken_impl(uint *dest, int length, uint color, const T &coverage) +static inline void comp_func_solid_Darken_impl(uint *dest, int length, uint color, const T &coverage) { int sa = qAlpha(color); int sr = qRed(color); @@ -1531,8 +1567,22 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Darken_impl(uint *dest, i } } +void QT_FASTCALL comp_func_solid_Darken(uint *dest, int length, uint color, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_solid_Darken_impl(dest, length, color, QFullCoverage()); + else + comp_func_solid_Darken_impl(dest, length, color, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) +static inline uint darken_op_rgb64(uint dst, uint src, uint da, uint sa) +{ + return qt_div_65535(qMin(src * da, dst * sa) + src * (65535 - da) + dst * (65535 - sa)); +} + template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Darken_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) +static inline void comp_func_solid_Darken_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) { uint sa = color.alpha(); uint sr = color.red(); @@ -1554,14 +1604,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Darken_impl(QRgba64 *dest } } -void QT_FASTCALL comp_func_solid_Darken(uint *dest, int length, uint color, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_solid_Darken_impl(dest, length, color, QFullCoverage()); - else - comp_func_solid_Darken_impl(dest, length, color, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_solid_Darken_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { if (const_alpha == 255) @@ -1569,9 +1611,10 @@ void QT_FASTCALL comp_func_solid_Darken_rgb64(QRgba64 *dest, int length, QRgba64 else comp_func_solid_Darken_impl(dest, length, color, QPartialCoverage(const_alpha)); } +#endif template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Darken_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Darken_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { uint d = dest[i]; @@ -1591,8 +1634,17 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Darken_impl(uint *Q_DECL_RESTRI } } +void QT_FASTCALL comp_func_Darken(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_Darken_impl(dest, src, length, QFullCoverage()); + else + comp_func_Darken_impl(dest, src, length, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Darken_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Darken_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { QRgba64 d = dest[i]; @@ -1612,14 +1664,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Darken_impl(QRgba64 *Q_DECL_RES } } -void QT_FASTCALL comp_func_Darken(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_Darken_impl(dest, src, length, QFullCoverage()); - else - comp_func_Darken_impl(dest, src, length, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_Darken_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { if (const_alpha == 255) @@ -1627,6 +1671,7 @@ void QT_FASTCALL comp_func_Darken_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRg else comp_func_Darken_impl(dest, src, length, QPartialCoverage(const_alpha)); } +#endif /* Dca' = max(Sca.Da, Dca.Sa) + Sca.(1 - Da) + Dca.(1 - Sa) @@ -1637,13 +1682,8 @@ static inline int lighten_op(int dst, int src, int da, int sa) return qt_div_255(qMax(src * da, dst * sa) + src * (255 - da) + dst * (255 - sa)); } -static inline uint lighten_op_rgb64(uint dst, uint src, uint da, uint sa) -{ - return qt_div_65535(qMax(src * da, dst * sa) + src * (65535 - da) + dst * (65535 - sa)); -} - template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Lighten_impl(uint *dest, int length, uint color, const T &coverage) +static inline void comp_func_solid_Lighten_impl(uint *dest, int length, uint color, const T &coverage) { int sa = qAlpha(color); int sr = qRed(color); @@ -1665,8 +1705,23 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Lighten_impl(uint *dest, } } +void QT_FASTCALL comp_func_solid_Lighten(uint *dest, int length, uint color, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_solid_Lighten_impl(dest, length, color, QFullCoverage()); + else + comp_func_solid_Lighten_impl(dest, length, color, QPartialCoverage(const_alpha)); +} + + +#if QT_CONFIG(raster_64bit) +static inline uint lighten_op_rgb64(uint dst, uint src, uint da, uint sa) +{ + return qt_div_65535(qMax(src * da, dst * sa) + src * (65535 - da) + dst * (65535 - sa)); +} + template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Lighten_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) +static inline void comp_func_solid_Lighten_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) { uint sa = color.alpha(); uint sr = color.red(); @@ -1688,14 +1743,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Lighten_impl(QRgba64 *des } } -void QT_FASTCALL comp_func_solid_Lighten(uint *dest, int length, uint color, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_solid_Lighten_impl(dest, length, color, QFullCoverage()); - else - comp_func_solid_Lighten_impl(dest, length, color, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_solid_Lighten_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { if (const_alpha == 255) @@ -1703,9 +1750,10 @@ void QT_FASTCALL comp_func_solid_Lighten_rgb64(QRgba64 *dest, int length, QRgba6 else comp_func_solid_Lighten_impl(dest, length, color, QPartialCoverage(const_alpha)); } +#endif template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Lighten_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Lighten_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { uint d = dest[i]; @@ -1725,8 +1773,17 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Lighten_impl(uint *Q_DECL_RESTR } } +void QT_FASTCALL comp_func_Lighten(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_Lighten_impl(dest, src, length, QFullCoverage()); + else + comp_func_Lighten_impl(dest, src, length, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Lighten_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Lighten_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { QRgba64 d = dest[i]; @@ -1746,14 +1803,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Lighten_impl(QRgba64 *Q_DECL_RE } } -void QT_FASTCALL comp_func_Lighten(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_Lighten_impl(dest, src, length, QFullCoverage()); - else - comp_func_Lighten_impl(dest, src, length, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_Lighten_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { if (const_alpha == 255) @@ -1761,6 +1810,7 @@ void QT_FASTCALL comp_func_Lighten_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QR else comp_func_Lighten_impl(dest, src, length, QPartialCoverage(const_alpha)); } +#endif /* if Sca.Da + Dca.Sa >= Sa.Da @@ -1781,21 +1831,8 @@ static inline int color_dodge_op(int dst, int src, int da, int sa) return qt_div_255(255 * dst_sa / (255 - 255 * src / sa) + temp); } -static inline uint color_dodge_op_rgb64(qint64 dst, qint64 src, qint64 da, qint64 sa) -{ - const qint64 sa_da = sa * da; - const qint64 dst_sa = dst * sa; - const qint64 src_da = src * da; - - const qint64 temp = src * (65535 - da) + dst * (65535 - sa); - if (src_da + dst_sa >= sa_da) - return qt_div_65535(sa_da + temp); - else - return qt_div_65535(65535 * dst_sa / (65535 - 65535 * src / sa) + temp); -} - template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_ColorDodge_impl(uint *dest, int length, uint color, const T &coverage) +static inline void comp_func_solid_ColorDodge_impl(uint *dest, int length, uint color, const T &coverage) { int sa = qAlpha(color); int sr = qRed(color); @@ -1817,8 +1854,30 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_ColorDodge_impl(uint *des } } +void QT_FASTCALL comp_func_solid_ColorDodge(uint *dest, int length, uint color, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_solid_ColorDodge_impl(dest, length, color, QFullCoverage()); + else + comp_func_solid_ColorDodge_impl(dest, length, color, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) +static inline uint color_dodge_op_rgb64(qint64 dst, qint64 src, qint64 da, qint64 sa) +{ + const qint64 sa_da = sa * da; + const qint64 dst_sa = dst * sa; + const qint64 src_da = src * da; + + const qint64 temp = src * (65535 - da) + dst * (65535 - sa); + if (src_da + dst_sa >= sa_da) + return qt_div_65535(sa_da + temp); + else + return qt_div_65535(65535 * dst_sa / (65535 - 65535 * src / sa) + temp); +} + template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_ColorDodge_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) +static inline void comp_func_solid_ColorDodge_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) { uint sa = color.alpha(); uint sr = color.red(); @@ -1840,14 +1899,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_ColorDodge_impl(QRgba64 * } } -void QT_FASTCALL comp_func_solid_ColorDodge(uint *dest, int length, uint color, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_solid_ColorDodge_impl(dest, length, color, QFullCoverage()); - else - comp_func_solid_ColorDodge_impl(dest, length, color, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_solid_ColorDodge_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { if (const_alpha == 255) @@ -1855,9 +1906,10 @@ void QT_FASTCALL comp_func_solid_ColorDodge_rgb64(QRgba64 *dest, int length, QRg else comp_func_solid_ColorDodge_impl(dest, length, color, QPartialCoverage(const_alpha)); } +#endif template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_ColorDodge_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_ColorDodge_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { uint d = dest[i]; @@ -1877,8 +1929,17 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_ColorDodge_impl(uint *Q_DECL_RE } } +void QT_FASTCALL comp_func_ColorDodge(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_ColorDodge_impl(dest, src, length, QFullCoverage()); + else + comp_func_ColorDodge_impl(dest, src, length, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_ColorDodge_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_ColorDodge_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { QRgba64 d = dest[i]; @@ -1898,14 +1959,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_ColorDodge_impl(QRgba64 *Q_DECL } } -void QT_FASTCALL comp_func_ColorDodge(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_ColorDodge_impl(dest, src, length, QFullCoverage()); - else - comp_func_ColorDodge_impl(dest, src, length, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_ColorDodge_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { if (const_alpha == 255) @@ -1913,6 +1966,7 @@ void QT_FASTCALL comp_func_ColorDodge_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const else comp_func_ColorDodge_impl(dest, src, length, QPartialCoverage(const_alpha)); } +#endif /* if Sca.Da + Dca.Sa <= Sa.Da @@ -1933,21 +1987,8 @@ static inline int color_burn_op(int dst, int src, int da, int sa) return qt_div_255(sa * (src_da + dst_sa - sa_da) / src + temp); } -static inline uint color_burn_op_rgb64(qint64 dst, qint64 src, qint64 da, qint64 sa) -{ - const qint64 src_da = src * da; - const qint64 dst_sa = dst * sa; - const qint64 sa_da = sa * da; - - const qint64 temp = src * (65535 - da) + dst * (65535 - sa); - - if (src == 0 || src_da + dst_sa <= sa_da) - return qt_div_65535(temp); - return qt_div_65535(sa * (src_da + dst_sa - sa_da) / src + temp); -} - template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_ColorBurn_impl(uint *dest, int length, uint color, const T &coverage) +static inline void comp_func_solid_ColorBurn_impl(uint *dest, int length, uint color, const T &coverage) { int sa = qAlpha(color); int sr = qRed(color); @@ -1969,8 +2010,30 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_ColorBurn_impl(uint *dest } } +void QT_FASTCALL comp_func_solid_ColorBurn(uint *dest, int length, uint color, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_solid_ColorBurn_impl(dest, length, color, QFullCoverage()); + else + comp_func_solid_ColorBurn_impl(dest, length, color, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) +static inline uint color_burn_op_rgb64(qint64 dst, qint64 src, qint64 da, qint64 sa) +{ + const qint64 src_da = src * da; + const qint64 dst_sa = dst * sa; + const qint64 sa_da = sa * da; + + const qint64 temp = src * (65535 - da) + dst * (65535 - sa); + + if (src == 0 || src_da + dst_sa <= sa_da) + return qt_div_65535(temp); + return qt_div_65535(sa * (src_da + dst_sa - sa_da) / src + temp); +} + template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_ColorBurn_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) +static inline void comp_func_solid_ColorBurn_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) { uint sa = color.alpha(); uint sr = color.red(); @@ -1992,14 +2055,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_ColorBurn_impl(QRgba64 *d } } -void QT_FASTCALL comp_func_solid_ColorBurn(uint *dest, int length, uint color, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_solid_ColorBurn_impl(dest, length, color, QFullCoverage()); - else - comp_func_solid_ColorBurn_impl(dest, length, color, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_solid_ColorBurn_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { if (const_alpha == 255) @@ -2007,9 +2062,10 @@ void QT_FASTCALL comp_func_solid_ColorBurn_rgb64(QRgba64 *dest, int length, QRgb else comp_func_solid_ColorBurn_impl(dest, length, color, QPartialCoverage(const_alpha)); } +#endif template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_ColorBurn_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_ColorBurn_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { uint d = dest[i]; @@ -2029,8 +2085,17 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_ColorBurn_impl(uint *Q_DECL_RES } } +void QT_FASTCALL comp_func_ColorBurn(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_ColorBurn_impl(dest, src, length, QFullCoverage()); + else + comp_func_ColorBurn_impl(dest, src, length, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_ColorBurn_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_ColorBurn_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { QRgba64 d = dest[i]; @@ -2050,14 +2115,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_ColorBurn_impl(QRgba64 *Q_DECL_ } } -void QT_FASTCALL comp_func_ColorBurn(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_ColorBurn_impl(dest, src, length, QFullCoverage()); - else - comp_func_ColorBurn_impl(dest, src, length, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_ColorBurn_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { if (const_alpha == 255) @@ -2065,6 +2122,7 @@ void QT_FASTCALL comp_func_ColorBurn_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const else comp_func_ColorBurn_impl(dest, src, length, QPartialCoverage(const_alpha)); } +#endif /* if 2.Sca < Sa @@ -2082,18 +2140,8 @@ static inline uint hardlight_op(int dst, int src, int da, int sa) return qt_div_255(sa * da - 2 * (da - dst) * (sa - src) + temp); } -static inline uint hardlight_op_rgb64(uint dst, uint src, uint da, uint sa) -{ - const uint temp = src * (65535 - da) + dst * (65535 - sa); - - if (2 * src < sa) - return qt_div_65535(2 * src * dst + temp); - else - return qt_div_65535(sa * da - 2 * (da - dst) * (sa - src) + temp); -} - template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_HardLight_impl(uint *dest, int length, uint color, const T &coverage) +static inline void comp_func_solid_HardLight_impl(uint *dest, int length, uint color, const T &coverage) { int sa = qAlpha(color); int sr = qRed(color); @@ -2115,8 +2163,27 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_HardLight_impl(uint *dest } } +void QT_FASTCALL comp_func_solid_HardLight(uint *dest, int length, uint color, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_solid_HardLight_impl(dest, length, color, QFullCoverage()); + else + comp_func_solid_HardLight_impl(dest, length, color, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) +static inline uint hardlight_op_rgb64(uint dst, uint src, uint da, uint sa) +{ + const uint temp = src * (65535 - da) + dst * (65535 - sa); + + if (2 * src < sa) + return qt_div_65535(2 * src * dst + temp); + else + return qt_div_65535(sa * da - 2 * (da - dst) * (sa - src) + temp); +} + template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_HardLight_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) +static inline void comp_func_solid_HardLight_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) { uint sa = color.alpha(); uint sr = color.red(); @@ -2138,14 +2205,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_HardLight_impl(QRgba64 *d } } -void QT_FASTCALL comp_func_solid_HardLight(uint *dest, int length, uint color, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_solid_HardLight_impl(dest, length, color, QFullCoverage()); - else - comp_func_solid_HardLight_impl(dest, length, color, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_solid_HardLight_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { if (const_alpha == 255) @@ -2153,9 +2212,10 @@ void QT_FASTCALL comp_func_solid_HardLight_rgb64(QRgba64 *dest, int length, QRgb else comp_func_solid_HardLight_impl(dest, length, color, QPartialCoverage(const_alpha)); } +#endif template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_HardLight_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_HardLight_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { uint d = dest[i]; @@ -2175,8 +2235,17 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_HardLight_impl(uint *Q_DECL_RES } } +void QT_FASTCALL comp_func_HardLight(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_HardLight_impl(dest, src, length, QFullCoverage()); + else + comp_func_HardLight_impl(dest, src, length, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_HardLight_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_HardLight_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { QRgba64 d = dest[i]; @@ -2196,14 +2265,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_HardLight_impl(QRgba64 *Q_DECL_ } } -void QT_FASTCALL comp_func_HardLight(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_HardLight_impl(dest, src, length, QFullCoverage()); - else - comp_func_HardLight_impl(dest, src, length, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_HardLight_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { if (const_alpha == 255) @@ -2211,6 +2272,7 @@ void QT_FASTCALL comp_func_HardLight_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const else comp_func_HardLight_impl(dest, src, length, QPartialCoverage(const_alpha)); } +#endif /* if 2.Sca <= Sa @@ -2235,24 +2297,8 @@ static inline int soft_light_op(int dst, int src, int da, int sa) } } -static inline uint soft_light_op_rgb64(qint64 dst, qint64 src, qint64 da, qint64 sa) -{ - const qint64 src2 = src << 1; - const qint64 dst_np = da != 0 ? (65535 * dst) / da : 0; - const qint64 temp = (src * (65535 - da) + dst * (65535 - sa)) * 65535; - const qint64 factor = qint64(65535) * 65535; - - if (src2 < sa) - return (dst * (sa * 65535 + (src2 - sa) * (65535 - dst_np)) + temp) / factor; - else if (4 * dst <= da) - return (dst * sa * 65535 + da * (src2 - sa) * ((((16 * dst_np - 12 * 65535) * dst_np + 3 * factor) * dst_np) / factor) + temp) / factor; - else { - return (dst * sa * 65535 + da * (src2 - sa) * (int(qSqrt(qreal(dst_np * 65535))) - dst_np) + temp) / factor; - } -} - template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_SoftLight_impl(uint *dest, int length, uint color, const T &coverage) +static inline void comp_func_solid_SoftLight_impl(uint *dest, int length, uint color, const T &coverage) { int sa = qAlpha(color); int sr = qRed(color); @@ -2274,8 +2320,25 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_SoftLight_impl(uint *dest } } +#if QT_CONFIG(raster_64bit) +static inline uint soft_light_op_rgb64(qint64 dst, qint64 src, qint64 da, qint64 sa) +{ + const qint64 src2 = src << 1; + const qint64 dst_np = da != 0 ? (65535 * dst) / da : 0; + const qint64 temp = (src * (65535 - da) + dst * (65535 - sa)) * 65535; + const qint64 factor = qint64(65535) * 65535; + + if (src2 < sa) + return (dst * (sa * 65535 + (src2 - sa) * (65535 - dst_np)) + temp) / factor; + else if (4 * dst <= da) + return (dst * sa * 65535 + da * (src2 - sa) * ((((16 * dst_np - 12 * 65535) * dst_np + 3 * factor) * dst_np) / factor) + temp) / factor; + else { + return (dst * sa * 65535 + da * (src2 - sa) * (int(qSqrt(qreal(dst_np * 65535))) - dst_np) + temp) / factor; + } +} + template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_SoftLight_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) +static inline void comp_func_solid_SoftLight_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) { uint sa = color.alpha(); uint sr = color.red(); @@ -2296,6 +2359,7 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_SoftLight_impl(QRgba64 *d coverage.store(&dest[i], qRgba64(r, g, b, a)); } } +#endif void QT_FASTCALL comp_func_solid_SoftLight(uint *dest, int length, uint color, uint const_alpha) { @@ -2305,16 +2369,8 @@ void QT_FASTCALL comp_func_solid_SoftLight(uint *dest, int length, uint color, u comp_func_solid_SoftLight_impl(dest, length, color, QPartialCoverage(const_alpha)); } -void QT_FASTCALL comp_func_solid_SoftLight_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_solid_SoftLight_impl(dest, length, color, QFullCoverage()); - else - comp_func_solid_SoftLight_impl(dest, length, color, QPartialCoverage(const_alpha)); -} - template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_SoftLight_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_SoftLight_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { uint d = dest[i]; @@ -2334,8 +2390,25 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_SoftLight_impl(uint *Q_DECL_RES } } +void QT_FASTCALL comp_func_SoftLight(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_SoftLight_impl(dest, src, length, QFullCoverage()); + else + comp_func_SoftLight_impl(dest, src, length, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) +void QT_FASTCALL comp_func_solid_SoftLight_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_solid_SoftLight_impl(dest, length, color, QFullCoverage()); + else + comp_func_solid_SoftLight_impl(dest, length, color, QPartialCoverage(const_alpha)); +} + template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_SoftLight_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_SoftLight_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { QRgba64 d = dest[i]; @@ -2355,14 +2428,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_SoftLight_impl(QRgba64 *Q_DECL_ } } -void QT_FASTCALL comp_func_SoftLight(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_SoftLight_impl(dest, src, length, QFullCoverage()); - else - comp_func_SoftLight_impl(dest, src, length, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_SoftLight_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { if (const_alpha == 255) @@ -2370,6 +2435,7 @@ void QT_FASTCALL comp_func_SoftLight_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const else comp_func_SoftLight_impl(dest, src, length, QPartialCoverage(const_alpha)); } +#endif /* Dca' = abs(Dca.Sa - Sca.Da) + Sca.(1 - Da) + Dca.(1 - Sa) @@ -2380,13 +2446,8 @@ static inline int difference_op(int dst, int src, int da, int sa) return src + dst - qt_div_255(2 * qMin(src * da, dst * sa)); } -static inline uint difference_op_rgb64(qint64 dst, qint64 src, qint64 da, qint64 sa) -{ - return src + dst - qt_div_65535(2 * qMin(src * da, dst * sa)); -} - template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Difference_impl(uint *dest, int length, uint color, const T &coverage) +static inline void comp_func_solid_Difference_impl(uint *dest, int length, uint color, const T &coverage) { int sa = qAlpha(color); int sr = qRed(color); @@ -2408,8 +2469,22 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Difference_impl(uint *des } } +void QT_FASTCALL comp_func_solid_Difference(uint *dest, int length, uint color, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_solid_Difference_impl(dest, length, color, QFullCoverage()); + else + comp_func_solid_Difference_impl(dest, length, color, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) +static inline uint difference_op_rgb64(qint64 dst, qint64 src, qint64 da, qint64 sa) +{ + return src + dst - qt_div_65535(2 * qMin(src * da, dst * sa)); +} + template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Difference_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) +static inline void comp_func_solid_Difference_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) { uint sa = color.alpha(); uint sr = color.red(); @@ -2431,14 +2506,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_solid_Difference_impl(QRgba64 * } } -void QT_FASTCALL comp_func_solid_Difference(uint *dest, int length, uint color, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_solid_Difference_impl(dest, length, color, QFullCoverage()); - else - comp_func_solid_Difference_impl(dest, length, color, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_solid_Difference_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { if (const_alpha == 255) @@ -2446,9 +2513,10 @@ void QT_FASTCALL comp_func_solid_Difference_rgb64(QRgba64 *dest, int length, QRg else comp_func_solid_Difference_impl(dest, length, color, QPartialCoverage(const_alpha)); } +#endif template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Difference_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Difference_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { uint d = dest[i]; @@ -2468,8 +2536,17 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Difference_impl(uint *Q_DECL_RE } } +void QT_FASTCALL comp_func_Difference(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_Difference_impl(dest, src, length, QFullCoverage()); + else + comp_func_Difference_impl(dest, src, length, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Difference_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Difference_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { QRgba64 d = dest[i]; @@ -2489,14 +2566,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Difference_impl(QRgba64 *Q_DECL } } -void QT_FASTCALL comp_func_Difference(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_Difference_impl(dest, src, length, QFullCoverage()); - else - comp_func_Difference_impl(dest, src, length, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_Difference_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { if (const_alpha == 255) @@ -2504,12 +2573,13 @@ void QT_FASTCALL comp_func_Difference_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const else comp_func_Difference_impl(dest, src, length, QPartialCoverage(const_alpha)); } +#endif /* Dca' = (Sca.Da + Dca.Sa - 2.Sca.Dca) + Sca.(1 - Da) + Dca.(1 - Sa) */ template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void QT_FASTCALL comp_func_solid_Exclusion_impl(uint *dest, int length, uint color, const T &coverage) +static inline void QT_FASTCALL comp_func_solid_Exclusion_impl(uint *dest, int length, uint color, const T &coverage) { int sa = qAlpha(color); int sr = qRed(color); @@ -2531,8 +2601,17 @@ Q_STATIC_TEMPLATE_FUNCTION inline void QT_FASTCALL comp_func_solid_Exclusion_imp } } +void QT_FASTCALL comp_func_solid_Exclusion(uint *dest, int length, uint color, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_solid_Exclusion_impl(dest, length, color, QFullCoverage()); + else + comp_func_solid_Exclusion_impl(dest, length, color, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void QT_FASTCALL comp_func_solid_Exclusion_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) +static inline void QT_FASTCALL comp_func_solid_Exclusion_impl(QRgba64 *dest, int length, QRgba64 color, const T &coverage) { uint sa = color.alpha(); uint sr = color.red(); @@ -2555,14 +2634,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void QT_FASTCALL comp_func_solid_Exclusion_imp } -void QT_FASTCALL comp_func_solid_Exclusion(uint *dest, int length, uint color, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_solid_Exclusion_impl(dest, length, color, QFullCoverage()); - else - comp_func_solid_Exclusion_impl(dest, length, color, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_solid_Exclusion_rgb64(QRgba64 *dest, int length, QRgba64 color, uint const_alpha) { if (const_alpha == 255) @@ -2570,9 +2641,10 @@ void QT_FASTCALL comp_func_solid_Exclusion_rgb64(QRgba64 *dest, int length, QRgb else comp_func_solid_Exclusion_impl(dest, length, color, QPartialCoverage(const_alpha)); } +#endif template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Exclusion_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Exclusion_impl(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { uint d = dest[i]; @@ -2592,8 +2664,17 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Exclusion_impl(uint *Q_DECL_RES } } +void QT_FASTCALL comp_func_Exclusion(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) +{ + if (const_alpha == 255) + comp_func_Exclusion_impl(dest, src, length, QFullCoverage()); + else + comp_func_Exclusion_impl(dest, src, length, QPartialCoverage(const_alpha)); +} + +#if QT_CONFIG(raster_64bit) template <typename T> -Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Exclusion_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) +static inline void comp_func_Exclusion_impl(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, const T &coverage) { for (int i = 0; i < length; ++i) { QRgba64 d = dest[i]; @@ -2613,14 +2694,6 @@ Q_STATIC_TEMPLATE_FUNCTION inline void comp_func_Exclusion_impl(QRgba64 *Q_DECL_ } } -void QT_FASTCALL comp_func_Exclusion(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha) -{ - if (const_alpha == 255) - comp_func_Exclusion_impl(dest, src, length, QFullCoverage()); - else - comp_func_Exclusion_impl(dest, src, length, QPartialCoverage(const_alpha)); -} - void QT_FASTCALL comp_func_Exclusion_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha) { if (const_alpha == 255) @@ -2628,6 +2701,7 @@ void QT_FASTCALL comp_func_Exclusion_rgb64(QRgba64 *Q_DECL_RESTRICT dest, const else comp_func_Exclusion_impl(dest, src, length, QPartialCoverage(const_alpha)); } +#endif void QT_FASTCALL rasterop_solid_SourceOrDestination(uint *dest, int length, @@ -2977,6 +3051,7 @@ CompositionFunctionSolid qt_functionForModeSolid_C[] = { }; CompositionFunctionSolid64 qt_functionForModeSolid64_C[] = { +#if QT_CONFIG(raster_64bit) comp_func_solid_SourceOver_rgb64, comp_func_solid_DestinationOver_rgb64, comp_func_solid_Clear_rgb64, @@ -3001,6 +3076,10 @@ CompositionFunctionSolid64 qt_functionForModeSolid64_C[] = { comp_func_solid_SoftLight_rgb64, comp_func_solid_Difference_rgb64, comp_func_solid_Exclusion_rgb64, +#else + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, +#endif 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }; @@ -3047,6 +3126,7 @@ CompositionFunction qt_functionForMode_C[] = { }; CompositionFunction64 qt_functionForMode64_C[] = { +#if QT_CONFIG(raster_64bit) comp_func_SourceOver_rgb64, comp_func_DestinationOver_rgb64, comp_func_Clear_rgb64, @@ -3071,6 +3151,10 @@ CompositionFunction64 qt_functionForMode64_C[] = { comp_func_SoftLight_rgb64, comp_func_Difference_rgb64, comp_func_Exclusion_rgb64, +#else + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, +#endif 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0, 0 }; diff --git a/src/gui/painting/qcoregraphics.mm b/src/gui/painting/qcoregraphics.mm index d45da14767..53066687d3 100644 --- a/src/gui/painting/qcoregraphics.mm +++ b/src/gui/painting/qcoregraphics.mm @@ -51,6 +51,33 @@ QT_BEGIN_NAMESPACE // ---------------------- Images ---------------------- +CGBitmapInfo qt_mac_bitmapInfoForImage(const QImage &image) +{ + CGBitmapInfo bitmapInfo = kCGImageAlphaNone; + switch (image.format()) { + case QImage::Format_ARGB32: + bitmapInfo = kCGImageAlphaFirst | kCGBitmapByteOrder32Host; + break; + case QImage::Format_RGB32: + bitmapInfo = kCGImageAlphaNoneSkipFirst | kCGBitmapByteOrder32Host; + break; + case QImage::Format_RGBA8888_Premultiplied: + bitmapInfo = kCGImageAlphaPremultipliedLast | kCGBitmapByteOrder32Big; + break; + case QImage::Format_RGBA8888: + bitmapInfo = kCGImageAlphaLast | kCGBitmapByteOrder32Big; + break; + case QImage::Format_RGBX8888: + bitmapInfo = kCGImageAlphaNoneSkipLast | kCGBitmapByteOrder32Big; + break; + case QImage::Format_ARGB32_Premultiplied: + bitmapInfo = kCGImageAlphaPremultipliedFirst | kCGBitmapByteOrder32Host; + break; + default: break; + } + return bitmapInfo; +} + CGImageRef qt_mac_toCGImage(const QImage &inImage) { CGImageRef cgImage = inImage.toCGImage(); @@ -362,13 +389,10 @@ QMacCGContext::QMacCGContext(QPaintDevice *paintDevice) : context(0) if (!image) return; // Context type not supported. - CGColorSpaceRef colorSpace = CGColorSpaceCreateWithName(kCGColorSpaceSRGB); - uint flags = kCGImageAlphaPremultipliedFirst; - flags |= kCGBitmapByteOrder32Host; + QCFType<CGColorSpaceRef> colorSpace = CGColorSpaceCreateWithName(kCGColorSpaceSRGB); + context = CGBitmapContextCreate(image->bits(), image->width(), image->height(), 8, + image->bytesPerLine(), colorSpace, qt_mac_bitmapInfoForImage(*image)); - context = CGBitmapContextCreate(image->bits(), image->width(), image->height(), - 8, image->bytesPerLine(), colorSpace, flags); - CFRelease(colorSpace); CGContextTranslateCTM(context, 0, image->height()); const qreal devicePixelRatio = paintDevice->devicePixelRatioF(); CGContextScaleCTM(context, devicePixelRatio, devicePixelRatio); @@ -396,16 +420,10 @@ QMacCGContext::QMacCGContext(QPainter *painter) : context(0) devType == QInternal::Pixmap || devType == QInternal::Image)) { - CGColorSpaceRef colorSpace = CGColorSpaceCreateWithName(kCGColorSpaceSRGB); - uint flags = kCGImageAlphaPremultipliedFirst; -#ifdef kCGBitmapByteOrder32Host //only needed because CGImage.h added symbols in the minor version - flags |= kCGBitmapByteOrder32Host; -#endif const QImage *image = static_cast<const QImage *>(paintEngine->paintDevice()); - - context = CGBitmapContextCreate((void *)image->bits(), image->width(), image->height(), - 8, image->bytesPerLine(), colorSpace, flags); - CFRelease(colorSpace); + QCFType<CGColorSpaceRef> colorSpace = CGColorSpaceCreateWithName(kCGColorSpaceSRGB); + context = CGBitmapContextCreate((void *)image->bits(), image->width(), image->height(), 8, + image->bytesPerLine(), colorSpace, qt_mac_bitmapInfoForImage(*image)); // Invert y axis CGContextTranslateCTM(context, 0, image->height()); diff --git a/src/gui/painting/qcoregraphics_p.h b/src/gui/painting/qcoregraphics_p.h index de721c94aa..868c2b08b5 100644 --- a/src/gui/painting/qcoregraphics_p.h +++ b/src/gui/painting/qcoregraphics_p.h @@ -64,6 +64,8 @@ QT_BEGIN_NAMESPACE +Q_GUI_EXPORT CGBitmapInfo qt_mac_bitmapInfoForImage(const QImage &image); + #ifdef HAVE_APPKIT Q_GUI_EXPORT NSImage *qt_mac_create_nsimage(const QPixmap &pm); Q_GUI_EXPORT NSImage *qt_mac_create_nsimage(const QIcon &icon, int defaultSize = 0); diff --git a/src/gui/painting/qcosmeticstroker.cpp b/src/gui/painting/qcosmeticstroker.cpp index 436a62d486..0fb89a75b5 100644 --- a/src/gui/painting/qcosmeticstroker.cpp +++ b/src/gui/painting/qcosmeticstroker.cpp @@ -289,7 +289,7 @@ void QCosmeticStroker::setup() drawCaps = state->lastPen.capStyle() != Qt::FlatCap; if (strokeSelection & FastDraw) { - color = multiplyAlpha256(state->penData.solid.color, opacity).toArgb32(); + color = multiplyAlpha256(state->penData.solidColor, opacity).toArgb32(); QRasterBuffer *buffer = state->penData.rasterBuffer; pixels = (uint *)buffer->buffer(); ppl = buffer->stride<quint32>(); diff --git a/src/gui/painting/qcosmeticstroker_p.h b/src/gui/painting/qcosmeticstroker_p.h index 082ddee30f..8571b0476a 100644 --- a/src/gui/painting/qcosmeticstroker_p.h +++ b/src/gui/painting/qcosmeticstroker_p.h @@ -98,8 +98,8 @@ public: : state(s), deviceRect(dr_unclipped), clip(dr), - pattern(0), - reversePattern(0), + pattern(nullptr), + reversePattern(nullptr), patternSize(0), patternLength(0), patternOffset(0), diff --git a/src/gui/painting/qdatabuffer_p.h b/src/gui/painting/qdatabuffer_p.h index 7cac2ac358..181d19da0b 100644 --- a/src/gui/painting/qdatabuffer_p.h +++ b/src/gui/painting/qdatabuffer_p.h @@ -60,7 +60,7 @@ QT_BEGIN_NAMESPACE template <typename Type> class QDataBuffer { - Q_DISABLE_COPY(QDataBuffer) + Q_DISABLE_COPY_MOVE(QDataBuffer) public: QDataBuffer(int res) { @@ -69,7 +69,7 @@ public: buffer = (Type*) malloc(capacity * sizeof(Type)); Q_CHECK_PTR(buffer); } else { - buffer = 0; + buffer = nullptr; } siz = 0; } @@ -128,7 +128,7 @@ public: Q_CHECK_PTR(buffer); } else { free(buffer); - buffer = 0; + buffer = nullptr; } } diff --git a/src/gui/painting/qdrawhelper.cpp b/src/gui/painting/qdrawhelper.cpp index bbeb9fd9ea..ac15d8f4f4 100644 --- a/src/gui/painting/qdrawhelper.cpp +++ b/src/gui/painting/qdrawhelper.cpp @@ -1,7 +1,7 @@ /**************************************************************************** ** ** Copyright (C) 2018 The Qt Company Ltd. -** Copyright (C) 2016 Intel Corporation. +** Copyright (C) 2018 Intel Corporation. ** Contact: https://www.qt.io/licensing/ ** ** This file is part of the QtGui module of the Qt Toolkit. @@ -43,7 +43,7 @@ #include <qstylehints.h> #include <qguiapplication.h> #include <qatomic.h> -#include <private/qcolorprofile_p.h> +#include <private/qcolortrclut_p.h> #include <private/qdrawhelper_p.h> #include <private/qpaintengine_raster_p.h> #include <private/qpainter_p.h> @@ -55,6 +55,7 @@ #endif #include <private/qguiapplication_p.h> #include <private/qrgba64_p.h> +#include <qendian.h> #include <qloggingcategory.h> #include <qmath.h> @@ -856,6 +857,44 @@ static const QRgba64 *QT_FASTCALL fetchGrayscale8ToRGB64(QRgba64 *buffer, const return buffer; } +static void QT_FASTCALL convertGrayscale16ToRGB32(uint *buffer, int count, const QVector<QRgb> *) +{ + for (int i = 0; i < count; ++i) { + const uint x = qt_div_257(buffer[i]); + buffer[i] = qRgb(x, x, x); + } +} + +static const uint *QT_FASTCALL fetchGrayscale16ToRGB32(uint *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + const unsigned short *s = reinterpret_cast<const unsigned short *>(src) + index; + for (int i = 0; i < count; ++i) { + const uint x = qt_div_257(s[i]); + buffer[i] = qRgb(x, x, x); + } + return buffer; +} + +static const QRgba64 *QT_FASTCALL convertGrayscale16ToRGBA64(QRgba64 *buffer, const uint *src, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + const unsigned short *s = reinterpret_cast<const unsigned short *>(src); + for (int i = 0; i < count; ++i) + buffer[i] = QRgba64::fromRgba64(s[i], s[i], s[i], 65535); + return buffer; +} + +static const QRgba64 *QT_FASTCALL fetchGrayscale16ToRGBA64(QRgba64 *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + const unsigned short *s = reinterpret_cast<const unsigned short *>(src) + index; + for (int i = 0; i < count; ++i) { + buffer[i] = QRgba64::fromRgba64(s[i], s[i], s[i], 65535); + } + return buffer; +} + static void QT_FASTCALL storeARGB32FromARGB32PM(uchar *dest, const uint *src, int index, int count, const QVector<QRgb> *, QDitherInfo *) { @@ -1047,18 +1086,8 @@ static const QRgba64 *QT_FASTCALL fetchRGB32ToRGB64(QRgba64 *buffer, const uchar static const QRgba64 *QT_FASTCALL convertARGB32ToRGBA64PM(QRgba64 *buffer, const uint *src, int count, const QVector<QRgb> *, QDitherInfo *) { -#ifdef __SSE2__ - qConvertARGB32PMToRGBA64PM_sse2<false, false>(buffer, src, count); - for (int i = 0; i < count; ++i) - buffer[i] = buffer[i].premultiplied(); -#elif defined(__ARM_NEON__) - qConvertARGB32PMToRGBA64PM_neon<false, false>(buffer, src, count); - for (int i = 0; i < count; ++i) - buffer[i] = buffer[i].premultiplied(); -#else for (int i = 0; i < count; ++i) buffer[i] = QRgba64::fromArgb32(src[i]).premultiplied(); -#endif return buffer; } @@ -1088,6 +1117,7 @@ static const QRgba64 *QT_FASTCALL fetchARGB32PMToRGBA64PM(QRgba64 *buffer, const return convertARGB32PMToRGBA64PM(buffer, reinterpret_cast<const uint *>(src) + index, count, nullptr, nullptr); } +#if QT_CONFIG(raster_64bit) static void convertRGBA64ToRGBA64PM(QRgba64 *buffer, int count) { for (int i = 0; i < count; ++i) @@ -1097,6 +1127,7 @@ static void convertRGBA64ToRGBA64PM(QRgba64 *buffer, int count) static void convertRGBA64PMToRGBA64PM(QRgba64 *, int) { } +#endif static const QRgba64 *QT_FASTCALL fetchRGBA64ToRGBA64PM(QRgba64 *buffer, const uchar *src, int index, int count, const QVector<QRgb> *, QDitherInfo *) @@ -1110,18 +1141,8 @@ static const QRgba64 *QT_FASTCALL fetchRGBA64ToRGBA64PM(QRgba64 *buffer, const u static const QRgba64 *QT_FASTCALL convertRGBA8888ToRGBA64PM(QRgba64 *buffer, const uint *src, int count, const QVector<QRgb> *, QDitherInfo *) { -#ifdef __SSE2__ - qConvertARGB32PMToRGBA64PM_sse2<true, false>(buffer, src, count); - for (int i = 0; i < count; ++i) - buffer[i] = buffer[i].premultiplied(); -#elif defined(__ARM_NEON__) - qConvertARGB32PMToRGBA64PM_neon<true, false>(buffer, src, count); - for (int i = 0; i < count; ++i) - buffer[i] = buffer[i].premultiplied(); -#else for (int i = 0; i < count; ++i) buffer[i] = QRgba64::fromArgb32(RGBA2ARGB(src[i])).premultiplied(); -#endif return buffer; } @@ -1361,6 +1382,22 @@ static void QT_FASTCALL storeGrayscale8FromARGB32PM(uchar *dest, const uint *src dest[index + i] = qGray(qUnpremultiply(src[i])); } +static void QT_FASTCALL storeGrayscale16FromRGB32(uchar *dest, const uint *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + unsigned short *d = reinterpret_cast<unsigned short *>(dest) + index; + for (int i = 0; i < count; ++i) + d[i] = qGray(src[i]) * 257; +} + +static void QT_FASTCALL storeGrayscale16FromARGB32PM(uchar *dest, const uint *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + unsigned short *d = reinterpret_cast<unsigned short *>(dest) + index; + for (int i = 0; i < count; ++i) + d[i] = qGray(qUnpremultiply(src[i])) * 257; +} + static const uint *QT_FASTCALL fetchRGB64ToRGB32(uint *buffer, const uchar *src, int index, int count, const QVector<QRgb> *, QDitherInfo *) { @@ -1487,7 +1524,11 @@ QPixelLayout qPixelLayouts[QImage::NImageFormats] = { { true, true, QPixelLayout::BPP64, nullptr, convertPassThrough, nullptr, fetchRGB64ToRGB32, fetchPassThrough64, - storeRGB64FromRGB32, storeRGB64FromRGB32 } // Format_RGBA64_Premultiplied + storeRGB64FromRGB32, storeRGB64FromRGB32 }, // Format_RGBA64_Premultiplied + { false, false, QPixelLayout::BPP16, nullptr, + convertGrayscale16ToRGB32, convertGrayscale16ToRGBA64, + fetchGrayscale16ToRGB32, fetchGrayscale16ToRGBA64, + storeGrayscale16FromARGB32PM, storeGrayscale16FromRGB32 } // Format_Grayscale16 }; Q_STATIC_ASSERT(sizeof(qPixelLayouts) / sizeof(*qPixelLayouts) == QImage::NImageFormats); @@ -1563,6 +1604,16 @@ static void QT_FASTCALL storeRGBA64PMFromRGBA64PM(uchar *dest, const QRgba64 *sr memcpy(d, src, count * sizeof(QRgba64)); } +static void QT_FASTCALL storeGray16FromRGBA64PM(uchar *dest, const QRgba64 *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + quint16 *d = reinterpret_cast<quint16*>(dest) + index; + for (int i = 0; i < count; ++i) { + QRgba64 s = src[i].unpremultiplied(); + d[i] = qGray(s.red(), s.green(), s.blue()); + } +} + ConvertAndStorePixelsFunc64 qStoreFromRGBA64PM[QImage::NImageFormats] = { nullptr, nullptr, @@ -1591,7 +1642,8 @@ ConvertAndStorePixelsFunc64 qStoreFromRGBA64PM[QImage::NImageFormats] = { storeGenericFromRGBA64PM<QImage::Format_Grayscale8>, storeRGBX64FromRGBA64PM, storeRGBA64FromRGBA64PM, - storeRGBA64PMFromRGBA64PM + storeRGBA64PMFromRGBA64PM, + storeGray16FromRGBA64PM }; /* @@ -1649,22 +1701,6 @@ static uint *QT_FASTCALL destFetchUndefined(uint *buffer, QRasterBuffer *, int, return buffer; } -static QRgba64 *QT_FASTCALL destFetch64(QRgba64 *buffer, QRasterBuffer *rasterBuffer, int x, int y, int length) -{ - const QPixelLayout *layout = &qPixelLayouts[rasterBuffer->format]; - return const_cast<QRgba64 *>(layout->fetchToRGBA64PM(buffer, rasterBuffer->scanLine(y), x, length, nullptr, nullptr)); -} - -static QRgba64 * QT_FASTCALL destFetchRGB64(QRgba64 *, QRasterBuffer *rasterBuffer, int x, int y, int) -{ - return (QRgba64 *)rasterBuffer->scanLine(y) + x; -} - -static QRgba64 * QT_FASTCALL destFetch64Undefined(QRgba64 *buffer, QRasterBuffer *, int, int, int) -{ - return buffer; -} - static DestFetchProc destFetchProc[QImage::NImageFormats] = { 0, // Format_Invalid @@ -1695,8 +1731,26 @@ static DestFetchProc destFetchProc[QImage::NImageFormats] = destFetch, // Format_RGBX64 destFetch, // Format_RGBA64 destFetch, // Format_RGBA64_Premultiplied + destFetch, // Format_Grayscale16 }; +#if QT_CONFIG(raster_64bit) +static QRgba64 *QT_FASTCALL destFetch64(QRgba64 *buffer, QRasterBuffer *rasterBuffer, int x, int y, int length) +{ + const QPixelLayout *layout = &qPixelLayouts[rasterBuffer->format]; + return const_cast<QRgba64 *>(layout->fetchToRGBA64PM(buffer, rasterBuffer->scanLine(y), x, length, nullptr, nullptr)); +} + +static QRgba64 * QT_FASTCALL destFetchRGB64(QRgba64 *, QRasterBuffer *rasterBuffer, int x, int y, int) +{ + return (QRgba64 *)rasterBuffer->scanLine(y) + x; +} + +static QRgba64 * QT_FASTCALL destFetch64Undefined(QRgba64 *buffer, QRasterBuffer *, int, int, int) +{ + return buffer; +} + static DestFetchProc64 destFetchProc64[QImage::NImageFormats] = { 0, // Format_Invalid @@ -1727,7 +1781,9 @@ static DestFetchProc64 destFetchProc64[QImage::NImageFormats] = destFetchRGB64, // Format_RGBX64 destFetch64, // Format_RGBA64 destFetchRGB64, // Format_RGBA64_Premultiplied + destFetch64, // Format_Grayscale16 }; +#endif /* Returns the color in the mono destination color table @@ -1835,21 +1891,6 @@ static void QT_FASTCALL destStore(QRasterBuffer *rasterBuffer, int x, int y, con store(dest, buffer, x, length, nullptr, nullptr); } -static void QT_FASTCALL destStore64(QRasterBuffer *rasterBuffer, int x, int y, const QRgba64 *buffer, int length) -{ - auto store = qStoreFromRGBA64PM[rasterBuffer->format]; - uchar *dest = rasterBuffer->scanLine(y); - store(dest, buffer, x, length, nullptr, nullptr); -} - -static void QT_FASTCALL destStore64RGBA64(QRasterBuffer *rasterBuffer, int x, int y, const QRgba64 *buffer, int length) -{ - QRgba64 *dest = reinterpret_cast<QRgba64*>(rasterBuffer->scanLine(y)) + x; - for (int i = 0; i < length; ++i) { - dest[i] = buffer[i].unpremultiplied(); - } -} - static DestStoreProc destStoreProc[QImage::NImageFormats] = { 0, // Format_Invalid @@ -1880,8 +1921,25 @@ static DestStoreProc destStoreProc[QImage::NImageFormats] = destStore, // Format_RGBX64 destStore, // Format_RGBA64 destStore, // Format_RGBA64_Premultiplied + destStore, // Format_Grayscale16 }; +#if QT_CONFIG(raster_64bit) +static void QT_FASTCALL destStore64(QRasterBuffer *rasterBuffer, int x, int y, const QRgba64 *buffer, int length) +{ + auto store = qStoreFromRGBA64PM[rasterBuffer->format]; + uchar *dest = rasterBuffer->scanLine(y); + store(dest, buffer, x, length, nullptr, nullptr); +} + +static void QT_FASTCALL destStore64RGBA64(QRasterBuffer *rasterBuffer, int x, int y, const QRgba64 *buffer, int length) +{ + QRgba64 *dest = reinterpret_cast<QRgba64*>(rasterBuffer->scanLine(y)) + x; + for (int i = 0; i < length; ++i) { + dest[i] = buffer[i].unpremultiplied(); + } +} + static DestStoreProc64 destStoreProc64[QImage::NImageFormats] = { 0, // Format_Invalid @@ -1911,8 +1969,10 @@ static DestStoreProc64 destStoreProc64[QImage::NImageFormats] = destStore64, // Format_Grayscale8 0, // Format_RGBX64 destStore64RGBA64, // Format_RGBA64 - 0 // Format_RGBA64_Premultiplied + 0, // Format_RGBA64_Premultiplied + destStore64, // Format_Grayscale16 }; +#endif /* Source fetches @@ -1963,6 +2023,7 @@ static const uint *QT_FASTCALL fetchUntransformedRGB16(uint *buffer, const Opera return buffer; } +#if QT_CONFIG(raster_64bit) static const QRgba64 *QT_FASTCALL fetchUntransformed64(QRgba64 *buffer, const Operator *, const QSpanData *data, int y, int x, int length) { @@ -1976,6 +2037,7 @@ static const QRgba64 *QT_FASTCALL fetchUntransformedRGBA64PM(QRgba64 *, const Op const uchar *scanLine = data->texture.scanLine(y); return reinterpret_cast<const QRgba64 *>(scanLine) + x; } +#endif template<TextureBlendType blendType> inline void fetchTransformed_pixelBounds(int max, int l1, int l2, int &v) @@ -2166,6 +2228,7 @@ static const uint *QT_FASTCALL fetchTransformed(uint *buffer, const Operator *, return buffer; } +#if QT_CONFIG(raster_64bit) template<TextureBlendType blendType> /* either BlendTransformed or BlendTransformedTiled */ static const QRgba64 *QT_FASTCALL fetchTransformed64(QRgba64 *buffer, const Operator *, const QSpanData *data, int y, int x, int length) @@ -2186,6 +2249,7 @@ static const QRgba64 *QT_FASTCALL fetchTransformed64(QRgba64 *buffer, const Oper convertRGBA64ToRGBA64PM(buffer, length); return buffer; } +#endif /** \internal interpolate 4 argb pixels with the distx and disty factor. @@ -3487,6 +3551,7 @@ static const uint *QT_FASTCALL fetchTransformedBilinear(uint *buffer, const Oper return buffer; } +#if QT_CONFIG(raster_64bit) template<TextureBlendType blendType> static const QRgba64 *QT_FASTCALL fetchTransformedBilinear64_uint32(QRgba64 *buffer, const QSpanData *data, int y, int x, int length) @@ -3500,8 +3565,8 @@ static const QRgba64 *QT_FASTCALL fetchTransformedBilinear64_uint32(QRgba64 *buf uint sbuf1[BufferSize]; uint sbuf2[BufferSize]; - QRgba64 buf1[BufferSize]; - QRgba64 buf2[BufferSize]; + alignas(8) QRgba64 buf1[BufferSize]; + alignas(8) QRgba64 buf2[BufferSize]; QRgba64 *end = buffer + length; QRgba64 *b = buffer; @@ -3658,8 +3723,8 @@ static const QRgba64 *QT_FASTCALL fetchTransformedBilinear64_uint64(QRgba64 *buf const qreal cx = x + qreal(0.5); const qreal cy = y + qreal(0.5); - QRgba64 buf1[BufferSize]; - QRgba64 buf2[BufferSize]; + alignas(8) QRgba64 buf1[BufferSize]; + alignas(8) QRgba64 buf2[BufferSize]; QRgba64 *end = buffer + length; QRgba64 *b = buffer; @@ -3807,6 +3872,7 @@ static const QRgba64 *QT_FASTCALL fetchTransformedBilinear64(QRgba64 *buffer, co return fetchTransformedBilinear64_uint64<blendType>(buffer, data, y, x, length); return fetchTransformedBilinear64_uint32<blendType>(buffer, data, y, x, length); } +#endif // FetchUntransformed can have more specialized methods added depending on SIMD features. static SourceFetchProc sourceFetchUntransformed[QImage::NImageFormats] = { @@ -3838,6 +3904,7 @@ static SourceFetchProc sourceFetchUntransformed[QImage::NImageFormats] = { fetchUntransformed, // RGBX64 fetchUntransformed, // RGBA64 fetchUntransformed, // RGBA64_Premultiplied + fetchUntransformed, // Grayscale16 }; static const SourceFetchProc sourceFetchGeneric[NBlendTypes] = { @@ -3876,6 +3943,20 @@ static SourceFetchProc sourceFetchAny32[NBlendTypes] = { fetchTransformedBilinear<BlendTransformedBilinearTiled, QPixelLayout::BPP32> // TransformedBilinearTiled }; +static inline SourceFetchProc getSourceFetch(TextureBlendType blendType, QImage::Format format) +{ + if (format == QImage::Format_RGB32 || format == QImage::Format_ARGB32_Premultiplied) + return sourceFetchARGB32PM[blendType]; + if (blendType == BlendUntransformed || blendType == BlendTiled) + return sourceFetchUntransformed[format]; + if (qPixelLayouts[format].bpp == QPixelLayout::BPP16) + return sourceFetchAny16[blendType]; + if (qPixelLayouts[format].bpp == QPixelLayout::BPP32) + return sourceFetchAny32[blendType]; + return sourceFetchGeneric[blendType]; +} + +#if QT_CONFIG(raster_64bit) static const SourceFetchProc64 sourceFetchGeneric64[NBlendTypes] = { fetchUntransformed64, // Untransformed fetchUntransformed64, // Tiled @@ -3894,25 +3975,13 @@ static const SourceFetchProc64 sourceFetchRGBA64PM[NBlendTypes] = { fetchTransformedBilinear64<BlendTransformedBilinearTiled> // BilinearTiled }; -static inline SourceFetchProc getSourceFetch(TextureBlendType blendType, QImage::Format format) -{ - if (format == QImage::Format_RGB32 || format == QImage::Format_ARGB32_Premultiplied) - return sourceFetchARGB32PM[blendType]; - if (blendType == BlendUntransformed || blendType == BlendTiled) - return sourceFetchUntransformed[format]; - if (qPixelLayouts[format].bpp == QPixelLayout::BPP16) - return sourceFetchAny16[blendType]; - if (qPixelLayouts[format].bpp == QPixelLayout::BPP32) - return sourceFetchAny32[blendType]; - return sourceFetchGeneric[blendType]; -} - static inline SourceFetchProc64 getSourceFetch64(TextureBlendType blendType, QImage::Format format) { if (format == QImage::Format_RGBX64 || format == QImage::Format_RGBA64_Premultiplied) return sourceFetchRGBA64PM[blendType]; return sourceFetchGeneric64[blendType]; } +#endif #define FIXPT_BITS 8 @@ -3924,11 +3993,13 @@ static uint qt_gradient_pixel_fixed(const QGradientData *data, int fixed_pos) return data->colorTable32[qt_gradient_clamp(data, ipos)]; } +#if QT_CONFIG(raster_64bit) static const QRgba64& qt_gradient_pixel64_fixed(const QGradientData *data, int fixed_pos) { int ipos = (fixed_pos + (FIXPT_SIZE / 2)) >> FIXPT_BITS; return data->colorTable64[qt_gradient_clamp(data, ipos)]; } +#endif static void QT_FASTCALL getLinearGradientValues(LinearGradientValues *v, const QSpanData *data) { @@ -3962,6 +4033,7 @@ public: } }; +#if QT_CONFIG(raster_64bit) class GradientBase64 { public: @@ -3980,6 +4052,7 @@ public: qt_memfill64((quint64*)buffer, fill, length); } }; +#endif template<class GradientBase, typename BlendType> static inline const BlendType * QT_FASTCALL qt_fetch_linear_gradient_template( @@ -4057,11 +4130,13 @@ static const uint * QT_FASTCALL qt_fetch_linear_gradient(uint *buffer, const Ope return qt_fetch_linear_gradient_template<GradientBase32, uint>(buffer, op, data, y, x, length); } +#if QT_CONFIG(raster_64bit) static const QRgba64 * QT_FASTCALL qt_fetch_linear_gradient_rgb64(QRgba64 *buffer, const Operator *op, const QSpanData *data, int y, int x, int length) { return qt_fetch_linear_gradient_template<GradientBase64, QRgba64>(buffer, op, data, y, x, length); } +#endif static void QT_FASTCALL getRadialGradientValues(RadialGradientValues *v, const QSpanData *data) { @@ -4123,11 +4198,13 @@ const uint * QT_FASTCALL qt_fetch_radial_gradient_plain(uint *buffer, const Oper static SourceFetchProc qt_fetch_radial_gradient = qt_fetch_radial_gradient_plain; +#if QT_CONFIG(raster_64bit) const QRgba64 * QT_FASTCALL qt_fetch_radial_gradient_rgb64(QRgba64 *buffer, const Operator *op, const QSpanData *data, int y, int x, int length) { return qt_fetch_radial_gradient_template<RadialFetchPlain<GradientBase64>, QRgba64>(buffer, op, data, y, x, length); } +#endif template <class GradientBase, typename BlendType> static inline const BlendType * QT_FASTCALL qt_fetch_conical_gradient_template( @@ -4186,23 +4263,29 @@ static const uint * QT_FASTCALL qt_fetch_conical_gradient(uint *buffer, const Op return qt_fetch_conical_gradient_template<GradientBase32, uint>(buffer, data, y, x, length); } +#if QT_CONFIG(raster_64bit) static const QRgba64 * QT_FASTCALL qt_fetch_conical_gradient_rgb64(QRgba64 *buffer, const Operator *, const QSpanData *data, int y, int x, int length) { return qt_fetch_conical_gradient_template<GradientBase64, QRgba64>(buffer, data, y, x, length); } +#endif extern CompositionFunctionSolid qt_functionForModeSolid_C[]; extern CompositionFunctionSolid64 qt_functionForModeSolid64_C[]; static const CompositionFunctionSolid *functionForModeSolid = qt_functionForModeSolid_C; +#if QT_CONFIG(raster_64bit) static const CompositionFunctionSolid64 *functionForModeSolid64 = qt_functionForModeSolid64_C; +#endif extern CompositionFunction qt_functionForMode_C[]; extern CompositionFunction64 qt_functionForMode64_C[]; static const CompositionFunction *functionForMode = qt_functionForMode_C; +#if QT_CONFIG(raster_64bit) static const CompositionFunction64 *functionForMode64 = qt_functionForMode64_C; +#endif static TextureBlendType getBlendType(const QSpanData *data) { @@ -4232,43 +4315,60 @@ static inline Operator getOperator(const QSpanData *data, const QSpan *spans, in switch(data->type) { case QSpanData::Solid: - solidSource = data->solid.color.isOpaque(); + solidSource = data->solidColor.isOpaque(); op.srcFetch = 0; +#if QT_CONFIG(raster_64bit) op.srcFetch64 = 0; +#endif break; case QSpanData::LinearGradient: solidSource = !data->gradient.alphaColor; getLinearGradientValues(&op.linear, data); op.srcFetch = qt_fetch_linear_gradient; +#if QT_CONFIG(raster_64bit) op.srcFetch64 = qt_fetch_linear_gradient_rgb64; +#endif break; case QSpanData::RadialGradient: solidSource = !data->gradient.alphaColor; getRadialGradientValues(&op.radial, data); op.srcFetch = qt_fetch_radial_gradient; +#if QT_CONFIG(raster_64bit) op.srcFetch64 = qt_fetch_radial_gradient_rgb64; +#endif break; case QSpanData::ConicalGradient: solidSource = !data->gradient.alphaColor; op.srcFetch = qt_fetch_conical_gradient; +#if QT_CONFIG(raster_64bit) op.srcFetch64 = qt_fetch_conical_gradient_rgb64; +#endif break; case QSpanData::Texture: solidSource = !data->texture.hasAlpha; op.srcFetch = getSourceFetch(getBlendType(data), data->texture.format); +#if QT_CONFIG(raster_64bit) op.srcFetch64 = getSourceFetch64(getBlendType(data), data->texture.format);; +#endif break; default: Q_UNREACHABLE(); break; } +#if !QT_CONFIG(raster_64bit) + op.srcFetch64 = 0; +#endif op.mode = data->rasterBuffer->compositionMode; if (op.mode == QPainter::CompositionMode_SourceOver && solidSource) op.mode = QPainter::CompositionMode_Source; op.destFetch = destFetchProc[data->rasterBuffer->format]; +#if QT_CONFIG(raster_64bit) op.destFetch64 = destFetchProc64[data->rasterBuffer->format]; +#else + op.destFetch64 = 0; +#endif if (op.mode == QPainter::CompositionMode_Source && (data->type != QSpanData::Texture || data->texture.const_alpha == 256)) { const QSpan *lastSpan = spans + spanCount; @@ -4280,44 +4380,90 @@ static inline Operator getOperator(const QSpanData *data, const QSpan *spans, in } ++spans; } - if (!alphaSpans) { + if (!alphaSpans && spanCount > 0) { // If all spans are opaque we do not need to fetch dest. // But don't clear passthrough destFetch as they are just as fast and save destStore. if (op.destFetch != destFetchARGB32P) op.destFetch = destFetchUndefined; +#if QT_CONFIG(raster_64bit) if (op.destFetch64 != destFetchRGB64) op.destFetch64 = destFetch64Undefined; +#endif } } op.destStore = destStoreProc[data->rasterBuffer->format]; - op.destStore64 = destStoreProc64[data->rasterBuffer->format]; - op.funcSolid = functionForModeSolid[op.mode]; - op.funcSolid64 = functionForModeSolid64[op.mode]; op.func = functionForMode[op.mode]; +#if QT_CONFIG(raster_64bit) + op.destStore64 = destStoreProc64[data->rasterBuffer->format]; + op.funcSolid64 = functionForModeSolid64[op.mode]; op.func64 = functionForMode64[op.mode]; +#else + op.destStore64 = 0; + op.funcSolid64 = 0; + op.func64 = 0; +#endif return op; } +static void spanfill_from_first(QRasterBuffer *rasterBuffer, QPixelLayout::BPP bpp, int x, int y, int length) +{ + switch (bpp) { + case QPixelLayout::BPP64: { + quint64 *dest = reinterpret_cast<quint64 *>(rasterBuffer->scanLine(y)) + x; + qt_memfill_template(dest + 1, dest[0], length - 1); + break; + } + case QPixelLayout::BPP32: { + quint32 *dest = reinterpret_cast<quint32 *>(rasterBuffer->scanLine(y)) + x; + qt_memfill_template(dest + 1, dest[0], length - 1); + break; + } + case QPixelLayout::BPP24: { + quint24 *dest = reinterpret_cast<quint24 *>(rasterBuffer->scanLine(y)) + x; + qt_memfill_template(dest + 1, dest[0], length - 1); + break; + } + case QPixelLayout::BPP16: { + quint16 *dest = reinterpret_cast<quint16 *>(rasterBuffer->scanLine(y)) + x; + qt_memfill_template(dest + 1, dest[0], length - 1); + break; + } + case QPixelLayout::BPP8: { + uchar *dest = rasterBuffer->scanLine(y) + x; + memset(dest + 1, dest[0], length - 1); + break; + } + default: + Q_UNREACHABLE(); + } +} // -------------------- blend methods --------------------- -#if !defined(Q_CC_SUN) -static -#endif -void blend_color_generic(int count, const QSpan *spans, void *userData) +static void blend_color_generic(int count, const QSpan *spans, void *userData) { QSpanData *data = reinterpret_cast<QSpanData *>(userData); uint buffer[BufferSize]; - Operator op = getOperator(data, spans, count); - const uint color = data->solid.color.toArgb32(); + Operator op = getOperator(data, nullptr, 0); + const uint color = data->solidColor.toArgb32(); + bool solidFill = data->rasterBuffer->compositionMode == QPainter::CompositionMode_Source + || (data->rasterBuffer->compositionMode == QPainter::CompositionMode_SourceOver && qAlpha(color) == 255); + QPixelLayout::BPP bpp = qPixelLayouts[data->rasterBuffer->format].bpp; while (count--) { int x = spans->x; int length = spans->len; + if (solidFill && bpp >= QPixelLayout::BPP8 && spans->coverage == 255 && length) { + // If dest doesn't matter we don't need to bother with blending or converting all the identical pixels + op.destStore(data->rasterBuffer, x, spans->y, &color, 1); + spanfill_from_first(data->rasterBuffer, bpp, x, spans->y, length); + length = 0; + } + while (length) { int l = qMin(BufferSize, length); uint *dest = op.destFetch(buffer, data->rasterBuffer, x, spans->y, l); @@ -4335,15 +4481,15 @@ static void blend_color_argb(int count, const QSpan *spans, void *userData) { QSpanData *data = reinterpret_cast<QSpanData *>(userData); - const Operator op = getOperator(data, spans, count); - const uint color = data->solid.color.toArgb32(); + const Operator op = getOperator(data, nullptr, 0); + const uint color = data->solidColor.toArgb32(); if (op.mode == QPainter::CompositionMode_Source) { // inline for performance while (count--) { uint *target = ((uint *)data->rasterBuffer->scanLine(spans->y)) + spans->x; if (spans->coverage == 255) { - QT_MEMFILL_UINT(target, spans->len, color); + qt_memfill(target, color, spans->len); } else { uint c = BYTE_MUL(color, spans->coverage); int ialpha = 255 - spans->coverage; @@ -4364,35 +4510,33 @@ static void blend_color_argb(int count, const QSpan *spans, void *userData) void blend_color_generic_rgb64(int count, const QSpan *spans, void *userData) { +#if QT_CONFIG(raster_64bit) QSpanData *data = reinterpret_cast<QSpanData *>(userData); - Operator op = getOperator(data, spans, count); + Operator op = getOperator(data, nullptr, 0); if (!op.funcSolid64) { qCDebug(lcQtGuiDrawHelper, "blend_color_generic_rgb64: unsupported 64bit blend attempted, falling back to 32-bit"); return blend_color_generic(count, spans, userData); } - quint64 buffer[BufferSize]; - const QRgba64 color = data->solid.color; + alignas(8) QRgba64 buffer[BufferSize]; + const QRgba64 color = data->solidColor; bool solidFill = data->rasterBuffer->compositionMode == QPainter::CompositionMode_Source || (data->rasterBuffer->compositionMode == QPainter::CompositionMode_SourceOver && color.isOpaque()); - bool isBpp32 = qPixelLayouts[data->rasterBuffer->format].bpp == QPixelLayout::BPP32; + QPixelLayout::BPP bpp = qPixelLayouts[data->rasterBuffer->format].bpp; while (count--) { int x = spans->x; int length = spans->len; - if (solidFill && isBpp32 && spans->coverage == 255) { + if (solidFill && bpp >= QPixelLayout::BPP8 && spans->coverage == 255 && length) { // If dest doesn't matter we don't need to bother with blending or converting all the identical pixels - if (length > 0) { - op.destStore64(data->rasterBuffer, x, spans->y, &color, 1); - uint *dest = (uint*)data->rasterBuffer->scanLine(spans->y) + x; - qt_memfill32(dest + 1, dest[0], length - 1); - length = 0; - } + op.destStore64(data->rasterBuffer, x, spans->y, &color, 1); + spanfill_from_first(data->rasterBuffer, bpp, x, spans->y, length); + length = 0; } while (length) { int l = qMin(BufferSize, length); - QRgba64 *dest = op.destFetch64((QRgba64 *)buffer, data->rasterBuffer, x, spans->y, l); + QRgba64 *dest = op.destFetch64(buffer, data->rasterBuffer, x, spans->y, l); op.funcSolid64(dest, l, color, spans->coverage); if (op.destStore64) op.destStore64(data->rasterBuffer, x, spans->y, dest, l); @@ -4401,6 +4545,9 @@ void blend_color_generic_rgb64(int count, const QSpan *spans, void *userData) } ++spans; } +#else + blend_color_generic(count, spans, userData); +#endif } static void blend_color_rgb16(int count, const QSpan *spans, void *userData) @@ -4413,16 +4560,16 @@ static void blend_color_rgb16(int count, const QSpan *spans, void *userData) from qt_gradient_quint16 with minimal overhead. */ QPainter::CompositionMode mode = data->rasterBuffer->compositionMode; - if (mode == QPainter::CompositionMode_SourceOver && data->solid.color.isOpaque()) + if (mode == QPainter::CompositionMode_SourceOver && data->solidColor.isOpaque()) mode = QPainter::CompositionMode_Source; if (mode == QPainter::CompositionMode_Source) { // inline for performance - ushort c = data->solid.color.toRgb16(); + ushort c = data->solidColor.toRgb16(); while (count--) { ushort *target = ((ushort *)data->rasterBuffer->scanLine(spans->y)) + spans->x; if (spans->coverage == 255) { - QT_MEMFILL_USHORT(target, spans->len, c); + qt_memfill(target, c, spans->len); } else { ushort color = BYTE_MUL_RGB16(c, spans->coverage); int ialpha = 255 - spans->coverage; @@ -4439,7 +4586,7 @@ static void blend_color_rgb16(int count, const QSpan *spans, void *userData) if (mode == QPainter::CompositionMode_SourceOver) { while (count--) { - uint color = BYTE_MUL(data->solid.color.toArgb32(), spans->coverage); + uint color = BYTE_MUL(data->solidColor.toArgb32(), spans->coverage); int ialpha = qAlpha(~color); ushort c = qConvertRgb32To16(color); ushort *target = ((ushort *)data->rasterBuffer->scanLine(spans->y)) + spans->x; @@ -4544,8 +4691,8 @@ struct QBlendBase BlendType *dest; - BlendType buffer[BufferSize]; - BlendType src_buffer[BufferSize]; + alignas(8) BlendType buffer[BufferSize]; + alignas(8) BlendType src_buffer[BufferSize]; }; class BlendSrcGeneric : public QBlendBase<uint> @@ -4574,11 +4721,12 @@ public: } }; -class BlendSrcGenericRGB64 : public QBlendBase<quint64> +#if QT_CONFIG(raster_64bit) +class BlendSrcGenericRGB64 : public QBlendBase<QRgba64> { public: BlendSrcGenericRGB64(QSpanData *d, const Operator &o) - : QBlendBase<quint64>(d, o) + : QBlendBase<QRgba64>(d, o) { } @@ -4587,23 +4735,24 @@ public: return op.func64 && op.destFetch64; } - const quint64 *fetch(int x, int y, int len) + const QRgba64 *fetch(int x, int y, int len) { - dest = (quint64 *)op.destFetch64((QRgba64 *)buffer, data->rasterBuffer, x, y, len); - return (const quint64 *)op.srcFetch64((QRgba64 *)src_buffer, &op, data, y, x, len); + dest = op.destFetch64(buffer, data->rasterBuffer, x, y, len); + return op.srcFetch64(src_buffer, &op, data, y, x, len); } - void process(int, int, int len, int coverage, const quint64 *src, int offset) + void process(int, int, int len, int coverage, const QRgba64 *src, int offset) { - op.func64((QRgba64 *)dest + offset, (const QRgba64 *)src + offset, len, coverage); + op.func64(dest + offset, src + offset, len, coverage); } void store(int x, int y, int len) { if (op.destStore64) - op.destStore64(data->rasterBuffer, x, y, (QRgba64 *)dest, len); + op.destStore64(data->rasterBuffer, x, y, dest, len); } }; +#endif static void blend_src_generic(int count, const QSpan *spans, void *userData) { @@ -4612,6 +4761,7 @@ static void blend_src_generic(int count, const QSpan *spans, void *userData) handleSpans(count, spans, data, blend); } +#if QT_CONFIG(raster_64bit) static void blend_src_generic_rgb64(int count, const QSpan *spans, void *userData) { QSpanData *data = reinterpret_cast<QSpanData *>(userData); @@ -4625,6 +4775,7 @@ static void blend_src_generic_rgb64(int count, const QSpan *spans, void *userDat handleSpans(count, spans, data, blend32); } } +#endif static void blend_untransformed_generic(int count, const QSpan *spans, void *userData) { @@ -4671,6 +4822,7 @@ static void blend_untransformed_generic(int count, const QSpan *spans, void *use } } +#if QT_CONFIG(raster_64bit) static void blend_untransformed_generic_rgb64(int count, const QSpan *spans, void *userData) { QSpanData *data = reinterpret_cast<QSpanData *>(userData); @@ -4680,8 +4832,8 @@ static void blend_untransformed_generic_rgb64(int count, const QSpan *spans, voi qCDebug(lcQtGuiDrawHelper, "blend_untransformed_generic_rgb64: unsupported 64-bit blend attempted, falling back to 32-bit"); return blend_untransformed_generic(count, spans, userData); } - quint64 buffer[BufferSize]; - quint64 src_buffer[BufferSize]; + alignas(8) QRgba64 buffer[BufferSize]; + alignas(8) QRgba64 src_buffer[BufferSize]; const int image_width = data->texture.width; const int image_height = data->texture.height; @@ -4705,8 +4857,8 @@ static void blend_untransformed_generic_rgb64(int count, const QSpan *spans, voi const int coverage = (spans->coverage * data->texture.const_alpha) >> 8; while (length) { int l = qMin(BufferSize, length); - const QRgba64 *src = op.srcFetch64((QRgba64 *)src_buffer, &op, data, sy, sx, l); - QRgba64 *dest = op.destFetch64((QRgba64 *)buffer, data->rasterBuffer, x, spans->y, l); + const QRgba64 *src = op.srcFetch64(src_buffer, &op, data, sy, sx, l); + QRgba64 *dest = op.destFetch64(buffer, data->rasterBuffer, x, spans->y, l); op.func64(dest, src, l, coverage); if (op.destStore64) op.destStore64(data->rasterBuffer, x, spans->y, dest, l); @@ -4719,6 +4871,7 @@ static void blend_untransformed_generic_rgb64(int count, const QSpan *spans, voi ++spans; } } +#endif static void blend_untransformed_argb(int count, const QSpan *spans, void *userData) { @@ -4913,6 +5066,7 @@ static void blend_tiled_generic(int count, const QSpan *spans, void *userData) } } +#if QT_CONFIG(raster_64bit) static void blend_tiled_generic_rgb64(int count, const QSpan *spans, void *userData) { QSpanData *data = reinterpret_cast<QSpanData *>(userData); @@ -4922,8 +5076,8 @@ static void blend_tiled_generic_rgb64(int count, const QSpan *spans, void *userD qCDebug(lcQtGuiDrawHelper, "blend_tiled_generic_rgb64: unsupported 64-bit blend attempted, falling back to 32-bit"); return blend_tiled_generic(count, spans, userData); } - quint64 buffer[BufferSize]; - quint64 src_buffer[BufferSize]; + alignas(8) QRgba64 buffer[BufferSize]; + alignas(8) QRgba64 src_buffer[BufferSize]; const int image_width = data->texture.width; const int image_height = data->texture.height; @@ -4952,7 +5106,7 @@ static void blend_tiled_generic_rgb64(int count, const QSpan *spans, void *userD int sl = qMin(image_width, length); if (sx > 0 && sl > 0) { int l = qMin(image_width - sx, sl); - const QRgba64 *src = op.srcFetch64((QRgba64 *)src_buffer, &op, data, sy, sx, l); + const QRgba64 *src = op.srcFetch64(src_buffer, &op, data, sy, sx, l); op.destStore64(data->rasterBuffer, x, y, src, l); x += l; sx += l; @@ -4962,7 +5116,7 @@ static void blend_tiled_generic_rgb64(int count, const QSpan *spans, void *userD } if (sl > 0) { Q_ASSERT(sx == 0); - const QRgba64 *src = op.srcFetch64((QRgba64 *)src_buffer, &op, data, sy, sx, sl); + const QRgba64 *src = op.srcFetch64(src_buffer, &op, data, sy, sx, sl); op.destStore64(data->rasterBuffer, x, y, src, sl); x += sl; sx += sl; @@ -4994,8 +5148,8 @@ static void blend_tiled_generic_rgb64(int count, const QSpan *spans, void *userD int l = qMin(image_width - sx, length); if (BufferSize < l) l = BufferSize; - const QRgba64 *src = op.srcFetch64((QRgba64 *)src_buffer, &op, data, sy, sx, l); - QRgba64 *dest = op.destFetch64((QRgba64 *)buffer, data->rasterBuffer, x, spans->y, l); + const QRgba64 *src = op.srcFetch64(src_buffer, &op, data, sy, sx, l); + QRgba64 *dest = op.destFetch64(buffer, data->rasterBuffer, x, spans->y, l); op.func64(dest, src, l, coverage); if (op.destStore64) op.destStore64(data->rasterBuffer, x, spans->y, dest, l); @@ -5008,6 +5162,7 @@ static void blend_tiled_generic_rgb64(int count, const QSpan *spans, void *userD ++spans; } } +#endif static void blend_tiled_argb(int count, const QSpan *spans, void *userData) { @@ -5184,6 +5339,7 @@ static const ProcessSpans processTextureSpansGeneric[NBlendTypes] = { blend_src_generic // TransformedBilinearTiled }; +#if QT_CONFIG(raster_64bit) static const ProcessSpans processTextureSpansGeneric64[NBlendTypes] = { blend_untransformed_generic_rgb64, // Untransformed blend_tiled_generic_rgb64, // Tiled @@ -5192,6 +5348,7 @@ static const ProcessSpans processTextureSpansGeneric64[NBlendTypes] = { blend_src_generic_rgb64, // TransformedBilinear blend_src_generic_rgb64 // TransformedBilinearTiled }; +#endif void qBlendTexture(int count, const QSpan *spans, void *userData) { @@ -5205,6 +5362,7 @@ void qBlendTexture(int count, const QSpan *spans, void *userData) case QImage::Format_RGB16: proc = processTextureSpansRGB16[blendType]; break; +#if QT_CONFIG(raster_64bit) #if defined(__SSE2__) || defined(__ARM_NEON__) || (Q_PROCESSOR_WORDSIZE == 8) case QImage::Format_ARGB32: case QImage::Format_RGBA8888: @@ -5216,8 +5374,10 @@ void qBlendTexture(int count, const QSpan *spans, void *userData) case QImage::Format_RGBX64: case QImage::Format_RGBA64: case QImage::Format_RGBA64_Premultiplied: + case QImage::Format_Grayscale16: proc = processTextureSpansGeneric64[blendType]; break; +#endif // QT_CONFIG(raster_64bit) case QImage::Format_Invalid: Q_UNREACHABLE(); return; @@ -5228,7 +5388,117 @@ void qBlendTexture(int count, const QSpan *spans, void *userData) proc(count, spans, userData); } -template <class DST> Q_STATIC_TEMPLATE_FUNCTION +static void blend_vertical_gradient_argb(int count, const QSpan *spans, void *userData) +{ + QSpanData *data = reinterpret_cast<QSpanData *>(userData); + + LinearGradientValues linear; + getLinearGradientValues(&linear, data); + + CompositionFunctionSolid funcSolid = + functionForModeSolid[data->rasterBuffer->compositionMode]; + + /* + The logic for vertical gradient calculations is a mathematically + reduced copy of that in fetchLinearGradient() - which is basically: + + qreal ry = data->m22 * (y + 0.5) + data->dy; + qreal t = linear.dy*ry + linear.off; + t *= (GRADIENT_STOPTABLE_SIZE - 1); + quint32 color = + qt_gradient_pixel_fixed(&data->gradient, + int(t * FIXPT_SIZE)); + + This has then been converted to fixed point to improve performance. + */ + const int gss = GRADIENT_STOPTABLE_SIZE - 1; + int yinc = int((linear.dy * data->m22 * gss) * FIXPT_SIZE); + int off = int((((linear.dy * (data->m22 * qreal(0.5) + data->dy) + linear.off) * gss) * FIXPT_SIZE)); + + while (count--) { + int y = spans->y; + int x = spans->x; + + quint32 *dst = (quint32 *)(data->rasterBuffer->scanLine(y)) + x; + quint32 color = + qt_gradient_pixel_fixed(&data->gradient, yinc * y + off); + + funcSolid(dst, spans->len, color, spans->coverage); + ++spans; + } +} + +template<ProcessSpans blend_color> +static void blend_vertical_gradient(int count, const QSpan *spans, void *userData) +{ + QSpanData *data = reinterpret_cast<QSpanData *>(userData); + + LinearGradientValues linear; + getLinearGradientValues(&linear, data); + + // Based on the same logic as blend_vertical_gradient_argb. + + const int gss = GRADIENT_STOPTABLE_SIZE - 1; + int yinc = int((linear.dy * data->m22 * gss) * FIXPT_SIZE); + int off = int((((linear.dy * (data->m22 * qreal(0.5) + data->dy) + linear.off) * gss) * FIXPT_SIZE)); + + while (count--) { + int y = spans->y; + +#if QT_CONFIG(raster_64bit) + data->solidColor = qt_gradient_pixel64_fixed(&data->gradient, yinc * y + off); +#else + data->solidColor = QRgba64::fromArgb32(qt_gradient_pixel_fixed(&data->gradient, yinc * y + off)); +#endif + blend_color(1, spans, userData); + ++spans; + } +} + +void qBlendGradient(int count, const QSpan *spans, void *userData) +{ + QSpanData *data = reinterpret_cast<QSpanData *>(userData); + bool isVerticalGradient = + data->txop <= QTransform::TxScale && + data->type == QSpanData::LinearGradient && + data->gradient.linear.end.x == data->gradient.linear.origin.x; + switch (data->rasterBuffer->format) { + case QImage::Format_RGB16: + if (isVerticalGradient) + return blend_vertical_gradient<blend_color_rgb16>(count, spans, userData); + return blend_src_generic(count, spans, userData); + case QImage::Format_RGB32: + case QImage::Format_ARGB32_Premultiplied: + if (isVerticalGradient) + return blend_vertical_gradient_argb(count, spans, userData); + return blend_src_generic(count, spans, userData); +#if QT_CONFIG(raster_64bit) +#if defined(__SSE2__) || defined(__ARM_NEON__) || (Q_PROCESSOR_WORDSIZE == 8) + case QImage::Format_ARGB32: + case QImage::Format_RGBA8888: +#endif + case QImage::Format_BGR30: + case QImage::Format_A2BGR30_Premultiplied: + case QImage::Format_RGB30: + case QImage::Format_A2RGB30_Premultiplied: + case QImage::Format_RGBX64: + case QImage::Format_RGBA64: + case QImage::Format_RGBA64_Premultiplied: + if (isVerticalGradient) + return blend_vertical_gradient<blend_color_generic_rgb64>(count, spans, userData); + return blend_src_generic_rgb64(count, spans, userData); +#endif // QT_CONFIG(raster_64bit) + case QImage::Format_Invalid: + break; + default: + if (isVerticalGradient) + return blend_vertical_gradient<blend_color_generic>(count, spans, userData); + return blend_src_generic(count, spans, userData); + } + Q_UNREACHABLE(); +} + +template <class DST> static inline void qt_bitmapblit_template(QRasterBuffer *rasterBuffer, int x, int y, DST color, const uchar *map, @@ -5290,103 +5560,6 @@ inline void qt_bitmapblit_template(QRasterBuffer *rasterBuffer, } } -static void qt_gradient_argb32(int count, const QSpan *spans, void *userData) -{ - QSpanData *data = reinterpret_cast<QSpanData *>(userData); - - bool isVerticalGradient = - data->txop <= QTransform::TxScale && - data->type == QSpanData::LinearGradient && - data->gradient.linear.end.x == data->gradient.linear.origin.x; - - if (isVerticalGradient) { - LinearGradientValues linear; - getLinearGradientValues(&linear, data); - - CompositionFunctionSolid funcSolid = - functionForModeSolid[data->rasterBuffer->compositionMode]; - - /* - The logic for vertical gradient calculations is a mathematically - reduced copy of that in fetchLinearGradient() - which is basically: - - qreal ry = data->m22 * (y + 0.5) + data->dy; - qreal t = linear.dy*ry + linear.off; - t *= (GRADIENT_STOPTABLE_SIZE - 1); - quint32 color = - qt_gradient_pixel_fixed(&data->gradient, - int(t * FIXPT_SIZE)); - - This has then been converted to fixed point to improve performance. - */ - const int gss = GRADIENT_STOPTABLE_SIZE - 1; - int yinc = int((linear.dy * data->m22 * gss) * FIXPT_SIZE); - int off = int((((linear.dy * (data->m22 * qreal(0.5) + data->dy) + linear.off) * gss) * FIXPT_SIZE)); - - while (count--) { - int y = spans->y; - int x = spans->x; - - quint32 *dst = (quint32 *)(data->rasterBuffer->scanLine(y)) + x; - quint32 color = - qt_gradient_pixel_fixed(&data->gradient, yinc * y + off); - - funcSolid(dst, spans->len, color, spans->coverage); - ++spans; - } - - } else { - blend_src_generic(count, spans, userData); - } -} - -static void qt_gradient_quint16(int count, const QSpan *spans, void *userData) -{ - QSpanData *data = reinterpret_cast<QSpanData *>(userData); - - bool isVerticalGradient = - data->txop <= QTransform::TxScale && - data->type == QSpanData::LinearGradient && - data->gradient.linear.end.x == data->gradient.linear.origin.x; - - if (isVerticalGradient) { - - LinearGradientValues linear; - getLinearGradientValues(&linear, data); - - /* - The logic for vertical gradient calculations is a mathematically - reduced copy of that in fetchLinearGradient() - which is basically: - - qreal ry = data->m22 * (y + 0.5) + data->dy; - qreal t = linear.dy*ry + linear.off; - t *= (GRADIENT_STOPTABLE_SIZE - 1); - quint32 color = - qt_gradient_pixel_fixed(&data->gradient, - int(t * FIXPT_SIZE)); - - This has then been converted to fixed point to improve performance. - */ - const int gss = GRADIENT_STOPTABLE_SIZE - 1; - int yinc = int((linear.dy * data->m22 * gss) * FIXPT_SIZE); - int off = int((((linear.dy * (data->m22 * qreal(0.5) + data->dy) + linear.off) * gss) * FIXPT_SIZE)); - - // Save the fillData since we overwrite it when setting solid.color. - QGradientData gradient = data->gradient; - while (count--) { - int y = spans->y; - - data->solid.color = QRgba64::fromArgb32(qt_gradient_pixel_fixed(&gradient, yinc * y + off)); - blend_color_rgb16(1, spans, userData); - ++spans; - } - data->gradient = gradient; - - } else { - blend_src_generic(count, spans, userData); - } -} - inline static void qt_bitmapblit_argb32(QRasterBuffer *rasterBuffer, int x, int y, const QRgba64 &color, const uchar *map, @@ -5424,7 +5597,36 @@ inline static void qt_bitmapblit_quint16(QRasterBuffer *rasterBuffer, map, mapWidth, mapHeight, mapStride); } -static inline void alphamapblend_generic(int coverage, QRgba64 *dest, int x, const QRgba64 &srcLinear, const QRgba64 &src, const QColorProfile *colorProfile) +static inline void grayBlendPixel(quint32 *dst, int coverage, QRgba64 srcLinear, const QColorTrcLut *colorProfile) +{ + // Do a gammacorrected gray alphablend... + const QRgba64 dstLinear = colorProfile ? colorProfile->toLinear64(*dst) : QRgba64::fromArgb32(*dst); + + QRgba64 blend = interpolate255(srcLinear, coverage, dstLinear, 255 - coverage); + + *dst = colorProfile ? colorProfile->fromLinear64(blend) : toArgb32(blend); +} + +static inline void alphamapblend_argb32(quint32 *dst, int coverage, QRgba64 srcLinear, quint32 src, const QColorTrcLut *colorProfile) +{ + if (coverage == 0) { + // nothing + } else if (coverage == 255) { + *dst = src; + } else if (!colorProfile) { + *dst = INTERPOLATE_PIXEL_255(src, coverage, *dst, 255 - coverage); + } else { + if (*dst >= 0xff000000) { + grayBlendPixel(dst, coverage, srcLinear, colorProfile); + } else { + // Give up and do a naive gray alphablend. Needed to deal with ARGB32 and invalid ARGB32_premultiplied, see QTBUG-60571 + *dst = INTERPOLATE_PIXEL_255(src, coverage, *dst, 255 - coverage); + } + } +} + +#if QT_CONFIG(raster_64bit) +static inline void alphamapblend_generic(int coverage, QRgba64 *dest, int x, const QRgba64 &srcLinear, const QRgba64 &src, const QColorTrcLut *colorProfile) { if (coverage == 0) { // nothing @@ -5459,7 +5661,7 @@ static void qt_alphamapblit_generic(QRasterBuffer *rasterBuffer, if (color.isTransparent()) return; - const QColorProfile *colorProfile = nullptr; + const QColorTrcLut *colorProfile = nullptr; if (useGammaCorrection) colorProfile = QGuiApplicationPrivate::instance()->colorProfileForA8Text(); @@ -5472,7 +5674,7 @@ static void qt_alphamapblit_generic(QRasterBuffer *rasterBuffer, srcColor = colorProfile->toLinear(srcColor.unpremultiplied()).premultiplied(); } - quint64 buffer[BufferSize]; + alignas(8) QRgba64 buffer[BufferSize]; const DestFetchProc64 destFetch64 = destFetchProc64[rasterBuffer->format]; const DestStoreProc64 destStore64 = destStoreProc64[rasterBuffer->format]; @@ -5482,7 +5684,7 @@ static void qt_alphamapblit_generic(QRasterBuffer *rasterBuffer, int length = mapWidth; while (length > 0) { int l = qMin(BufferSize, length); - QRgba64 *dest = destFetch64((QRgba64*)buffer, rasterBuffer, i, y + ly, l); + QRgba64 *dest = destFetch64(buffer, rasterBuffer, i, y + ly, l); for (int j=0; j < l; ++j) { const int coverage = map[j + (i - x)]; alphamapblend_generic(coverage, dest, j, srcColor, color, colorProfile); @@ -5512,7 +5714,7 @@ static void qt_alphamapblit_generic(QRasterBuffer *rasterBuffer, if (end <= start) continue; Q_ASSERT(end - start <= BufferSize); - QRgba64 *dest = destFetch64((QRgba64*)buffer, rasterBuffer, start, clip.y, end - start); + QRgba64 *dest = destFetch64(buffer, rasterBuffer, start, clip.y, end - start); for (int xp=start; xp<end; ++xp) { const int coverage = map[xp - x]; @@ -5525,6 +5727,85 @@ static void qt_alphamapblit_generic(QRasterBuffer *rasterBuffer, } // for (yp -> bottom) } } +#else +static void qt_alphamapblit_generic(QRasterBuffer *rasterBuffer, + int x, int y, const QRgba64 &color, + const uchar *map, + int mapWidth, int mapHeight, int mapStride, + const QClipData *clip, bool useGammaCorrection) +{ + if (color.isTransparent()) + return; + + const quint32 c = color.toArgb32(); + + const QColorTrcLut *colorProfile = nullptr; + + if (useGammaCorrection) + colorProfile = QGuiApplicationPrivate::instance()->colorProfileForA8Text(); + + QRgba64 srcColor = color; + if (colorProfile) { + if (color.isOpaque()) + srcColor = colorProfile->toLinear(srcColor); + else + srcColor = colorProfile->toLinear(srcColor.unpremultiplied()).premultiplied(); + } + + quint32 buffer[BufferSize]; + const DestFetchProc destFetch = destFetchProc[rasterBuffer->format]; + const DestStoreProc destStore = destStoreProc[rasterBuffer->format]; + + if (!clip) { + for (int ly = 0; ly < mapHeight; ++ly) { + int i = x; + int length = mapWidth; + while (length > 0) { + int l = qMin(BufferSize, length); + quint32 *dest = destFetch(buffer, rasterBuffer, i, y + ly, l); + for (int j=0; j < l; ++j) { + const int coverage = map[j + (i - x)]; + alphamapblend_argb32(dest + j, coverage, srcColor, c, colorProfile); + } + if (destStore) + destStore(rasterBuffer, i, y + ly, dest, l); + length -= l; + i += l; + } + map += mapStride; + } + } else { + int bottom = qMin(y + mapHeight, rasterBuffer->height()); + + int top = qMax(y, 0); + map += (top - y) * mapStride; + + const_cast<QClipData *>(clip)->initialize(); + for (int yp = top; yp<bottom; ++yp) { + const QClipData::ClipLine &line = clip->m_clipLines[yp]; + + for (int i=0; i<line.count; ++i) { + const QSpan &clip = line.spans[i]; + + int start = qMax<int>(x, clip.x); + int end = qMin<int>(x + mapWidth, clip.x + clip.len); + if (end <= start) + continue; + Q_ASSERT(end - start <= BufferSize); + quint32 *dest = destFetch(buffer, rasterBuffer, start, clip.y, end - start); + + for (int xp=start; xp<end; ++xp) { + const int coverage = map[xp - x]; + alphamapblend_argb32(dest + xp - x, coverage, srcColor, color, colorProfile); + } + if (destStore) + destStore(rasterBuffer, start, clip.y, dest, end - start); + } // for (i -> line.count) + map += mapStride; + } // for (yp -> bottom) + } +} +#endif static inline void alphamapblend_quint16(int coverage, quint16 *dest, int x, const quint16 srcColor) { @@ -5585,44 +5866,6 @@ void qt_alphamapblit_quint16(QRasterBuffer *rasterBuffer, } } -static inline void rgbBlendPixel(quint32 *dst, int coverage, QRgba64 slinear, const QColorProfile *colorProfile) -{ - // Do a gammacorrected RGB alphablend... - const QRgba64 dlinear = colorProfile ? colorProfile->toLinear64(*dst) : QRgba64::fromArgb32(*dst); - - QRgba64 blend = rgbBlend(dlinear, slinear, coverage); - - *dst = colorProfile ? colorProfile->fromLinear64(blend) : toArgb32(blend); -} - -static inline void grayBlendPixel(quint32 *dst, int coverage, QRgba64 srcLinear, const QColorProfile *colorProfile) -{ - // Do a gammacorrected gray alphablend... - const QRgba64 dstLinear = colorProfile ? colorProfile->toLinear64(*dst) : QRgba64::fromArgb32(*dst); - - QRgba64 blend = interpolate255(srcLinear, coverage, dstLinear, 255 - coverage); - - *dst = colorProfile ? colorProfile->fromLinear64(blend) : toArgb32(blend); -} - -static inline void alphamapblend_argb32(quint32 *dst, int coverage, QRgba64 srcLinear, quint32 src, const QColorProfile *colorProfile) -{ - if (coverage == 0) { - // nothing - } else if (coverage == 255) { - *dst = src; - } else if (!colorProfile) { - *dst = INTERPOLATE_PIXEL_255(src, coverage, *dst, 255 - coverage); - } else { - if (*dst >= 0xff000000) { - grayBlendPixel(dst, coverage, srcLinear, colorProfile); - } else { - // Give up and do a naive gray alphablend. Needed to deal with ARGB32 and invalid ARGB32_premultiplied, see QTBUG-60571 - *dst = INTERPOLATE_PIXEL_255(src, coverage, *dst, 255 - coverage); - } - } -} - static void qt_alphamapblit_argb32(QRasterBuffer *rasterBuffer, int x, int y, const QRgba64 &color, const uchar *map, @@ -5635,7 +5878,7 @@ static void qt_alphamapblit_argb32(QRasterBuffer *rasterBuffer, if (color.isTransparent()) return; - const QColorProfile *colorProfile = nullptr; + const QColorTrcLut *colorProfile = nullptr; if (useGammaCorrection) colorProfile = QGuiApplicationPrivate::instance()->colorProfileForA8Text(); @@ -5691,6 +5934,16 @@ static inline int qRgbAvg(QRgb rgb) return (qRed(rgb) * 5 + qGreen(rgb) * 6 + qBlue(rgb) * 5) / 16; } +static inline void rgbBlendPixel(quint32 *dst, int coverage, QRgba64 slinear, const QColorTrcLut *colorProfile) +{ + // Do a gammacorrected RGB alphablend... + const QRgba64 dlinear = colorProfile ? colorProfile->toLinear64(*dst) : QRgba64::fromArgb32(*dst); + + QRgba64 blend = rgbBlend(dlinear, slinear, coverage); + + *dst = colorProfile ? colorProfile->fromLinear64(blend) : toArgb32(blend); +} + static inline QRgb rgbBlend(QRgb d, QRgb s, uint rgbAlpha) { #if defined(__SSE2__) @@ -5731,7 +5984,8 @@ static inline QRgb rgbBlend(QRgb d, QRgb s, uint rgbAlpha) #endif } -static inline void alphargbblend_generic(uint coverage, QRgba64 *dest, int x, const QRgba64 &srcLinear, const QRgba64 &src, const QColorProfile *colorProfile) +#if QT_CONFIG(raster_64bit) +static inline void alphargbblend_generic(uint coverage, QRgba64 *dest, int x, const QRgba64 &srcLinear, const QRgba64 &src, const QColorTrcLut *colorProfile) { if (coverage == 0xff000000) { // nothing @@ -5752,8 +6006,9 @@ static inline void alphargbblend_generic(uint coverage, QRgba64 *dest, int x, co } } } +#endif -static inline void alphargbblend_argb32(quint32 *dst, uint coverage, const QRgba64 &srcLinear, quint32 src, const QColorProfile *colorProfile) +static inline void alphargbblend_argb32(quint32 *dst, uint coverage, const QRgba64 &srcLinear, quint32 src, const QColorTrcLut *colorProfile) { if (coverage == 0xff000000) { // nothing @@ -5770,6 +6025,7 @@ static inline void alphargbblend_argb32(quint32 *dst, uint coverage, const QRgba } } +#if QT_CONFIG(raster_64bit) static void qt_alphargbblit_generic(QRasterBuffer *rasterBuffer, int x, int y, const QRgba64 &color, const uint *src, int mapWidth, int mapHeight, int srcStride, @@ -5778,7 +6034,7 @@ static void qt_alphargbblit_generic(QRasterBuffer *rasterBuffer, if (color.isTransparent()) return; - const QColorProfile *colorProfile = nullptr; + const QColorTrcLut *colorProfile = nullptr; if (useGammaCorrection) colorProfile = QGuiApplicationPrivate::instance()->colorProfileForA32Text(); @@ -5791,7 +6047,7 @@ static void qt_alphargbblit_generic(QRasterBuffer *rasterBuffer, srcColor = colorProfile->toLinear(srcColor.unpremultiplied()).premultiplied(); } - quint64 buffer[BufferSize]; + alignas(8) QRgba64 buffer[BufferSize]; const DestFetchProc64 destFetch64 = destFetchProc64[rasterBuffer->format]; const DestStoreProc64 destStore64 = destStoreProc64[rasterBuffer->format]; @@ -5801,7 +6057,7 @@ static void qt_alphargbblit_generic(QRasterBuffer *rasterBuffer, int length = mapWidth; while (length > 0) { int l = qMin(BufferSize, length); - QRgba64 *dest = destFetch64((QRgba64*)buffer, rasterBuffer, i, y + ly, l); + QRgba64 *dest = destFetch64(buffer, rasterBuffer, i, y + ly, l); for (int j=0; j < l; ++j) { const uint coverage = src[j + (i - x)]; alphargbblend_generic(coverage, dest, j, srcColor, color, colorProfile); @@ -5831,7 +6087,7 @@ static void qt_alphargbblit_generic(QRasterBuffer *rasterBuffer, if (end <= start) continue; Q_ASSERT(end - start <= BufferSize); - QRgba64 *dest = destFetch64((QRgba64*)buffer, rasterBuffer, start, clip.y, end - start); + QRgba64 *dest = destFetch64(buffer, rasterBuffer, start, clip.y, end - start); for (int xp=start; xp<end; ++xp) { const uint coverage = src[xp - x]; @@ -5844,6 +6100,84 @@ static void qt_alphargbblit_generic(QRasterBuffer *rasterBuffer, } // for (yp -> bottom) } } +#else +static void qt_alphargbblit_generic(QRasterBuffer *rasterBuffer, + int x, int y, const QRgba64 &color, + const uint *src, int mapWidth, int mapHeight, int srcStride, + const QClipData *clip, bool useGammaCorrection) +{ + if (color.isTransparent()) + return; + + const quint32 c = color.toArgb32(); + + const QColorTrcLut *colorProfile = nullptr; + + if (useGammaCorrection) + colorProfile = QGuiApplicationPrivate::instance()->colorProfileForA32Text(); + + QRgba64 srcColor = color; + if (colorProfile) { + if (color.isOpaque()) + srcColor = colorProfile->toLinear(srcColor); + else + srcColor = colorProfile->toLinear(srcColor.unpremultiplied()).premultiplied(); + } + + quint32 buffer[BufferSize]; + const DestFetchProc destFetch = destFetchProc[rasterBuffer->format]; + const DestStoreProc destStore = destStoreProc[rasterBuffer->format]; + + if (!clip) { + for (int ly = 0; ly < mapHeight; ++ly) { + int i = x; + int length = mapWidth; + while (length > 0) { + int l = qMin(BufferSize, length); + quint32 *dest = destFetch(buffer, rasterBuffer, i, y + ly, l); + for (int j=0; j < l; ++j) { + const uint coverage = src[j + (i - x)]; + alphargbblend_argb32(dest + j, coverage, srcColor, c, colorProfile); + } + if (destStore) + destStore(rasterBuffer, i, y + ly, dest, l); + length -= l; + i += l; + } + src += srcStride; + } + } else { + int bottom = qMin(y + mapHeight, rasterBuffer->height()); + + int top = qMax(y, 0); + src += (top - y) * srcStride; + + const_cast<QClipData *>(clip)->initialize(); + for (int yp = top; yp<bottom; ++yp) { + const QClipData::ClipLine &line = clip->m_clipLines[yp]; + + for (int i=0; i<line.count; ++i) { + const QSpan &clip = line.spans[i]; + + int start = qMax<int>(x, clip.x); + int end = qMin<int>(x + mapWidth, clip.x + clip.len); + if (end <= start) + continue; + Q_ASSERT(end - start <= BufferSize); + quint32 *dest = destFetch(buffer, rasterBuffer, start, clip.y, end - start); + + for (int xp=start; xp<end; ++xp) { + const uint coverage = src[xp - x]; + alphargbblend_argb32(dest + xp - start, coverage, srcColor, c, colorProfile); + } + if (destStore) + destStore(rasterBuffer, start, clip.y, dest, end - start); + } // for (i -> line.count) + src += srcStride; + } // for (yp -> bottom) + } +} +#endif static void qt_alphargbblit_argb32(QRasterBuffer *rasterBuffer, int x, int y, const QRgba64 &color, @@ -5855,7 +6189,7 @@ static void qt_alphargbblit_argb32(QRasterBuffer *rasterBuffer, const quint32 c = color.toArgb32(); - const QColorProfile *colorProfile = nullptr; + const QColorTrcLut *colorProfile = nullptr; if (useGammaCorrection) colorProfile = QGuiApplicationPrivate::instance()->colorProfileForA32Text(); @@ -6007,29 +6341,25 @@ static void qt_rectfill_quint64(QRasterBuffer *rasterBuffer, DrawHelper qDrawHelper[QImage::NImageFormats] = { // Format_Invalid, - { 0, 0, 0, 0, 0, 0 }, + { 0, 0, 0, 0, 0 }, // Format_Mono, { blend_color_generic, - blend_src_generic, 0, 0, 0, 0 }, // Format_MonoLSB, { blend_color_generic, - blend_src_generic, 0, 0, 0, 0 }, // Format_Indexed8, { blend_color_generic, - blend_src_generic, 0, 0, 0, 0 }, // Format_RGB32, { blend_color_argb, - qt_gradient_argb32, qt_bitmapblit_argb32, qt_alphamapblit_argb32, qt_alphargbblit_argb32, @@ -6038,7 +6368,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_ARGB32, { blend_color_generic, - blend_src_generic, qt_bitmapblit_argb32, qt_alphamapblit_argb32, qt_alphargbblit_argb32, @@ -6047,7 +6376,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_ARGB32_Premultiplied { blend_color_argb, - qt_gradient_argb32, qt_bitmapblit_argb32, qt_alphamapblit_argb32, qt_alphargbblit_argb32, @@ -6056,7 +6384,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_RGB16 { blend_color_rgb16, - qt_gradient_quint16, qt_bitmapblit_quint16, qt_alphamapblit_quint16, qt_alphargbblit_generic, @@ -6065,7 +6392,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_ARGB8565_Premultiplied { blend_color_generic, - blend_src_generic, 0, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6074,7 +6400,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_RGB666 { blend_color_generic, - blend_src_generic, 0, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6083,7 +6408,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_ARGB6666_Premultiplied { blend_color_generic, - blend_src_generic, 0, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6092,7 +6416,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_RGB555 { blend_color_generic, - blend_src_generic, 0, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6101,7 +6424,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_ARGB8555_Premultiplied { blend_color_generic, - blend_src_generic, 0, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6110,7 +6432,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_RGB888 { blend_color_generic, - blend_src_generic, 0, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6119,7 +6440,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_RGB444 { blend_color_generic, - blend_src_generic, 0, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6128,7 +6448,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_ARGB4444_Premultiplied { blend_color_generic, - blend_src_generic, 0, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6137,7 +6456,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_RGBX8888 { blend_color_generic, - blend_src_generic, qt_bitmapblit_rgba8888, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6146,7 +6464,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_RGBA8888 { blend_color_generic, - blend_src_generic, qt_bitmapblit_rgba8888, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6155,7 +6472,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_RGB8888_Premultiplied { blend_color_generic, - blend_src_generic, qt_bitmapblit_rgba8888, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6164,7 +6480,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_BGR30 { blend_color_generic_rgb64, - blend_src_generic_rgb64, qt_bitmapblit_rgb30<PixelOrderBGR>, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6173,7 +6488,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_A2BGR30_Premultiplied { blend_color_generic_rgb64, - blend_src_generic_rgb64, qt_bitmapblit_rgb30<PixelOrderBGR>, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6182,7 +6496,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_RGB30 { blend_color_generic_rgb64, - blend_src_generic_rgb64, qt_bitmapblit_rgb30<PixelOrderRGB>, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6191,7 +6504,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_A2RGB30_Premultiplied { blend_color_generic_rgb64, - blend_src_generic_rgb64, qt_bitmapblit_rgb30<PixelOrderRGB>, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6200,7 +6512,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_Alpha8 { blend_color_generic, - blend_src_generic, 0, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6209,7 +6520,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_Grayscale8 { blend_color_generic, - blend_src_generic, 0, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6218,7 +6528,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_RGBX64 { blend_color_generic_rgb64, - blend_src_generic_rgb64, 0, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6227,7 +6536,6 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_RGBA64 { blend_color_generic_rgb64, - blend_src_generic_rgb64, 0, qt_alphamapblit_generic, qt_alphargbblit_generic, @@ -6236,82 +6544,98 @@ DrawHelper qDrawHelper[QImage::NImageFormats] = // Format_RGBA64_Premultiplied { blend_color_generic_rgb64, - blend_src_generic_rgb64, 0, qt_alphamapblit_generic, qt_alphargbblit_generic, qt_rectfill_quint64 }, + // Format_Grayscale16 + { + blend_color_generic_rgb64, + 0, + qt_alphamapblit_generic, + qt_alphargbblit_generic, + qt_rectfill_quint16 + }, }; -#if defined(Q_CC_MSVC) && !defined(_MIPS_) -template <class T> -inline void qt_memfill_template(T *dest, T color, int count) +#if !defined(__SSE2__) +void qt_memfill64(quint64 *dest, quint64 color, qsizetype count) { - while (count--) - *dest++ = color; + qt_memfill_template<quint64>(dest, color, count); } +#endif -#else - -template <class T> -inline void qt_memfill_template(T *dest, T color, int count) +#if defined(QT_COMPILER_SUPPORTS_SSSE3) && defined(Q_CC_GNU) && !defined(Q_CC_INTEL) && !defined(Q_CC_CLANG) +__attribute__((optimize("no-tree-vectorize"))) +#endif +void qt_memfill24(quint24 *dest, quint24 color, qsizetype count) { - int n = (count + 7) / 8; - switch (count & 0x07) - { - case 0: do { *dest++ = color; Q_FALLTHROUGH(); - case 7: *dest++ = color; Q_FALLTHROUGH(); - case 6: *dest++ = color; Q_FALLTHROUGH(); - case 5: *dest++ = color; Q_FALLTHROUGH(); - case 4: *dest++ = color; Q_FALLTHROUGH(); - case 3: *dest++ = color; Q_FALLTHROUGH(); - case 2: *dest++ = color; Q_FALLTHROUGH(); - case 1: *dest++ = color; - } while (--n > 0); - } -} +# ifdef QT_COMPILER_SUPPORTS_SSSE3 + extern void qt_memfill24_ssse3(quint24 *, quint24, qsizetype); + if (qCpuHasFeature(SSSE3)) + return qt_memfill24_ssse3(dest, color, count); +# endif -template <> -inline void qt_memfill_template(quint16 *dest, quint16 value, int count) -{ - if (count < 3) { - switch (count) { - case 2: *dest++ = value; Q_FALLTHROUGH(); - case 1: *dest = value; - } + const quint32 v = color; + quint24 *end = dest + count; + + // prolog: align dest to 32bit + while ((quintptr(dest) & 0x3) && dest < end) { + *dest++ = v; + } + if (dest >= end) return; + + const uint val1 = qFromBigEndian((v << 8) | (v >> 16)); + const uint val2 = qFromBigEndian((v << 16) | (v >> 8)); + const uint val3 = qFromBigEndian((v << 24) | (v >> 0)); + + for ( ; dest <= (end - 4); dest += 4) { + quint32 *dst = reinterpret_cast<quint32 *>(dest); + dst[0] = val1; + dst[1] = val2; + dst[2] = val3; } - const int align = (quintptr)(dest) & 0x3; - switch (align) { - case 2: *dest++ = value; --count; + // less than 4px left + switch (end - dest) { + case 3: + *dest++ = v; + Q_FALLTHROUGH(); + case 2: + *dest++ = v; + Q_FALLTHROUGH(); + case 1: + *dest++ = v; + } +} + +void qt_memfill16(quint16 *dest, quint16 value, qsizetype count) +{ + const int align = quintptr(dest) & 0x3; + if (align) { + *dest++ = value; + --count; } - const quint32 value32 = (value << 16) | value; - qt_memfill(reinterpret_cast<quint32*>(dest), value32, count / 2); if (count & 0x1) dest[count - 1] = value; -} -#endif -void qt_memfill64(quint64 *dest, quint64 color, int count) -{ - qt_memfill_template<quint64>(dest, color, count); + const quint32 value32 = (value << 16) | value; + qt_memfill32(reinterpret_cast<quint32*>(dest), value32, count / 2); } -#if !defined(__SSE2__) -void qt_memfill16(quint16 *dest, quint16 color, int count) -{ - qt_memfill_template<quint16>(dest, color, count); -} -#endif #if !defined(__SSE2__) && !defined(__ARM_NEON__) && !defined(__MIPS_DSP__) -void qt_memfill32(quint32 *dest, quint32 color, int count) +void qt_memfill32(quint32 *dest, quint32 color, qsizetype count) { qt_memfill_template<quint32>(dest, color, count); } #endif +#ifdef __SSE2__ +decltype(qt_memfill32_sse2) *qt_memfill32 = nullptr; +decltype(qt_memfill64_sse2) *qt_memfill64 = nullptr; +#endif #ifdef QT_COMPILER_SUPPORTS_SSE4_1 template<QtPixelOrder> void QT_FASTCALL storeA2RGB30PMFromARGB32PM_sse4(uchar *dest, const uint *src, int index, int count, const QVector<QRgb> *, QDitherInfo *); @@ -6325,6 +6649,10 @@ static void qInitDrawhelperFunctions() qInitBlendFunctions(); #ifdef __SSE2__ +# ifndef __AVX2__ + qt_memfill32 = qt_memfill32_sse2; + qt_memfill64 = qt_memfill64_sse2; +# endif qDrawHelper[QImage::Format_RGB32].bitmapBlit = qt_bitmapblit32_sse2; qDrawHelper[QImage::Format_ARGB32].bitmapBlit = qt_bitmapblit32_sse2; qDrawHelper[QImage::Format_ARGB32_Premultiplied].bitmapBlit = qt_bitmapblit32_sse2; @@ -6401,6 +6729,14 @@ static void qInitDrawhelperFunctions() const QVector<QRgb> *, QDitherInfo *); extern const uint *QT_FASTCALL fetchRGBA8888ToARGB32PM_sse4(uint *buffer, const uchar *src, int index, int count, const QVector<QRgb> *, QDitherInfo *); + extern const QRgba64 * QT_FASTCALL convertARGB32ToRGBA64PM_sse4(QRgba64 *buffer, const uint *src, int count, + const QVector<QRgb> *, QDitherInfo *); + extern const QRgba64 * QT_FASTCALL convertRGBA8888ToRGBA64PM_sse4(QRgba64 *buffer, const uint *src, int count, + const QVector<QRgb> *, QDitherInfo *); + extern const QRgba64 *QT_FASTCALL fetchARGB32ToRGBA64PM_sse4(QRgba64 *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *); + extern const QRgba64 *QT_FASTCALL fetchRGBA8888ToRGBA64PM_sse4(QRgba64 *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *); extern void QT_FASTCALL storeARGB32FromARGB32PM_sse4(uchar *dest, const uint *src, int index, int count, const QVector<QRgb> *, QDitherInfo *); extern void QT_FASTCALL storeRGBA8888FromARGB32PM_sse4(uchar *dest, const uint *src, int index, int count, @@ -6413,10 +6749,18 @@ static void qInitDrawhelperFunctions() const QVector<QRgb> *, QDitherInfo *); extern void QT_FASTCALL destStore64ARGB32_sse4(QRasterBuffer *rasterBuffer, int x, int y, const QRgba64 *buffer, int length); extern void QT_FASTCALL destStore64RGBA8888_sse4(QRasterBuffer *rasterBuffer, int x, int y, const QRgba64 *buffer, int length); +# ifndef __AVX2__ qPixelLayouts[QImage::Format_ARGB32].fetchToARGB32PM = fetchARGB32ToARGB32PM_sse4; qPixelLayouts[QImage::Format_ARGB32].convertToARGB32PM = convertARGB32ToARGB32PM_sse4; qPixelLayouts[QImage::Format_RGBA8888].fetchToARGB32PM = fetchRGBA8888ToARGB32PM_sse4; qPixelLayouts[QImage::Format_RGBA8888].convertToARGB32PM = convertRGBA8888ToARGB32PM_sse4; + qPixelLayouts[QImage::Format_ARGB32].fetchToRGBA64PM = fetchARGB32ToRGBA64PM_sse4; + qPixelLayouts[QImage::Format_ARGB32].convertToRGBA64PM = convertARGB32ToRGBA64PM_sse4; + qPixelLayouts[QImage::Format_RGBA8888].fetchToRGBA64PM = fetchRGBA8888ToRGBA64PM_sse4; + qPixelLayouts[QImage::Format_RGBA8888].convertToRGBA64PM = convertRGBA8888ToRGBA64PM_sse4; + qPixelLayouts[QImage::Format_RGBX8888].fetchToRGBA64PM = fetchRGBA8888ToRGBA64PM_sse4; + qPixelLayouts[QImage::Format_RGBX8888].convertToRGBA64PM = convertRGBA8888ToRGBA64PM_sse4; +# endif qPixelLayouts[QImage::Format_ARGB32].storeFromARGB32PM = storeARGB32FromARGB32PM_sse4; qPixelLayouts[QImage::Format_RGBA8888].storeFromARGB32PM = storeRGBA8888FromARGB32PM_sse4; qPixelLayouts[QImage::Format_RGBX8888].storeFromARGB32PM = storeRGBXFromARGB32PM_sse4; @@ -6424,13 +6768,17 @@ static void qInitDrawhelperFunctions() qPixelLayouts[QImage::Format_A2RGB30_Premultiplied].storeFromARGB32PM = storeA2RGB30PMFromARGB32PM_sse4<PixelOrderRGB>; qStoreFromRGBA64PM[QImage::Format_ARGB32] = storeARGB32FromRGBA64PM_sse4; qStoreFromRGBA64PM[QImage::Format_RGBA8888] = storeRGBA8888FromRGBA64PM_sse4; +#if QT_CONFIG(raster_64bit) destStoreProc64[QImage::Format_ARGB32] = destStore64ARGB32_sse4; destStoreProc64[QImage::Format_RGBA8888] = destStore64RGBA8888_sse4; +#endif } #endif #if defined(QT_COMPILER_SUPPORTS_AVX2) if (qCpuHasFeature(ArchHaswell)) { + qt_memfill32 = qt_memfill32_avx2; + qt_memfill64 = qt_memfill64_avx2; extern void qt_blend_rgb32_on_rgb32_avx2(uchar *destPixels, int dbpl, const uchar *srcPixels, int sbpl, int w, int h, int const_alpha); @@ -6447,18 +6795,19 @@ static void qInitDrawhelperFunctions() qBlendFunctions[QImage::Format_RGBA8888_Premultiplied][QImage::Format_RGBA8888_Premultiplied] = qt_blend_argb32_on_argb32_avx2; extern void QT_FASTCALL comp_func_Source_avx2(uint *destPixels, const uint *srcPixels, int length, uint const_alpha); - extern void QT_FASTCALL comp_func_Source_rgb64_avx2(QRgba64 *destPixels, const QRgba64 *srcPixels, int length, uint const_alpha); extern void QT_FASTCALL comp_func_SourceOver_avx2(uint *destPixels, const uint *srcPixels, int length, uint const_alpha); - extern void QT_FASTCALL comp_func_SourceOver_rgb64_avx2(QRgba64 *destPixels, const QRgba64 *srcPixels, int length, uint const_alpha); extern void QT_FASTCALL comp_func_solid_SourceOver_avx2(uint *destPixels, int length, uint color, uint const_alpha); - extern void QT_FASTCALL comp_func_solid_SourceOver_rgb64_avx2(QRgba64 *destPixels, int length, QRgba64 color, uint const_alpha); - qt_functionForMode_C[QPainter::CompositionMode_Source] = comp_func_Source_avx2; - qt_functionForMode64_C[QPainter::CompositionMode_Source] = comp_func_Source_rgb64_avx2; qt_functionForMode_C[QPainter::CompositionMode_SourceOver] = comp_func_SourceOver_avx2; - qt_functionForMode64_C[QPainter::CompositionMode_SourceOver] = comp_func_SourceOver_rgb64_avx2; qt_functionForModeSolid_C[QPainter::CompositionMode_SourceOver] = comp_func_solid_SourceOver_avx2; +#if QT_CONFIG(raster_64bit) + extern void QT_FASTCALL comp_func_Source_rgb64_avx2(QRgba64 *destPixels, const QRgba64 *srcPixels, int length, uint const_alpha); + extern void QT_FASTCALL comp_func_SourceOver_rgb64_avx2(QRgba64 *destPixels, const QRgba64 *srcPixels, int length, uint const_alpha); + extern void QT_FASTCALL comp_func_solid_SourceOver_rgb64_avx2(QRgba64 *destPixels, int length, QRgba64 color, uint const_alpha); + qt_functionForMode64_C[QPainter::CompositionMode_Source] = comp_func_Source_rgb64_avx2; + qt_functionForMode64_C[QPainter::CompositionMode_SourceOver] = comp_func_SourceOver_rgb64_avx2; qt_functionForModeSolid64_C[QPainter::CompositionMode_SourceOver] = comp_func_solid_SourceOver_rgb64_avx2; +#endif extern void QT_FASTCALL fetchTransformedBilinearARGB32PM_simple_scale_helper_avx2(uint *b, uint *end, const QTextureData &image, int &fx, int &fy, int fdx, int /*fdy*/); @@ -6470,6 +6819,28 @@ static void qInitDrawhelperFunctions() bilinearFastTransformHelperARGB32PM[0][SimpleScaleTransform] = fetchTransformedBilinearARGB32PM_simple_scale_helper_avx2; bilinearFastTransformHelperARGB32PM[0][DownscaleTransform] = fetchTransformedBilinearARGB32PM_downscale_helper_avx2; bilinearFastTransformHelperARGB32PM[0][FastRotateTransform] = fetchTransformedBilinearARGB32PM_fast_rotate_helper_avx2; + + extern void QT_FASTCALL convertARGB32ToARGB32PM_avx2(uint *buffer, int count, const QVector<QRgb> *); + extern void QT_FASTCALL convertRGBA8888ToARGB32PM_avx2(uint *buffer, int count, const QVector<QRgb> *); + extern const uint *QT_FASTCALL fetchARGB32ToARGB32PM_avx2(uint *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *); + extern const uint *QT_FASTCALL fetchRGBA8888ToARGB32PM_avx2(uint *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *); + qPixelLayouts[QImage::Format_ARGB32].fetchToARGB32PM = fetchARGB32ToARGB32PM_avx2; + qPixelLayouts[QImage::Format_ARGB32].convertToARGB32PM = convertARGB32ToARGB32PM_avx2; + qPixelLayouts[QImage::Format_RGBA8888].fetchToARGB32PM = fetchRGBA8888ToARGB32PM_avx2; + qPixelLayouts[QImage::Format_RGBA8888].convertToARGB32PM = convertRGBA8888ToARGB32PM_avx2; + +#if QT_CONFIG(raster_64bit) + extern const QRgba64 * QT_FASTCALL convertARGB32ToRGBA64PM_avx2(QRgba64 *, const uint *, int, const QVector<QRgb> *, QDitherInfo *); + extern const QRgba64 * QT_FASTCALL convertRGBA8888ToRGBA64PM_avx2(QRgba64 *, const uint *, int count, const QVector<QRgb> *, QDitherInfo *); + extern const QRgba64 *QT_FASTCALL fetchARGB32ToRGBA64PM_avx2(QRgba64 *, const uchar *, int, int, const QVector<QRgb> *, QDitherInfo *); + extern const QRgba64 *QT_FASTCALL fetchRGBA8888ToRGBA64PM_avx2(QRgba64 *, const uchar *, int, int, const QVector<QRgb> *, QDitherInfo *); + qPixelLayouts[QImage::Format_ARGB32].convertToRGBA64PM = convertARGB32ToRGBA64PM_avx2; + qPixelLayouts[QImage::Format_RGBX8888].convertToRGBA64PM = convertRGBA8888ToRGBA64PM_avx2; + qPixelLayouts[QImage::Format_ARGB32].fetchToRGBA64PM = fetchARGB32ToRGBA64PM_avx2; + qPixelLayouts[QImage::Format_RGBX8888].fetchToRGBA64PM = fetchRGBA8888ToRGBA64PM_avx2; +#endif } #endif @@ -6505,6 +6876,14 @@ static void qInitDrawhelperFunctions() const QVector<QRgb> *, QDitherInfo *); extern const uint *QT_FASTCALL fetchRGBA8888ToARGB32PM_neon(uint *buffer, const uchar *src, int index, int count, const QVector<QRgb> *, QDitherInfo *); + extern const QRgba64 * QT_FASTCALL convertARGB32ToRGBA64PM_neon(QRgba64 *buffer, const uint *src, int count, + const QVector<QRgb> *, QDitherInfo *); + extern const QRgba64 * QT_FASTCALL convertRGBA8888ToRGBA64PM_neon(QRgba64 *buffer, const uint *src, int count, + const QVector<QRgb> *, QDitherInfo *); + extern const QRgba64 *QT_FASTCALL fetchARGB32ToRGBA64PM_neon(QRgba64 *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *); + extern const QRgba64 *QT_FASTCALL fetchRGBA8888ToRGBA64PM_neon(QRgba64 *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *); extern void QT_FASTCALL storeARGB32FromARGB32PM_neon(uchar *dest, const uint *src, int index, int count, const QVector<QRgb> *, QDitherInfo *); extern void QT_FASTCALL storeRGBA8888FromARGB32PM_neon(uchar *dest, const uint *src, int index, int count, @@ -6514,10 +6893,16 @@ static void qInitDrawhelperFunctions() qPixelLayouts[QImage::Format_ARGB32].fetchToARGB32PM = fetchARGB32ToARGB32PM_neon; qPixelLayouts[QImage::Format_ARGB32].convertToARGB32PM = convertARGB32ToARGB32PM_neon; qPixelLayouts[QImage::Format_ARGB32].storeFromARGB32PM = storeARGB32FromARGB32PM_neon; + qPixelLayouts[QImage::Format_ARGB32].fetchToRGBA64PM = fetchARGB32ToRGBA64PM_neon; + qPixelLayouts[QImage::Format_ARGB32].convertToRGBA64PM = convertARGB32ToRGBA64PM_neon; qPixelLayouts[QImage::Format_RGBA8888].fetchToARGB32PM = fetchRGBA8888ToARGB32PM_neon; qPixelLayouts[QImage::Format_RGBA8888].convertToARGB32PM = convertRGBA8888ToARGB32PM_neon; qPixelLayouts[QImage::Format_RGBA8888].storeFromARGB32PM = storeRGBA8888FromARGB32PM_neon; + qPixelLayouts[QImage::Format_RGBA8888].fetchToRGBA64PM = fetchRGBA8888ToRGBA64PM_neon; + qPixelLayouts[QImage::Format_RGBA8888].convertToRGBA64PM = convertRGBA8888ToRGBA64PM_neon; qPixelLayouts[QImage::Format_RGBX8888].storeFromARGB32PM = storeRGBXFromARGB32PM_neon; + qPixelLayouts[QImage::Format_RGBX8888].fetchToRGBA64PM = fetchRGBA8888ToRGBA64PM_neon; + qPixelLayouts[QImage::Format_RGBX8888].convertToRGBA64PM = convertRGBA8888ToRGBA64PM_neon; #endif #if defined(ENABLE_PIXMAN_DRAWHELPERS) diff --git a/src/gui/painting/qdrawhelper_avx2.cpp b/src/gui/painting/qdrawhelper_avx2.cpp index ec6643deed..fb50cb6a50 100644 --- a/src/gui/painting/qdrawhelper_avx2.cpp +++ b/src/gui/painting/qdrawhelper_avx2.cpp @@ -1,6 +1,7 @@ /**************************************************************************** ** -** Copyright (C) 2016 The Qt Company Ltd. +** Copyright (C) 2018 The Qt Company Ltd. +** Copyright (C) 2018 Intel Corporation. ** Contact: https://www.qt.io/licensing/ ** ** This file is part of the QtGui module of the Qt Toolkit. @@ -38,6 +39,7 @@ ****************************************************************************/ #include "qdrawhelper_p.h" +#include "qdrawhelper_x86_p.h" #include "qdrawingprimitive_sse2_p.h" #include "qrgba64_p.h" @@ -53,7 +55,8 @@ enum { // Vectorized blend functions: // See BYTE_MUL_SSE2 for details. -inline static void BYTE_MUL_AVX2(__m256i &pixelVector, const __m256i &alphaChannel, const __m256i &colorMask, const __m256i &half) +inline static void Q_DECL_VECTORCALL +BYTE_MUL_AVX2(__m256i &pixelVector, __m256i alphaChannel, __m256i colorMask, __m256i half) { __m256i pixelVectorAG = _mm256_srli_epi16(pixelVector, 8); __m256i pixelVectorRB = _mm256_and_si256(pixelVector, colorMask); @@ -72,7 +75,8 @@ inline static void BYTE_MUL_AVX2(__m256i &pixelVector, const __m256i &alphaChann pixelVector = _mm256_or_si256(pixelVectorAG, pixelVectorRB); } -inline static void BYTE_MUL_RGB64_AVX2(__m256i &pixelVector, const __m256i &alphaChannel, const __m256i &colorMask, const __m256i &half) +inline static void Q_DECL_VECTORCALL +BYTE_MUL_RGB64_AVX2(__m256i &pixelVector, __m256i alphaChannel, __m256i colorMask, __m256i half) { __m256i pixelVectorAG = _mm256_srli_epi32(pixelVector, 16); __m256i pixelVectorRB = _mm256_and_si256(pixelVector, colorMask); @@ -92,7 +96,8 @@ inline static void BYTE_MUL_RGB64_AVX2(__m256i &pixelVector, const __m256i &alph } // See INTERPOLATE_PIXEL_255_SSE2 for details. -inline static void INTERPOLATE_PIXEL_255_AVX2(const __m256i &srcVector, __m256i &dstVector, const __m256i &alphaChannel, const __m256i &oneMinusAlphaChannel, const __m256i &colorMask, const __m256i &half) +inline static void Q_DECL_VECTORCALL +INTERPOLATE_PIXEL_255_AVX2(__m256i srcVector, __m256i &dstVector, __m256i alphaChannel, __m256i oneMinusAlphaChannel, __m256i colorMask, __m256i half) { const __m256i srcVectorAG = _mm256_srli_epi16(srcVector, 8); const __m256i dstVectorAG = _mm256_srli_epi16(dstVector, 8); @@ -114,7 +119,8 @@ inline static void INTERPOLATE_PIXEL_255_AVX2(const __m256i &srcVector, __m256i dstVector = _mm256_or_si256(finalAG, finalRB); } -inline static void INTERPOLATE_PIXEL_RGB64_AVX2(const __m256i &srcVector, __m256i &dstVector, const __m256i &alphaChannel, const __m256i &oneMinusAlphaChannel, const __m256i &colorMask, const __m256i &half) +inline static void Q_DECL_VECTORCALL +INTERPOLATE_PIXEL_RGB64_AVX2(__m256i srcVector, __m256i &dstVector, __m256i alphaChannel, __m256i oneMinusAlphaChannel, __m256i colorMask, __m256i half) { const __m256i srcVectorAG = _mm256_srli_epi32(srcVector, 16); const __m256i dstVectorAG = _mm256_srli_epi32(dstVector, 16); @@ -138,7 +144,7 @@ inline static void INTERPOLATE_PIXEL_RGB64_AVX2(const __m256i &srcVector, __m256 // See BLEND_SOURCE_OVER_ARGB32_SSE2 for details. -inline static void BLEND_SOURCE_OVER_ARGB32_AVX2(quint32 *dst, const quint32 *src, const int length) +inline static void Q_DECL_VECTORCALL BLEND_SOURCE_OVER_ARGB32_AVX2(quint32 *dst, const quint32 *src, const int length) { const __m256i half = _mm256_set1_epi16(0x80); const __m256i one = _mm256_set1_epi16(0xff); @@ -209,7 +215,8 @@ inline static void BLEND_SOURCE_OVER_ARGB32_AVX2(quint32 *dst, const quint32 *sr // See BLEND_SOURCE_OVER_ARGB32_WITH_CONST_ALPHA_SSE2 for details. -inline static void BLEND_SOURCE_OVER_ARGB32_WITH_CONST_ALPHA_AVX2(quint32 *dst, const quint32 *src, const int length, const int const_alpha) +inline static void Q_DECL_VECTORCALL +BLEND_SOURCE_OVER_ARGB32_WITH_CONST_ALPHA_AVX2(quint32 *dst, const quint32 *src, const int length, const int const_alpha) { int x = 0; @@ -316,6 +323,66 @@ void qt_blend_rgb32_on_rgb32_avx2(uchar *destPixels, int dbpl, } } +static Q_NEVER_INLINE +void Q_DECL_VECTORCALL qt_memfillXX_avx2(uchar *dest, __m256i value256, qsizetype bytes) +{ + __m128i value128 = _mm256_castsi256_si128(value256); + + // main body + __m256i *dst256 = reinterpret_cast<__m256i *>(dest); + uchar *end = dest + bytes; + while (reinterpret_cast<uchar *>(dst256 + 4) <= end) { + _mm256_storeu_si256(dst256 + 0, value256); + _mm256_storeu_si256(dst256 + 1, value256); + _mm256_storeu_si256(dst256 + 2, value256); + _mm256_storeu_si256(dst256 + 3, value256); + dst256 += 4; + } + + // first epilogue: fewer than 128 bytes / 32 entries + bytes = end - reinterpret_cast<uchar *>(dst256); + switch (bytes / sizeof(value256)) { + case 3: _mm256_storeu_si256(dst256++, value256); Q_FALLTHROUGH(); + case 2: _mm256_storeu_si256(dst256++, value256); Q_FALLTHROUGH(); + case 1: _mm256_storeu_si256(dst256++, value256); + } + + // second epilogue: fewer than 32 bytes + __m128i *dst128 = reinterpret_cast<__m128i *>(dst256); + if (bytes & sizeof(value128)) + _mm_storeu_si128(dst128++, value128); + + // third epilogue: fewer than 16 bytes + if (bytes & 8) + _mm_storel_epi64(reinterpret_cast<__m128i *>(end - 8), value128); +} + +void qt_memfill64_avx2(quint64 *dest, quint64 value, qsizetype count) +{ +#if defined(Q_CC_GNU) && !defined(Q_CC_CLANG) && !defined(Q_CC_INTEL) + // work around https://gcc.gnu.org/bugzilla/show_bug.cgi?id=80820 + __m128i value64 = _mm_set_epi64x(0, value); // _mm_cvtsi64_si128(value); +# ifdef Q_PROCESSOR_X86_64 + asm ("" : "+x" (value64)); +# endif + __m256i value256 = _mm256_broadcastq_epi64(value64); +#else + __m256i value256 = _mm256_set1_epi64x(value); +#endif + + qt_memfillXX_avx2(reinterpret_cast<uchar *>(dest), value256, count * sizeof(quint64)); +} + +void qt_memfill32_avx2(quint32 *dest, quint32 value, qsizetype count) +{ + if (count % 2) { + // odd number of pixels, round to even + *dest++ = value; + --count; + } + qt_memfillXX_avx2(reinterpret_cast<uchar *>(dest), _mm256_set1_epi32(value), count * sizeof(quint32)); +} + void QT_FASTCALL comp_func_SourceOver_avx2(uint *destPixels, const uint *srcPixels, int length, uint const_alpha) { Q_ASSERT(const_alpha < 256); @@ -329,6 +396,7 @@ void QT_FASTCALL comp_func_SourceOver_avx2(uint *destPixels, const uint *srcPixe BLEND_SOURCE_OVER_ARGB32_WITH_CONST_ALPHA_AVX2(dst, src, length, const_alpha); } +#if QT_CONFIG(raster_64bit) void QT_FASTCALL comp_func_SourceOver_rgb64_avx2(QRgba64 *dst, const QRgba64 *src, int length, uint const_alpha) { Q_ASSERT(const_alpha < 256); // const_alpha is in [0-255] @@ -386,6 +454,7 @@ void QT_FASTCALL comp_func_SourceOver_rgb64_avx2(QRgba64 *dst, const QRgba64 *sr blend_pixel(dst[x], src[x], const_alpha); } } +#endif void QT_FASTCALL comp_func_Source_avx2(uint *dst, const uint *src, int length, uint const_alpha) { @@ -418,6 +487,7 @@ void QT_FASTCALL comp_func_Source_avx2(uint *dst, const uint *src, int length, u } } +#if QT_CONFIG(raster_64bit) void QT_FASTCALL comp_func_Source_rgb64_avx2(QRgba64 *dst, const QRgba64 *src, int length, uint const_alpha) { Q_ASSERT(const_alpha < 256); // const_alpha is in [0-255] @@ -450,6 +520,7 @@ void QT_FASTCALL comp_func_Source_rgb64_avx2(QRgba64 *dst, const QRgba64 *src, i dst[x] = interpolate65535(src[x], ca, dst[x], cia); } } +#endif void QT_FASTCALL comp_func_solid_SourceOver_avx2(uint *destPixels, int length, uint color, uint const_alpha) { @@ -482,6 +553,7 @@ void QT_FASTCALL comp_func_solid_SourceOver_avx2(uint *destPixels, int length, u } } +#if QT_CONFIG(raster_64bit) void QT_FASTCALL comp_func_solid_SourceOver_rgb64_avx2(QRgba64 *destPixels, int length, QRgba64 color, uint const_alpha) { Q_ASSERT(const_alpha < 256); // const_alpha is in [0-255] @@ -512,6 +584,7 @@ void QT_FASTCALL comp_func_solid_SourceOver_rgb64_avx2(QRgba64 *destPixels, int destPixels[x] = color + multiplyAlpha65535(destPixels[x], minusAlphaOfColor); } } +#endif #define interpolate_4_pixels_16_avx2(tlr1, tlr2, blr1, blr2, distx, disty, colorMask, v_256, b) \ { \ @@ -928,6 +1001,233 @@ void QT_FASTCALL fetchTransformedBilinearARGB32PM_fast_rotate_helper_avx2(uint * } } +static inline __m256i epilogueMaskFromCount(qsizetype count) +{ + Q_ASSERT(count > 0); + static const __m256i offsetMask = _mm256_setr_epi32(0, 1, 2, 3, 4, 5, 6, 7); + return _mm256_add_epi32(offsetMask, _mm256_set1_epi32(-count)); +} + +template<bool RGBA> +static void convertARGBToARGB32PM_avx2(uint *buffer, const uint *src, qsizetype count) +{ + qsizetype i = 0; + const __m256i alphaMask = _mm256_set1_epi32(0xff000000); + const __m256i rgbaMask = _mm256_broadcastsi128_si256(_mm_setr_epi8(2, 1, 0, 3, 6, 5, 4, 7, 10, 9, 8, 11, 14, 13, 12, 15)); + const __m256i shuffleMask = _mm256_broadcastsi128_si256(_mm_setr_epi8(6, 7, 6, 7, 6, 7, 6, 7, 14, 15, 14, 15, 14, 15, 14, 15)); + const __m256i half = _mm256_set1_epi16(0x0080); + const __m256i zero = _mm256_setzero_si256(); + + for (; i < count - 7; i += 8) { + __m256i srcVector = _mm256_loadu_si256(reinterpret_cast<const __m256i *>(src + i)); + if (!_mm256_testz_si256(srcVector, alphaMask)) { + // keep the two _mm_test[zc]_siXXX next to each other + bool cf = _mm256_testc_si256(srcVector, alphaMask); + if (RGBA) + srcVector = _mm256_shuffle_epi8(srcVector, rgbaMask); + if (!cf) { + __m256i src1 = _mm256_unpacklo_epi8(srcVector, zero); + __m256i src2 = _mm256_unpackhi_epi8(srcVector, zero); + __m256i alpha1 = _mm256_shuffle_epi8(src1, shuffleMask); + __m256i alpha2 = _mm256_shuffle_epi8(src2, shuffleMask); + src1 = _mm256_mullo_epi16(src1, alpha1); + src2 = _mm256_mullo_epi16(src2, alpha2); + src1 = _mm256_add_epi16(src1, _mm256_srli_epi16(src1, 8)); + src2 = _mm256_add_epi16(src2, _mm256_srli_epi16(src2, 8)); + src1 = _mm256_add_epi16(src1, half); + src2 = _mm256_add_epi16(src2, half); + src1 = _mm256_srli_epi16(src1, 8); + src2 = _mm256_srli_epi16(src2, 8); + src1 = _mm256_blend_epi16(src1, alpha1, 0x88); + src2 = _mm256_blend_epi16(src2, alpha2, 0x88); + srcVector = _mm256_packus_epi16(src1, src2); + _mm256_storeu_si256(reinterpret_cast<__m256i *>(buffer + i), srcVector); + } else { + if (buffer != src || RGBA) + _mm256_storeu_si256(reinterpret_cast<__m256i *>(buffer + i), srcVector); + } + } else { + _mm256_storeu_si256(reinterpret_cast<__m256i *>(buffer + i), zero); + } + } + + if (i < count) { + const __m256i epilogueMask = epilogueMaskFromCount(count - i); + __m256i srcVector = _mm256_maskload_epi32(reinterpret_cast<const int *>(src + i), epilogueMask); + const __m256i epilogueAlphaMask = _mm256_blendv_epi8(_mm256_setzero_si256(), alphaMask, epilogueMask); + + if (!_mm256_testz_si256(srcVector, epilogueAlphaMask)) { + // keep the two _mm_test[zc]_siXXX next to each other + bool cf = _mm256_testc_si256(srcVector, epilogueAlphaMask); + if (RGBA) + srcVector = _mm256_shuffle_epi8(srcVector, rgbaMask); + if (!cf) { + __m256i src1 = _mm256_unpacklo_epi8(srcVector, zero); + __m256i src2 = _mm256_unpackhi_epi8(srcVector, zero); + __m256i alpha1 = _mm256_shuffle_epi8(src1, shuffleMask); + __m256i alpha2 = _mm256_shuffle_epi8(src2, shuffleMask); + src1 = _mm256_mullo_epi16(src1, alpha1); + src2 = _mm256_mullo_epi16(src2, alpha2); + src1 = _mm256_add_epi16(src1, _mm256_srli_epi16(src1, 8)); + src2 = _mm256_add_epi16(src2, _mm256_srli_epi16(src2, 8)); + src1 = _mm256_add_epi16(src1, half); + src2 = _mm256_add_epi16(src2, half); + src1 = _mm256_srli_epi16(src1, 8); + src2 = _mm256_srli_epi16(src2, 8); + src1 = _mm256_blend_epi16(src1, alpha1, 0x88); + src2 = _mm256_blend_epi16(src2, alpha2, 0x88); + srcVector = _mm256_packus_epi16(src1, src2); + _mm256_maskstore_epi32(reinterpret_cast<int *>(buffer + i), epilogueMask, srcVector); + } else { + if (buffer != src || RGBA) + _mm256_maskstore_epi32(reinterpret_cast<int *>(buffer + i), epilogueMask, srcVector); + } + } else { + _mm256_maskstore_epi32(reinterpret_cast<int *>(buffer + i), epilogueMask, zero); + } + } +} + +void QT_FASTCALL convertARGB32ToARGB32PM_avx2(uint *buffer, int count, const QVector<QRgb> *) +{ + convertARGBToARGB32PM_avx2<false>(buffer, buffer, count); +} + +void QT_FASTCALL convertRGBA8888ToARGB32PM_avx2(uint *buffer, int count, const QVector<QRgb> *) +{ + convertARGBToARGB32PM_avx2<true>(buffer, buffer, count); +} + +const uint *QT_FASTCALL fetchARGB32ToARGB32PM_avx2(uint *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGBToARGB32PM_avx2<false>(buffer, reinterpret_cast<const uint *>(src) + index, count); + return buffer; +} + +const uint *QT_FASTCALL fetchRGBA8888ToARGB32PM_avx2(uint *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGBToARGB32PM_avx2<true>(buffer, reinterpret_cast<const uint *>(src) + index, count); + return buffer; +} + +template<bool RGBA> +static void convertARGBToRGBA64PM_avx2(QRgba64 *buffer, const uint *src, qsizetype count) +{ + qsizetype i = 0; + const __m256i alphaMask = _mm256_set1_epi32(0xff000000); + const __m256i rgbaMask = _mm256_broadcastsi128_si256(_mm_setr_epi8(2, 1, 0, 3, 6, 5, 4, 7, 10, 9, 8, 11, 14, 13, 12, 15)); + const __m256i shuffleMask = _mm256_broadcastsi128_si256(_mm_setr_epi8(6, 7, 6, 7, 6, 7, 6, 7, 14, 15, 14, 15, 14, 15, 14, 15)); + const __m256i zero = _mm256_setzero_si256(); + + for (; i < count - 7; i += 8) { + __m256i dst1, dst2; + __m256i srcVector = _mm256_loadu_si256(reinterpret_cast<const __m256i *>(src + i)); + if (!_mm256_testz_si256(srcVector, alphaMask)) { + // keep the two _mm_test[zc]_siXXX next to each other + bool cf = _mm256_testc_si256(srcVector, alphaMask); + if (!RGBA) + srcVector = _mm256_shuffle_epi8(srcVector, rgbaMask); + + // The two unpack instructions unpack the low and upper halves of + // each 128-bit half of the 256-bit register. Here's the tracking + // of what's where: (p is 32-bit, P is 64-bit) + // as loaded: [ p1, p2, p3, p4; p5, p6, p7, p8 ] + // after permute4x64 [ p1, p2, p5, p6; p3, p4, p7, p8 ] + // after unpacklo/hi [ P1, P2; P3, P4 ] [ P5, P6; P7, P8 ] + srcVector = _mm256_permute4x64_epi64(srcVector, _MM_SHUFFLE(3, 1, 2, 0)); + + const __m256i src1 = _mm256_unpacklo_epi8(srcVector, srcVector); + const __m256i src2 = _mm256_unpackhi_epi8(srcVector, srcVector); + if (!cf) { + const __m256i alpha1 = _mm256_shuffle_epi8(src1, shuffleMask); + const __m256i alpha2 = _mm256_shuffle_epi8(src2, shuffleMask); + dst1 = _mm256_mulhi_epu16(src1, alpha1); + dst2 = _mm256_mulhi_epu16(src2, alpha2); + dst1 = _mm256_add_epi16(dst1, _mm256_srli_epi16(dst1, 15)); + dst2 = _mm256_add_epi16(dst2, _mm256_srli_epi16(dst2, 15)); + dst1 = _mm256_blend_epi16(dst1, src1, 0x88); + dst2 = _mm256_blend_epi16(dst2, src2, 0x88); + } else { + dst1 = src1; + dst2 = src2; + } + } else { + dst1 = dst2 = zero; + } + _mm256_storeu_si256(reinterpret_cast<__m256i *>(buffer + i), dst1); + _mm256_storeu_si256(reinterpret_cast<__m256i *>(buffer + i) + 1, dst2); + } + + if (i < count) { + __m256i epilogueMask = epilogueMaskFromCount(count - i); + const __m256i epilogueAlphaMask = _mm256_blendv_epi8(_mm256_setzero_si256(), alphaMask, epilogueMask); + __m256i dst1, dst2; + __m256i srcVector = _mm256_maskload_epi32(reinterpret_cast<const int *>(src + i), epilogueMask); + + if (!_mm256_testz_si256(srcVector, epilogueAlphaMask)) { + // keep the two _mm_test[zc]_siXXX next to each other + bool cf = _mm256_testc_si256(srcVector, epilogueAlphaMask); + if (!RGBA) + srcVector = _mm256_shuffle_epi8(srcVector, rgbaMask); + srcVector = _mm256_permute4x64_epi64(srcVector, _MM_SHUFFLE(3, 1, 2, 0)); + const __m256i src1 = _mm256_unpacklo_epi8(srcVector, srcVector); + const __m256i src2 = _mm256_unpackhi_epi8(srcVector, srcVector); + if (!cf) { + const __m256i alpha1 = _mm256_shuffle_epi8(src1, shuffleMask); + const __m256i alpha2 = _mm256_shuffle_epi8(src2, shuffleMask); + dst1 = _mm256_mulhi_epu16(src1, alpha1); + dst2 = _mm256_mulhi_epu16(src2, alpha2); + dst1 = _mm256_add_epi16(dst1, _mm256_srli_epi16(dst1, 15)); + dst2 = _mm256_add_epi16(dst2, _mm256_srli_epi16(dst2, 15)); + dst1 = _mm256_blend_epi16(dst1, src1, 0x88); + dst2 = _mm256_blend_epi16(dst2, src2, 0x88); + } else { + dst1 = src1; + dst2 = src2; + } + } else { + dst1 = dst2 = zero; + } + epilogueMask = _mm256_permute4x64_epi64(epilogueMask, _MM_SHUFFLE(3, 1, 2, 0)); + _mm256_maskstore_epi64(reinterpret_cast<qint64 *>(buffer + i), + _mm256_unpacklo_epi32(epilogueMask, epilogueMask), + dst1); + _mm256_maskstore_epi64(reinterpret_cast<qint64 *>(buffer + i + 4), + _mm256_unpackhi_epi32(epilogueMask, epilogueMask), + dst2); + } +} + +const QRgba64 * QT_FASTCALL convertARGB32ToRGBA64PM_avx2(QRgba64 *buffer, const uint *src, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGBToRGBA64PM_avx2<false>(buffer, src, count); + return buffer; +} + +const QRgba64 * QT_FASTCALL convertRGBA8888ToRGBA64PM_avx2(QRgba64 *buffer, const uint *src, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGBToRGBA64PM_avx2<true>(buffer, src, count); + return buffer; +} + +const QRgba64 *QT_FASTCALL fetchARGB32ToRGBA64PM_avx2(QRgba64 *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGBToRGBA64PM_avx2<false>(buffer, reinterpret_cast<const uint *>(src) + index, count); + return buffer; +} + +const QRgba64 *QT_FASTCALL fetchRGBA8888ToRGBA64PM_avx2(QRgba64 *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGBToRGBA64PM_avx2<true>(buffer, reinterpret_cast<const uint *>(src) + index, count); + return buffer; +} + QT_END_NAMESPACE #endif diff --git a/src/gui/painting/qdrawhelper_mips_dsp.cpp b/src/gui/painting/qdrawhelper_mips_dsp.cpp index e92a6606de..17597deb1d 100644 --- a/src/gui/painting/qdrawhelper_mips_dsp.cpp +++ b/src/gui/painting/qdrawhelper_mips_dsp.cpp @@ -43,7 +43,7 @@ QT_BEGIN_NAMESPACE -void qt_memfill32(quint32 *dest, quint32 color, int count) +void qt_memfill32(quint32 *dest, quint32 color, qsizetype count) { qt_memfill32_asm_mips_dsp(dest, color, count); } diff --git a/src/gui/painting/qdrawhelper_mips_dsp_p.h b/src/gui/painting/qdrawhelper_mips_dsp_p.h index 36c4af2732..a3d0410274 100644 --- a/src/gui/painting/qdrawhelper_mips_dsp_p.h +++ b/src/gui/painting/qdrawhelper_mips_dsp_p.h @@ -57,7 +57,7 @@ QT_BEGIN_NAMESPACE #if defined(QT_COMPILER_SUPPORTS_MIPS_DSP) -extern "C" void qt_memfill32_asm_mips_dsp(quint32 *dest, quint32 value, int count); +extern "C" void qt_memfill32_asm_mips_dsp(quint32 *dest, quint32 value, qsizetype count); extern "C" void comp_func_SourceOver_asm_mips_dsp(uint *dest, const uint *src, int length, uint const_alpha); diff --git a/src/gui/painting/qdrawhelper_neon.cpp b/src/gui/painting/qdrawhelper_neon.cpp index 629dfe2358..8196a87b24 100644 --- a/src/gui/painting/qdrawhelper_neon.cpp +++ b/src/gui/painting/qdrawhelper_neon.cpp @@ -47,10 +47,21 @@ QT_BEGIN_NAMESPACE -void qt_memfill32(quint32 *dest, quint32 value, int count) +void qt_memfill32(quint32 *dest, quint32 value, qsizetype count) { const int epilogueSize = count % 16; -#if !defined(Q_PROCESSOR_ARM_64) +#if defined(Q_CC_GHS) || defined(Q_CC_MSVC) + // inline assembler free version: + if (count >= 16) { + quint32 *const neonEnd = dest + count - epilogueSize; + const uint32x4_t valueVector1 = vdupq_n_u32(value); + const uint32x4x4_t valueVector4 = { valueVector1, valueVector1, valueVector1, valueVector1 }; + do { + vst4q_u32(dest, valueVector4); + dest += 16; + } while (dest != neonEnd); + } +#elif !defined(Q_PROCESSOR_ARM_64) if (count >= 16) { quint32 *const neonEnd = dest + count - epilogueSize; register uint32x4_t valueVector1 asm ("q0") = vdupq_n_u32(value); @@ -84,20 +95,20 @@ void qt_memfill32(quint32 *dest, quint32 value, int count) switch (epilogueSize) { - case 15: *dest++ = value; - case 14: *dest++ = value; - case 13: *dest++ = value; - case 12: *dest++ = value; - case 11: *dest++ = value; - case 10: *dest++ = value; - case 9: *dest++ = value; - case 8: *dest++ = value; - case 7: *dest++ = value; - case 6: *dest++ = value; - case 5: *dest++ = value; - case 4: *dest++ = value; - case 3: *dest++ = value; - case 2: *dest++ = value; + case 15: *dest++ = value; Q_FALLTHROUGH(); + case 14: *dest++ = value; Q_FALLTHROUGH(); + case 13: *dest++ = value; Q_FALLTHROUGH(); + case 12: *dest++ = value; Q_FALLTHROUGH(); + case 11: *dest++ = value; Q_FALLTHROUGH(); + case 10: *dest++ = value; Q_FALLTHROUGH(); + case 9: *dest++ = value; Q_FALLTHROUGH(); + case 8: *dest++ = value; Q_FALLTHROUGH(); + case 7: *dest++ = value; Q_FALLTHROUGH(); + case 6: *dest++ = value; Q_FALLTHROUGH(); + case 5: *dest++ = value; Q_FALLTHROUGH(); + case 4: *dest++ = value; Q_FALLTHROUGH(); + case 3: *dest++ = value; Q_FALLTHROUGH(); + case 2: *dest++ = value; Q_FALLTHROUGH(); case 1: *dest++ = value; } } @@ -791,7 +802,7 @@ void QT_FASTCALL qt_destStoreRGB16_neon(QRasterBuffer *rasterBuffer, int x, int void QT_FASTCALL comp_func_solid_SourceOver_neon(uint *destPixels, int length, uint color, uint const_alpha) { if ((const_alpha & qAlpha(color)) == 255) { - QT_MEMFILL_UINT(destPixels, length, color); + qt_memfill32(destPixels, color, length); } else { if (const_alpha != 255) color = BYTE_MUL(color, const_alpha); @@ -1149,6 +1160,72 @@ static inline void convertARGBToARGB32PM_neon(uint *buffer, const uint *src, int } } +template<bool RGBA> +static inline void convertARGB32ToRGBA64PM_neon(QRgba64 *buffer, const uint *src, int count) +{ + if (count <= 0) + return; + + const uint8x8_t shuffleMask = { 3, 3, 3, 3, 7, 7, 7, 7}; + const uint64x2_t blendMask = vdupq_n_u64(Q_UINT64_C(0xffff000000000000)); + + int i = 0; + for (; i < count-3; i += 4) { + uint32x4_t vs32 = vld1q_u32(src + i); + uint32x4_t alphaVector = vshrq_n_u32(vs32, 24); +#if defined(Q_PROCESSOR_ARM_64) + uint32_t alphaSum = vaddvq_u32(alphaVector); +#else + // no vaddvq_u32 + uint32x2_t tmp = vpadd_u32(vget_low_u32(alphaVector), vget_high_u32(alphaVector)); + uint32_t alphaSum = vget_lane_u32(vpadd_u32(tmp, tmp), 0); +#endif + if (alphaSum) { + if (!RGBA) + vs32 = vrgba2argb(vs32); + const uint8x16_t vs8 = vreinterpretq_u8_u32(vs32); + const uint8x16x2_t v = vzipq_u8(vs8, vs8); + if (alphaSum != 255 * 4) { + const uint8x8_t s1 = vreinterpret_u8_u32(vget_low_u32(vs32)); + const uint8x8_t s2 = vreinterpret_u8_u32(vget_high_u32(vs32)); + const uint8x8_t alpha1 = vtbl1_u8(s1, shuffleMask); + const uint8x8_t alpha2 = vtbl1_u8(s2, shuffleMask); + uint16x8_t src1 = vmull_u8(s1, alpha1); + uint16x8_t src2 = vmull_u8(s2, alpha2); + // convert from 0->(255x255) to 0->(255x257) + src1 = vsraq_n_u16(src1, src1, 7); + src2 = vsraq_n_u16(src2, src2, 7); + + // now restore alpha from the trivial conversion + const uint64x2_t d1 = vbslq_u64(blendMask, vreinterpretq_u64_u8(v.val[0]), vreinterpretq_u64_u16(src1)); + const uint64x2_t d2 = vbslq_u64(blendMask, vreinterpretq_u64_u8(v.val[1]), vreinterpretq_u64_u16(src2)); + + vst1q_u16((uint16_t *)buffer, vreinterpretq_u16_u64(d1)); + buffer += 2; + vst1q_u16((uint16_t *)buffer, vreinterpretq_u16_u64(d2)); + buffer += 2; + } else { + vst1q_u16((uint16_t *)buffer, vreinterpretq_u16_u8(v.val[0])); + buffer += 2; + vst1q_u16((uint16_t *)buffer, vreinterpretq_u16_u8(v.val[1])); + buffer += 2; + } + } else { + vst1q_u16((uint16_t *)buffer, vdupq_n_u16(0)); + buffer += 2; + vst1q_u16((uint16_t *)buffer, vdupq_n_u16(0)); + buffer += 2; + } + } + + SIMD_EPILOGUE(i, count, 3) { + uint s = src[i]; + if (RGBA) + s = RGBA2ARGB(s); + *buffer++ = QRgba64::fromArgb32(s).premultiplied(); + } +} + static inline float32x4_t reciprocal_mul_ps(float32x4_t a, float mul) { float32x4_t ia = vrecpeq_f32(a); // estimate 1/a @@ -1258,6 +1335,34 @@ const uint *QT_FASTCALL fetchRGBA8888ToARGB32PM_neon(uint *buffer, const uchar * return buffer; } +const QRgba64 * QT_FASTCALL convertARGB32ToRGBA64PM_neon(QRgba64 *buffer, const uint *src, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGB32ToRGBA64PM_neon<false>(buffer, src, count); + return buffer; +} + +const QRgba64 * QT_FASTCALL convertRGBA8888ToRGBA64PM_neon(QRgba64 *buffer, const uint *src, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGB32ToRGBA64PM_neon<true>(buffer, src, count); + return buffer; +} + +const QRgba64 *QT_FASTCALL fetchARGB32ToRGBA64PM_neon(QRgba64 *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGB32ToRGBA64PM_neon<false>(buffer, reinterpret_cast<const uint *>(src) + index, count); + return buffer; +} + +const QRgba64 *QT_FASTCALL fetchRGBA8888ToRGBA64PM_neon(QRgba64 *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGB32ToRGBA64PM_neon<true>(buffer, reinterpret_cast<const uint *>(src) + index, count); + return buffer; +} + void QT_FASTCALL storeRGB32FromARGB32PM_neon(uchar *dest, const uint *src, int index, int count, const QVector<QRgb> *, QDitherInfo *) { diff --git a/src/gui/painting/qdrawhelper_neon_p.h b/src/gui/painting/qdrawhelper_neon_p.h index 40475a9bde..19e1f21a3b 100644 --- a/src/gui/painting/qdrawhelper_neon_p.h +++ b/src/gui/painting/qdrawhelper_neon_p.h @@ -123,7 +123,7 @@ void qt_transform_image_rgb16_on_rgb16_neon(uchar *destPixels, int dbpl, const QTransform &targetRectTransform, int const_alpha); -void qt_memfill32_neon(quint32 *dest, quint32 value, int count); +void qt_memfill32_neon(quint32 *dest, quint32 value, qsizetype count); void qt_memrotate90_16_neon(const uchar *srcPixels, int w, int h, int sbpl, uchar *destPixels, int dbpl); void qt_memrotate270_16_neon(const uchar *srcPixels, int w, int h, int sbpl, uchar *destPixels, int dbpl); diff --git a/src/gui/painting/qdrawhelper_p.h b/src/gui/painting/qdrawhelper_p.h index fb08261205..9c5d525722 100644 --- a/src/gui/painting/qdrawhelper_p.h +++ b/src/gui/painting/qdrawhelper_p.h @@ -69,14 +69,18 @@ QT_BEGIN_NAMESPACE #if defined(Q_CC_GNU) -# define Q_STATIC_TEMPLATE_FUNCTION static # define Q_DECL_RESTRICT __restrict__ +# if defined(Q_PROCESSOR_X86_32) && defined(Q_CC_GNU) && !defined(Q_CC_CLANG) && !defined(Q_CC_INTEL) +# define Q_DECL_VECTORCALL __attribute__((sseregparm,regparm(3))) +# else +# define Q_DECL_VECTORCALL +# endif #elif defined(Q_CC_MSVC) -# define Q_STATIC_TEMPLATE_FUNCTION static # define Q_DECL_RESTRICT __restrict +# define Q_DECL_VECTORCALL __vectorcall #else -# define Q_STATIC_TEMPLATE_FUNCTION static # define Q_DECL_RESTRICT +# define Q_DECL_VECTORCALL #endif static const uint AMASK = 0xff000000; @@ -149,7 +153,6 @@ typedef void (*MemRotateFunc)(const uchar *srcPixels, int w, int h, int sbpl, uc struct DrawHelper { ProcessSpans blendColor; - ProcessSpans blendGradient; BitmapBlitFunc bitmapBlit; AlphamapBlitFunc alphamapBlit; AlphaRGBBlitFunc alphaRGBBlit; @@ -162,10 +165,33 @@ extern SrcOverTransformFunc qTransformFunctions[QImage::NImageFormats][QImage::N extern DrawHelper qDrawHelper[QImage::NImageFormats]; +struct quint24 { + quint24() = default; + quint24(uint value) + { + data[0] = uchar(value >> 16); + data[1] = uchar(value >> 8); + data[2] = uchar(value); + } + operator uint() const + { + return data[2] | (data[1] << 8) | (data[0] << 16); + } + + uchar data[3]; +}; + +void qBlendGradient(int count, const QSpan *spans, void *userData); void qBlendTexture(int count, const QSpan *spans, void *userData); -extern void qt_memfill64(quint64 *dest, quint64 value, int count); -extern void qt_memfill32(quint32 *dest, quint32 value, int count); -extern void qt_memfill16(quint16 *dest, quint16 value, int count); +#ifdef __SSE2__ +extern void (*qt_memfill64)(quint64 *dest, quint64 value, qsizetype count); +extern void (*qt_memfill32)(quint32 *dest, quint32 value, qsizetype count); +#else +extern void qt_memfill64(quint64 *dest, quint64 value, qsizetype count); +extern void qt_memfill32(quint32 *dest, quint32 value, qsizetype count); +#endif +extern void qt_memfill24(quint24 *dest, quint24 value, qsizetype count); +extern void qt_memfill16(quint16 *dest, quint16 value, qsizetype count); typedef void (QT_FASTCALL *CompositionFunction)(uint *Q_DECL_RESTRICT dest, const uint *Q_DECL_RESTRICT src, int length, uint const_alpha); typedef void (QT_FASTCALL *CompositionFunction64)(QRgba64 *Q_DECL_RESTRICT dest, const QRgba64 *Q_DECL_RESTRICT src, int length, uint const_alpha); @@ -222,11 +248,6 @@ struct Operator class QRasterPaintEngine; -struct QSolidData -{ - QRgba64 color; -}; - struct QLinearGradientData { struct { @@ -275,7 +296,9 @@ struct QGradientData #define GRADIENT_STOPTABLE_SIZE 1024 #define GRADIENT_STOPTABLE_SIZE_SHIFT 10 +#if QT_CONFIG(raster_64bit) const QRgba64 *colorTable64; //[GRADIENT_STOPTABLE_SIZE]; +#endif const QRgb *colorTable32; //[GRADIENT_STOPTABLE_SIZE]; uint alphaColor : 1; @@ -307,7 +330,7 @@ struct QTextureData struct QSpanData { - QSpanData() : tempImage(0) {} + QSpanData() : tempImage(nullptr) {} ~QSpanData() { delete tempImage; } QRasterBuffer *rasterBuffer; @@ -331,8 +354,8 @@ struct QSpanData int fast_matrix : 1; bool bilinear; QImage *tempImage; + QRgba64 solidColor; union { - QSolidData solid; QGradientData gradient; QTextureData texture; }; @@ -381,11 +404,13 @@ static inline uint qt_gradient_pixel(const QGradientData *data, qreal pos) return data->colorTable32[qt_gradient_clamp(data, ipos)]; } +#if QT_CONFIG(raster_64bit) static inline const QRgba64& qt_gradient_pixel64(const QGradientData *data, qreal pos) { int ipos = int(pos * (GRADIENT_STOPTABLE_SIZE - 1) + qreal(0.5)); return data->colorTable64[qt_gradient_clamp(data, ipos)]; } +#endif static inline qreal qRadialDeterminant(qreal a, qreal b, qreal c) { @@ -858,6 +883,8 @@ static Q_ALWAYS_INLINE uint BYTE_MUL_RGB16_32(uint x, uint a) { // qt_div_255 is a fast rounded division by 255 using an approximation that is accurate for all positive 16-bit integers static Q_DECL_CONSTEXPR Q_ALWAYS_INLINE int qt_div_255(int x) { return (x + (x>>8) + 0x80) >> 8; } +static Q_DECL_CONSTEXPR Q_ALWAYS_INLINE uint qt_div_257_floor(uint x) { return (x - (x >> 8)) >> 8; } +static Q_DECL_CONSTEXPR Q_ALWAYS_INLINE uint qt_div_257(uint x) { return qt_div_257_floor(x + 128); } static Q_DECL_CONSTEXPR Q_ALWAYS_INLINE uint qt_div_65535(uint x) { return (x + (x>>16) + 0x8000U) >> 16; } static Q_ALWAYS_INLINE uint qAlphaRgb30(uint c) @@ -868,76 +895,63 @@ static Q_ALWAYS_INLINE uint qAlphaRgb30(uint c) return a; } -struct quint24 { - quint24() = default; - quint24(uint value); - operator uint() const; - uchar data[3]; -}; - -inline quint24::quint24(uint value) +template <class T> inline void qt_memfill_template(T *dest, T color, qsizetype count) { - data[0] = uchar(value >> 16); - data[1] = uchar(value >> 8); - data[2] = uchar(value); + if (!count) + return; + + qsizetype n = (count + 7) / 8; + switch (count & 0x07) + { + case 0: do { *dest++ = color; Q_FALLTHROUGH(); + case 7: *dest++ = color; Q_FALLTHROUGH(); + case 6: *dest++ = color; Q_FALLTHROUGH(); + case 5: *dest++ = color; Q_FALLTHROUGH(); + case 4: *dest++ = color; Q_FALLTHROUGH(); + case 3: *dest++ = color; Q_FALLTHROUGH(); + case 2: *dest++ = color; Q_FALLTHROUGH(); + case 1: *dest++ = color; + } while (--n > 0); + } } -inline quint24::operator uint() const +template <class T> inline void qt_memfill(T *dest, T value, qsizetype count) { - return data[2] | (data[1] << 8) | (data[0] << 16); + qt_memfill_template(dest, value, count); } -template <class T> Q_STATIC_TEMPLATE_FUNCTION -void qt_memfill(T *dest, T value, int count); - -template<> inline void qt_memfill(quint64 *dest, quint64 color, int count) +template<> inline void qt_memfill(quint64 *dest, quint64 color, qsizetype count) { qt_memfill64(dest, color, count); } -template<> inline void qt_memfill(quint32 *dest, quint32 color, int count) +template<> inline void qt_memfill(quint32 *dest, quint32 color, qsizetype count) { qt_memfill32(dest, color, count); } -template<> inline void qt_memfill(quint16 *dest, quint16 color, int count) +template<> inline void qt_memfill(quint24 *dest, quint24 color, qsizetype count) { - qt_memfill16(dest, color, count); + qt_memfill24(dest, color, count); } -template<> inline void qt_memfill(quint8 *dest, quint8 color, int count) +template<> inline void qt_memfill(quint16 *dest, quint16 color, qsizetype count) { - memset(dest, color, count); + qt_memfill16(dest, color, count); } -template <class T> -inline void qt_memfill(T *dest, T value, int count) +template<> inline void qt_memfill(quint8 *dest, quint8 color, qsizetype count) { - if (!count) - return; - - int n = (count + 7) / 8; - switch (count & 0x07) - { - case 0: do { *dest++ = value; Q_FALLTHROUGH(); - case 7: *dest++ = value; Q_FALLTHROUGH(); - case 6: *dest++ = value; Q_FALLTHROUGH(); - case 5: *dest++ = value; Q_FALLTHROUGH(); - case 4: *dest++ = value; Q_FALLTHROUGH(); - case 3: *dest++ = value; Q_FALLTHROUGH(); - case 2: *dest++ = value; Q_FALLTHROUGH(); - case 1: *dest++ = value; - } while (--n > 0); - } + memset(dest, color, count); } -template <class T> Q_STATIC_TEMPLATE_FUNCTION +template <class T> static inline void qt_rectfill(T *dest, T value, int x, int y, int width, int height, qsizetype stride) { char *d = reinterpret_cast<char*>(dest + x) + y * stride; if (uint(stride) == (width * sizeof(T))) { - qt_memfill(reinterpret_cast<T*>(d), value, width * height); + qt_memfill(reinterpret_cast<T*>(d), value, qsizetype(width) * height); } else { for (int j = 0; j < height; ++j) { dest = reinterpret_cast<T*>(d); @@ -947,52 +961,6 @@ inline void qt_rectfill(T *dest, T value, } } -#define QT_MEMFILL_UINT(dest, length, color) \ - qt_memfill<quint32>(dest, color, length); - -#define QT_MEMFILL_USHORT(dest, length, color) \ - qt_memfill<quint16>(dest, color, length); - -#define QT_MEMCPY_REV_UINT(dest, src, length) \ -do { \ - /* Duff's device */ \ - uint *_d = (uint*)(dest) + length; \ - const uint *_s = (uint*)(src) + length; \ - int n = ((length) + 7) / 8; \ - switch ((length) & 0x07) \ - { \ - case 0: do { *--_d = *--_s; Q_FALLTHROUGH(); \ - case 7: *--_d = *--_s; Q_FALLTHROUGH(); \ - case 6: *--_d = *--_s; Q_FALLTHROUGH(); \ - case 5: *--_d = *--_s; Q_FALLTHROUGH(); \ - case 4: *--_d = *--_s; Q_FALLTHROUGH(); \ - case 3: *--_d = *--_s; Q_FALLTHROUGH(); \ - case 2: *--_d = *--_s; Q_FALLTHROUGH(); \ - case 1: *--_d = *--_s; \ - } while (--n > 0); \ - } \ -} while (false) - -#define QT_MEMCPY_USHORT(dest, src, length) \ -do { \ - /* Duff's device */ \ - ushort *_d = (ushort*)(dest); \ - const ushort *_s = (const ushort*)(src); \ - int n = ((length) + 7) / 8; \ - switch ((length) & 0x07) \ - { \ - case 0: do { *_d++ = *_s++; Q_FALLTHROUGH(); \ - case 7: *_d++ = *_s++; Q_FALLTHROUGH(); \ - case 6: *_d++ = *_s++; Q_FALLTHROUGH(); \ - case 5: *_d++ = *_s++; Q_FALLTHROUGH(); \ - case 4: *_d++ = *_s++; Q_FALLTHROUGH(); \ - case 3: *_d++ = *_s++; Q_FALLTHROUGH(); \ - case 2: *_d++ = *_s++; Q_FALLTHROUGH(); \ - case 1: *_d++ = *_s++; \ - } while (--n > 0); \ - } \ -} while (false) - inline ushort qConvertRgb32To16(uint c) { return (((c) >> 3) & 0x001f) diff --git a/src/gui/painting/qdrawhelper_sse2.cpp b/src/gui/painting/qdrawhelper_sse2.cpp index 3212ffdd2d..c82f41ec88 100644 --- a/src/gui/painting/qdrawhelper_sse2.cpp +++ b/src/gui/painting/qdrawhelper_sse2.cpp @@ -233,19 +233,71 @@ void QT_FASTCALL comp_func_Source_sse2(uint *dst, const uint *src, int length, u } } -void qt_memfill32(quint32 *dest, quint32 value, int count) +#ifndef __AVX2__ +static Q_NEVER_INLINE +void Q_DECL_VECTORCALL qt_memfillXX_aligned(void *dest, __m128i value128, quintptr bytecount) { - if (count < 7) { + __m128i *dst128 = reinterpret_cast<__m128i *>(dest); + __m128i *end128 = reinterpret_cast<__m128i *>(static_cast<uchar *>(dest) + bytecount); + + while (dst128 + 4 <= end128) { + _mm_store_si128(dst128 + 0, value128); + _mm_store_si128(dst128 + 1, value128); + _mm_store_si128(dst128 + 2, value128); + _mm_store_si128(dst128 + 3, value128); + dst128 += 4; + } + + bytecount %= 4 * sizeof(__m128i); + switch (bytecount / sizeof(__m128i)) { + case 3: _mm_store_si128(dst128++, value128); Q_FALLTHROUGH(); + case 2: _mm_store_si128(dst128++, value128); Q_FALLTHROUGH(); + case 1: _mm_store_si128(dst128++, value128); + } +} + +void qt_memfill64_sse2(quint64 *dest, quint64 value, qsizetype count) +{ + quintptr misaligned = quintptr(dest) % sizeof(__m128i); + if (misaligned && count) { +#if defined(Q_PROCESSOR_X86_32) + // Before SSE came out, the alignment of the stack used to be only 4 + // bytes and some OS/ABIs (notably, code generated by MSVC) still only + // align to that. In any case, we cannot count on the alignment of + // quint64 to be 8 -- see QtPrivate::AlignOf_WorkaroundForI386Abi in + // qglobal.h. + // + // If the pointer is not aligned to at least 8 bytes, then we'll never + // in turn hit a multiple of 16 for the qt_memfillXX_aligned call + // below. + if (Q_UNLIKELY(misaligned % sizeof(quint64))) + return qt_memfill_template(dest, value, count); +#endif + + *dest++ = value; + --count; + } + + if (count % 2) { + dest[count - 1] = value; + --count; + } + + qt_memfillXX_aligned(dest, _mm_set1_epi64x(value), count * sizeof(quint64)); +} + +void qt_memfill32_sse2(quint32 *dest, quint32 value, qsizetype count) +{ + if (count < 4) { + // this simplifies the code below: the first switch can fall through + // without checking the value of count switch (count) { - case 6: *dest++ = value; Q_FALLTHROUGH(); - case 5: *dest++ = value; Q_FALLTHROUGH(); - case 4: *dest++ = value; Q_FALLTHROUGH(); case 3: *dest++ = value; Q_FALLTHROUGH(); case 2: *dest++ = value; Q_FALLTHROUGH(); case 1: *dest = value; } return; - }; + } const int align = (quintptr)(dest) & 0xf; switch (align) { @@ -263,25 +315,9 @@ void qt_memfill32(quint32 *dest, quint32 value, int count) } } - int count128 = count / 4; - __m128i *dst128 = reinterpret_cast<__m128i*>(dest); - __m128i *end128 = dst128 + count128; - const __m128i value128 = _mm_set_epi32(value, value, value, value); - - while (dst128 + 3 < end128) { - _mm_stream_si128(dst128 + 0, value128); - _mm_stream_si128(dst128 + 1, value128); - _mm_stream_si128(dst128 + 2, value128); - _mm_stream_si128(dst128 + 3, value128); - dst128 += 4; - } - - switch (count128 & 0x3) { - case 3: _mm_stream_si128(dst128++, value128); Q_FALLTHROUGH(); - case 2: _mm_stream_si128(dst128++, value128); Q_FALLTHROUGH(); - case 1: _mm_stream_si128(dst128++, value128); - } + qt_memfillXX_aligned(dest, _mm_set1_epi32(value), count * sizeof(quint32)); } +#endif // !__AVX2__ void QT_FASTCALL comp_func_solid_SourceOver_sse2(uint *destPixels, int length, uint color, uint const_alpha) { @@ -314,28 +350,6 @@ void QT_FASTCALL comp_func_solid_SourceOver_sse2(uint *destPixels, int length, u } } -void qt_memfill16(quint16 *dest, quint16 value, int count) -{ - if (count < 3) { - switch (count) { - case 2: *dest++ = value; Q_FALLTHROUGH(); - case 1: *dest = value; - } - return; - } - - const int align = (quintptr)(dest) & 0x3; - switch (align) { - case 2: *dest++ = value; --count; - } - - const quint32 value32 = (value << 16) | value; - qt_memfill32(reinterpret_cast<quint32*>(dest), value32, count / 2); - - if (count & 0x1) - dest[count - 1] = value; -} - void qt_bitmapblit32_sse2_base(QRasterBuffer *rasterBuffer, int x, int y, quint32 color, const uchar *src, int width, int height, int stride) @@ -440,30 +454,30 @@ public: union Vect_buffer_i { Int32x4 v; int i[4]; }; union Vect_buffer_f { Float32x4 v; float f[4]; }; - static inline Float32x4 v_dup(float x) { return _mm_set1_ps(x); } - static inline Float32x4 v_dup(double x) { return _mm_set1_ps(x); } - static inline Int32x4 v_dup(int x) { return _mm_set1_epi32(x); } - static inline Int32x4 v_dup(uint x) { return _mm_set1_epi32(x); } + static inline Float32x4 Q_DECL_VECTORCALL v_dup(float x) { return _mm_set1_ps(x); } + static inline Float32x4 Q_DECL_VECTORCALL v_dup(double x) { return _mm_set1_ps(x); } + static inline Int32x4 Q_DECL_VECTORCALL v_dup(int x) { return _mm_set1_epi32(x); } + static inline Int32x4 Q_DECL_VECTORCALL v_dup(uint x) { return _mm_set1_epi32(x); } - static inline Float32x4 v_add(Float32x4 a, Float32x4 b) { return _mm_add_ps(a, b); } - static inline Int32x4 v_add(Int32x4 a, Int32x4 b) { return _mm_add_epi32(a, b); } + static inline Float32x4 Q_DECL_VECTORCALL v_add(Float32x4 a, Float32x4 b) { return _mm_add_ps(a, b); } + static inline Int32x4 Q_DECL_VECTORCALL v_add(Int32x4 a, Int32x4 b) { return _mm_add_epi32(a, b); } - static inline Float32x4 v_max(Float32x4 a, Float32x4 b) { return _mm_max_ps(a, b); } - static inline Float32x4 v_min(Float32x4 a, Float32x4 b) { return _mm_min_ps(a, b); } - static inline Int32x4 v_min_16(Int32x4 a, Int32x4 b) { return _mm_min_epi16(a, b); } + static inline Float32x4 Q_DECL_VECTORCALL v_max(Float32x4 a, Float32x4 b) { return _mm_max_ps(a, b); } + static inline Float32x4 Q_DECL_VECTORCALL v_min(Float32x4 a, Float32x4 b) { return _mm_min_ps(a, b); } + static inline Int32x4 Q_DECL_VECTORCALL v_min_16(Int32x4 a, Int32x4 b) { return _mm_min_epi16(a, b); } - static inline Int32x4 v_and(Int32x4 a, Int32x4 b) { return _mm_and_si128(a, b); } + static inline Int32x4 Q_DECL_VECTORCALL v_and(Int32x4 a, Int32x4 b) { return _mm_and_si128(a, b); } - static inline Float32x4 v_sub(Float32x4 a, Float32x4 b) { return _mm_sub_ps(a, b); } - static inline Int32x4 v_sub(Int32x4 a, Int32x4 b) { return _mm_sub_epi32(a, b); } + static inline Float32x4 Q_DECL_VECTORCALL v_sub(Float32x4 a, Float32x4 b) { return _mm_sub_ps(a, b); } + static inline Int32x4 Q_DECL_VECTORCALL v_sub(Int32x4 a, Int32x4 b) { return _mm_sub_epi32(a, b); } - static inline Float32x4 v_mul(Float32x4 a, Float32x4 b) { return _mm_mul_ps(a, b); } + static inline Float32x4 Q_DECL_VECTORCALL v_mul(Float32x4 a, Float32x4 b) { return _mm_mul_ps(a, b); } - static inline Float32x4 v_sqrt(Float32x4 x) { return _mm_sqrt_ps(x); } + static inline Float32x4 Q_DECL_VECTORCALL v_sqrt(Float32x4 x) { return _mm_sqrt_ps(x); } - static inline Int32x4 v_toInt(Float32x4 x) { return _mm_cvttps_epi32(x); } + static inline Int32x4 Q_DECL_VECTORCALL v_toInt(Float32x4 x) { return _mm_cvttps_epi32(x); } - static inline Int32x4 v_greaterOrEqual(Float32x4 a, Float32x4 b) { return _mm_castps_si128(_mm_cmpgt_ps(a, b)); } + static inline Int32x4 Q_DECL_VECTORCALL v_greaterOrEqual(Float32x4 a, Float32x4 b) { return _mm_castps_si128(_mm_cmpgt_ps(a, b)); } }; const uint * QT_FASTCALL qt_fetch_radial_gradient_sse2(uint *buffer, const Operator *op, const QSpanData *data, diff --git a/src/gui/painting/qdrawhelper_sse4.cpp b/src/gui/painting/qdrawhelper_sse4.cpp index e3cc1dd43e..5e8acc332d 100644 --- a/src/gui/painting/qdrawhelper_sse4.cpp +++ b/src/gui/painting/qdrawhelper_sse4.cpp @@ -45,6 +45,7 @@ QT_BEGIN_NAMESPACE +#ifndef __AVX2__ template<bool RGBA> static void convertARGBToARGB32PM_sse4(uint *buffer, const uint *src, int count) { @@ -94,7 +95,55 @@ static void convertARGBToARGB32PM_sse4(uint *buffer, const uint *src, int count) } } -static inline __m128 reciprocal_mul_ps(__m128 a, float mul) +template<bool RGBA> +static void convertARGBToRGBA64PM_sse4(QRgba64 *buffer, const uint *src, int count) +{ + int i = 0; + const __m128i alphaMask = _mm_set1_epi32(0xff000000); + const __m128i rgbaMask = _mm_setr_epi8(2, 1, 0, 3, 6, 5, 4, 7, 10, 9, 8, 11, 14, 13, 12, 15); + const __m128i shuffleMask = _mm_setr_epi8(6, 7, 6, 7, 6, 7, 6, 7, 14, 15, 14, 15, 14, 15, 14, 15); + const __m128i zero = _mm_setzero_si128(); + + for (; i < count - 3; i += 4) { + __m128i srcVector = _mm_loadu_si128((const __m128i *)&src[i]); + if (!_mm_testz_si128(srcVector, alphaMask)) { + bool cf = _mm_testc_si128(srcVector, alphaMask); + + if (!RGBA) + srcVector = _mm_shuffle_epi8(srcVector, rgbaMask); + const __m128i src1 = _mm_unpacklo_epi8(srcVector, srcVector); + const __m128i src2 = _mm_unpackhi_epi8(srcVector, srcVector); + if (!cf) { + __m128i alpha1 = _mm_shuffle_epi8(src1, shuffleMask); + __m128i alpha2 = _mm_shuffle_epi8(src2, shuffleMask); + __m128i dst1 = _mm_mulhi_epu16(src1, alpha1); + __m128i dst2 = _mm_mulhi_epu16(src2, alpha2); + // Map 0->0xfffe to 0->0xffff + dst1 = _mm_add_epi16(dst1, _mm_srli_epi16(dst1, 15)); + dst2 = _mm_add_epi16(dst2, _mm_srli_epi16(dst2, 15)); + // correct alpha value: + dst1 = _mm_blend_epi16(dst1, src1, 0x88); + dst2 = _mm_blend_epi16(dst2, src2, 0x88); + _mm_storeu_si128((__m128i *)&buffer[i], dst1); + _mm_storeu_si128((__m128i *)&buffer[i + 2], dst2); + } else { + _mm_storeu_si128((__m128i *)&buffer[i], src1); + _mm_storeu_si128((__m128i *)&buffer[i + 2], src2); + } + } else { + _mm_storeu_si128((__m128i *)&buffer[i], zero); + _mm_storeu_si128((__m128i *)&buffer[i + 2], zero); + } + } + + SIMD_EPILOGUE(i, count, 3) { + const uint s = RGBA ? RGBA2ARGB(src[i]) : src[i]; + buffer[i] = QRgba64::fromArgb32(s).premultiplied(); + } +} +#endif // __AVX2__ + +static inline __m128 Q_DECL_VECTORCALL reciprocal_mul_ps(__m128 a, float mul) { __m128 ia = _mm_rcp_ps(a); // Approximate 1/a // Improve precision of ia using Newton-Raphson @@ -174,7 +223,7 @@ template<bool RGBA> static inline void convertARGBFromRGBA64PM_sse4(uint *buffer, const QRgba64 *src, int count) { int i = 0; - const __m128i alphaMask = _mm_set1_epi64x(Q_UINT64_C(0xffff) << 48); + const __m128i alphaMask = _mm_set1_epi64x(qint64(Q_UINT64_C(0xffff) << 48)); const __m128i alphaMask32 = _mm_set1_epi32(0xff000000); const __m128i rgbaMask = _mm_setr_epi8(2, 1, 0, 3, 6, 5, 4, 7, 10, 9, 8, 11, 14, 13, 12, 15); const __m128i zero = _mm_setzero_si128(); @@ -259,6 +308,7 @@ static inline void convertARGBFromRGBA64PM_sse4(uint *buffer, const QRgba64 *src } } +#ifndef __AVX2__ void QT_FASTCALL convertARGB32ToARGB32PM_sse4(uint *buffer, int count, const QVector<QRgb> *) { convertARGBToARGB32PM_sse4<false>(buffer, buffer, count); @@ -269,6 +319,20 @@ void QT_FASTCALL convertRGBA8888ToARGB32PM_sse4(uint *buffer, int count, const Q convertARGBToARGB32PM_sse4<true>(buffer, buffer, count); } +const QRgba64 * QT_FASTCALL convertARGB32ToRGBA64PM_sse4(QRgba64 *buffer, const uint *src, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGBToRGBA64PM_sse4<false>(buffer, src, count); + return buffer; +} + +const QRgba64 * QT_FASTCALL convertRGBA8888ToRGBA64PM_sse4(QRgba64 *buffer, const uint *src, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGBToRGBA64PM_sse4<true>(buffer, src, count); + return buffer; +} + const uint *QT_FASTCALL fetchARGB32ToARGB32PM_sse4(uint *buffer, const uchar *src, int index, int count, const QVector<QRgb> *, QDitherInfo *) { @@ -283,6 +347,21 @@ const uint *QT_FASTCALL fetchRGBA8888ToARGB32PM_sse4(uint *buffer, const uchar * return buffer; } +const QRgba64 *QT_FASTCALL fetchARGB32ToRGBA64PM_sse4(QRgba64 *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGBToRGBA64PM_sse4<false>(buffer, reinterpret_cast<const uint *>(src) + index, count); + return buffer; +} + +const QRgba64 *QT_FASTCALL fetchRGBA8888ToRGBA64PM_sse4(QRgba64 *buffer, const uchar *src, int index, int count, + const QVector<QRgb> *, QDitherInfo *) +{ + convertARGBToRGBA64PM_sse4<true>(buffer, reinterpret_cast<const uint *>(src) + index, count); + return buffer; +} +#endif // __AVX2__ + void QT_FASTCALL storeRGB32FromARGB32PM_sse4(uchar *dest, const uint *src, int index, int count, const QVector<QRgb> *, QDitherInfo *) { @@ -320,6 +399,7 @@ void QT_FASTCALL storeA2RGB30PMFromARGB32PM_sse4(uchar *dest, const uint *src, i d[i] = qConvertArgb32ToA2rgb30_sse4<PixelOrder>(src[i]); } +#if QT_CONFIG(raster_64bit) void QT_FASTCALL destStore64ARGB32_sse4(QRasterBuffer *rasterBuffer, int x, int y, const QRgba64 *buffer, int length) { uint *dest = (uint*)rasterBuffer->scanLine(y) + x; @@ -331,6 +411,7 @@ void QT_FASTCALL destStore64RGBA8888_sse4(QRasterBuffer *rasterBuffer, int x, in uint *dest = (uint*)rasterBuffer->scanLine(y) + x; convertARGBFromRGBA64PM_sse4<true>(dest, buffer, length); } +#endif void QT_FASTCALL storeARGB32FromRGBA64PM_sse4(uchar *dest, const QRgba64 *src, int index, int count, const QVector<QRgb> *, QDitherInfo *) diff --git a/src/gui/painting/qdrawhelper_ssse3.cpp b/src/gui/painting/qdrawhelper_ssse3.cpp index 42d760d5cc..35d61c3e6c 100644 --- a/src/gui/painting/qdrawhelper_ssse3.cpp +++ b/src/gui/painting/qdrawhelper_ssse3.cpp @@ -1,6 +1,7 @@ /**************************************************************************** ** -** Copyright (C) 2016 The Qt Company Ltd. +** Copyright (C) 2018 The Qt Company Ltd. +** Copyright (C) 2018 Intel Corporation. ** Contact: https://www.qt.io/licensing/ ** ** This file is part of the QtGui module of the Qt Toolkit. @@ -79,55 +80,58 @@ QT_BEGIN_NAMESPACE // The computation being done is: // result = s + d * (1-alpha) // with shortcuts if fully opaque or fully transparent. -#define BLEND_SOURCE_OVER_ARGB32_SSSE3(dst, src, length, nullVector, half, one, colorMask, alphaMask) { \ - int x = 0; \ -\ - /* First, get dst aligned. */ \ - ALIGNMENT_PROLOGUE_16BYTES(dst, x, length) { \ - blend_pixel(dst[x], src[x]); \ - } \ -\ - const int minusOffsetToAlignSrcOn16Bytes = (reinterpret_cast<quintptr>(&(src[x])) >> 2) & 0x3;\ -\ - if (!minusOffsetToAlignSrcOn16Bytes) {\ - /* src is aligned, usual algorithm but with aligned operations.\ - See the SSE2 version for more documentation on the algorithm itself. */\ - const __m128i alphaShuffleMask = _mm_set_epi8(char(0xff),15,char(0xff),15,char(0xff),11,char(0xff),11,char(0xff),7,char(0xff),7,char(0xff),3,char(0xff),3);\ - for (; x < length-3; x += 4) { \ - const __m128i srcVector = _mm_load_si128((const __m128i *)&src[x]); \ - const __m128i srcVectorAlpha = _mm_and_si128(srcVector, alphaMask); \ - if (_mm_movemask_epi8(_mm_cmpeq_epi32(srcVectorAlpha, alphaMask)) == 0xffff) { \ - _mm_store_si128((__m128i *)&dst[x], srcVector); \ - } else if (_mm_movemask_epi8(_mm_cmpeq_epi32(srcVectorAlpha, nullVector)) != 0xffff) { \ - __m128i alphaChannel = _mm_shuffle_epi8(srcVector, alphaShuffleMask); \ - alphaChannel = _mm_sub_epi16(one, alphaChannel); \ - const __m128i dstVector = _mm_load_si128((__m128i *)&dst[x]); \ - __m128i destMultipliedByOneMinusAlpha; \ - BYTE_MUL_SSE2(destMultipliedByOneMinusAlpha, dstVector, alphaChannel, colorMask, half); \ - const __m128i result = _mm_add_epi8(srcVector, destMultipliedByOneMinusAlpha); \ - _mm_store_si128((__m128i *)&dst[x], result); \ - } \ - } /* end for() */\ - } else if ((length - x) >= 8) {\ - /* We use two vectors to extract the src: prevLoaded for the first pixels, lastLoaded for the current pixels. */\ - __m128i srcVectorPrevLoaded = _mm_load_si128((const __m128i *)&src[x - minusOffsetToAlignSrcOn16Bytes]);\ - const int palignrOffset = minusOffsetToAlignSrcOn16Bytes << 2;\ -\ - const __m128i alphaShuffleMask = _mm_set_epi8(char(0xff),15,char(0xff),15,char(0xff),11,char(0xff),11,char(0xff),7,char(0xff),7,char(0xff),3,char(0xff),3);\ - switch (palignrOffset) {\ - case 4:\ - BLENDING_LOOP(4, length)\ - break;\ - case 8:\ - BLENDING_LOOP(8, length)\ - break;\ - case 12:\ - BLENDING_LOOP(12, length)\ - break;\ - }\ - }\ - for (; x < length; ++x) \ - blend_pixel(dst[x], src[x]); \ +static inline void Q_DECL_VECTORCALL +BLEND_SOURCE_OVER_ARGB32_SSSE3(quint32 *dst, const quint32 *src, int length, + __m128i nullVector, __m128i half, __m128i one, __m128i colorMask, __m128i alphaMask) +{ + int x = 0; + + /* First, get dst aligned. */ + ALIGNMENT_PROLOGUE_16BYTES(dst, x, length) { + blend_pixel(dst[x], src[x]); + } + + const int minusOffsetToAlignSrcOn16Bytes = (reinterpret_cast<quintptr>(&(src[x])) >> 2) & 0x3; + + if (!minusOffsetToAlignSrcOn16Bytes) { + /* src is aligned, usual algorithm but with aligned operations. + See the SSE2 version for more documentation on the algorithm itself. */ + const __m128i alphaShuffleMask = _mm_set_epi8(char(0xff),15,char(0xff),15,char(0xff),11,char(0xff),11,char(0xff),7,char(0xff),7,char(0xff),3,char(0xff),3); + for (; x < length-3; x += 4) { + const __m128i srcVector = _mm_load_si128((const __m128i *)&src[x]); + const __m128i srcVectorAlpha = _mm_and_si128(srcVector, alphaMask); + if (_mm_movemask_epi8(_mm_cmpeq_epi32(srcVectorAlpha, alphaMask)) == 0xffff) { + _mm_store_si128((__m128i *)&dst[x], srcVector); + } else if (_mm_movemask_epi8(_mm_cmpeq_epi32(srcVectorAlpha, nullVector)) != 0xffff) { + __m128i alphaChannel = _mm_shuffle_epi8(srcVector, alphaShuffleMask); + alphaChannel = _mm_sub_epi16(one, alphaChannel); + const __m128i dstVector = _mm_load_si128((__m128i *)&dst[x]); + __m128i destMultipliedByOneMinusAlpha; + BYTE_MUL_SSE2(destMultipliedByOneMinusAlpha, dstVector, alphaChannel, colorMask, half); + const __m128i result = _mm_add_epi8(srcVector, destMultipliedByOneMinusAlpha); + _mm_store_si128((__m128i *)&dst[x], result); + } + } /* end for() */ + } else if ((length - x) >= 8) { + /* We use two vectors to extract the src: prevLoaded for the first pixels, lastLoaded for the current pixels. */ + __m128i srcVectorPrevLoaded = _mm_load_si128((const __m128i *)&src[x - minusOffsetToAlignSrcOn16Bytes]); + const int palignrOffset = minusOffsetToAlignSrcOn16Bytes << 2; + + const __m128i alphaShuffleMask = _mm_set_epi8(char(0xff),15,char(0xff),15,char(0xff),11,char(0xff),11,char(0xff),7,char(0xff),7,char(0xff),3,char(0xff),3); + switch (palignrOffset) { + case 4: + BLENDING_LOOP(4, length) + break; + case 8: + BLENDING_LOOP(8, length) + break; + case 12: + BLENDING_LOOP(12, length) + break; + } + } + for (; x < length; ++x) + blend_pixel(dst[x], src[x]); } void qt_blend_argb32_on_argb32_ssse3(uchar *destPixels, int dbpl, @@ -185,6 +189,71 @@ const uint * QT_FASTCALL qt_fetchUntransformed_888_ssse3(uint *buffer, const Ope return buffer; } +void qt_memfill24_ssse3(quint24 *dest, quint24 color, qsizetype count) +{ + // LCM of 12 and 16 bytes is 48 bytes (16 px) + quint32 v = color; + __m128i m = _mm_cvtsi32_si128(v); + quint24 *end = dest + count; + + constexpr uchar x = 2, y = 1, z = 0; + Q_DECL_ALIGN(__m128i) static const uchar + shuffleMask[16 + 1] = { x, y, z, x, y, z, x, y, z, x, y, z, x, y, z, x, y }; + + __m128i mval1 = _mm_shuffle_epi8(m, _mm_load_si128(reinterpret_cast<const __m128i *>(shuffleMask))); + __m128i mval2 = _mm_shuffle_epi8(m, _mm_loadu_si128(reinterpret_cast<const __m128i *>(shuffleMask + 1))); + __m128i mval3 = _mm_alignr_epi8(mval2, mval1, 2); + + for ( ; dest + 16 <= end; dest += 16) { +#ifdef __AVX__ + // Store using 32-byte AVX instruction + __m256 mval12 = _mm256_castps128_ps256(_mm_castsi128_ps(mval1)); + mval12 = _mm256_insertf128_ps(mval12, _mm_castsi128_ps(mval2), 1); + _mm256_storeu_ps(reinterpret_cast<float *>(dest), mval12); +#else + _mm_storeu_si128(reinterpret_cast<__m128i *>(dest) + 0, mval1); + _mm_storeu_si128(reinterpret_cast<__m128i *>(dest) + 1, mval2); +#endif + _mm_storeu_si128(reinterpret_cast<__m128i *>(dest) + 2, mval3); + } + + if (count < 3) { + if (count > 1) + end[-2] = v; + if (count) + end[-1] = v; + return; + } + + // less than 16px/48B left + uchar *ptr = reinterpret_cast<uchar *>(dest); + uchar *ptr_end = reinterpret_cast<uchar *>(end); + qptrdiff left = ptr_end - ptr; + if (left >= 24) { + // 8px/24B or more left + _mm_storeu_si128(reinterpret_cast<__m128i *>(ptr) + 0, mval1); + _mm_storel_epi64(reinterpret_cast<__m128i *>(ptr) + 1, mval2); + ptr += 24; + left -= 24; + } + + // less than 8px/24B left + + if (left >= 16) { + // but more than 5px/15B left + _mm_storeu_si128(reinterpret_cast<__m128i *>(ptr) , mval1); + } else if (left >= 8) { + // but more than 2px/6B left + _mm_storel_epi64(reinterpret_cast<__m128i *>(ptr), mval1); + } + + if (left) { + // 1 or 2px left + // store 8 bytes ending with the right values (will overwrite a bit) + _mm_storel_epi64(reinterpret_cast<__m128i *>(ptr_end - 8), mval2); + } +} + QT_END_NAMESPACE #endif // QT_COMPILER_SUPPORTS_SSSE3 diff --git a/src/gui/painting/qdrawhelper_x86_p.h b/src/gui/painting/qdrawhelper_x86_p.h index cefc213999..5749d8c9fb 100644 --- a/src/gui/painting/qdrawhelper_x86_p.h +++ b/src/gui/painting/qdrawhelper_x86_p.h @@ -57,8 +57,8 @@ QT_BEGIN_NAMESPACE #ifdef __SSE2__ -void qt_memfill32(quint32 *dest, quint32 value, int count); -void qt_memfill16(quint16 *dest, quint16 value, int count); +void qt_memfill64_sse2(quint64 *dest, quint64 value, qsizetype count); +void qt_memfill32_sse2(quint32 *dest, quint32 value, qsizetype count); void qt_bitmapblit32_sse2(QRasterBuffer *rasterBuffer, int x, int y, const QRgba64 &color, const uchar *src, int width, int height, int stride); @@ -79,6 +79,9 @@ void qt_blend_rgb32_on_rgb32_sse2(uchar *destPixels, int dbpl, extern CompositionFunction qt_functionForMode_SSE2[]; extern CompositionFunctionSolid qt_functionForModeSolid_SSE2[]; + +void qt_memfill64_avx2(quint64 *dest, quint64 value, qsizetype count); +void qt_memfill32_avx2(quint32 *dest, quint32 value, qsizetype count); #endif // __SSE2__ static const int numCompositionFunctions = 38; diff --git a/src/gui/painting/qdrawingprimitive_sse2_p.h b/src/gui/painting/qdrawingprimitive_sse2_p.h index b237ea1611..cc8d230fa8 100644 --- a/src/gui/painting/qdrawingprimitive_sse2_p.h +++ b/src/gui/painting/qdrawingprimitive_sse2_p.h @@ -42,7 +42,7 @@ #include <QtGui/private/qtguiglobal_p.h> #include <private/qsimd_p.h> -#include "qdrawhelper_p.h" +#include "qdrawhelper_x86_p.h" #include "qrgba64_p.h" #ifdef __SSE2__ @@ -232,7 +232,7 @@ QT_END_NAMESPACE QT_BEGIN_NAMESPACE #if QT_COMPILER_SUPPORTS_HERE(SSE4_1) QT_FUNCTION_TARGET(SSE2) -Q_ALWAYS_INLINE void reciprocal_mul_ss(__m128 &ia, const __m128 a, float mul) +Q_ALWAYS_INLINE void Q_DECL_VECTORCALL reciprocal_mul_ss(__m128 &ia, const __m128 a, float mul) { ia = _mm_rcp_ss(a); // Approximate 1/a // Improve precision of ia using Newton-Raphson diff --git a/src/gui/painting/qicc.cpp b/src/gui/painting/qicc.cpp new file mode 100644 index 0000000000..d88b005782 --- /dev/null +++ b/src/gui/painting/qicc.cpp @@ -0,0 +1,669 @@ +/**************************************************************************** +** +** Copyright (C) 2016 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#include "qicc_p.h" + +#include <qbuffer.h> +#include <qbytearray.h> +#include <qdatastream.h> +#include <qloggingcategory.h> +#include <qendian.h> + +#include "qcolorspace_p.h" +#include "qcolortrc_p.h" + +QT_BEGIN_NAMESPACE +Q_LOGGING_CATEGORY(lcIcc, "qt.gui.icc") + +struct ICCProfileHeader +{ + quint32_be profileSize; + + quint32_be preferredCmmType; + + quint32_be profileVersion; + quint32_be profileClass; + quint32_be inputColorSpace; + quint32_be pcs; + quint32_be datetime[3]; + quint32_be signature; + quint32_be platformSignature; + quint32_be flags; + quint32_be deviceManufacturer; + quint32_be deviceModel; + quint32_be deviceAttributes[2]; + + quint32_be renderingIntent; + qint32_be illuminantXyz[3]; + + quint32_be creatorSignature; + quint32_be profileId[4]; + + quint32_be reserved[7]; + +// Technically after the header, but easier to include here: + quint32_be tagCount; +}; + +constexpr quint32 IccTag(uchar a, uchar b, uchar c, uchar d) +{ + return (a << 24) | (b << 16) | (c << 8) | d; +} + +enum class ProfileClass : quint32 { + Input = IccTag('s', 'c', 'r', 'n'), + Display = IccTag('m', 'n', 't', 'r'), + // Not supported: + Output = IccTag('p', 'r', 't', 'r'), + ColorSpace = IccTag('s', 'p', 'a', 'c'), +}; + +enum class Tag : quint32 { + acsp = IccTag('a', 'c', 's', 'p'), + RGB_ = IccTag('R', 'G', 'B', ' '), + XYZ_ = IccTag('X', 'Y', 'Z', ' '), + rXYZ = IccTag('r', 'X', 'Y', 'Z'), + gXYZ = IccTag('g', 'X', 'Y', 'Z'), + bXYZ = IccTag('b', 'X', 'Y', 'Z'), + rTRC = IccTag('r', 'T', 'R', 'C'), + gTRC = IccTag('g', 'T', 'R', 'C'), + bTRC = IccTag('b', 'T', 'R', 'C'), + A2B0 = IccTag('A', '2', 'B', '0'), + A2B1 = IccTag('A', '2', 'B', '1'), + B2A0 = IccTag('B', '2', 'A', '0'), + B2A1 = IccTag('B', '2', 'A', '1'), + desc = IccTag('d', 'e', 's', 'c'), + text = IccTag('t', 'e', 'x', 't'), + cprt = IccTag('c', 'p', 'r', 't'), + curv = IccTag('c', 'u', 'r', 'v'), + para = IccTag('p', 'a', 'r', 'a'), + wtpt = IccTag('w', 't', 'p', 't'), + bkpt = IccTag('b', 'k', 'p', 't'), + mft1 = IccTag('m', 'f', 't', '1'), + mft2 = IccTag('m', 'f', 't', '2'), + mAB_ = IccTag('m', 'A', 'B', ' '), + mBA_ = IccTag('m', 'B', 'A', ' '), + chad = IccTag('c', 'h', 'a', 'd'), + sf32 = IccTag('s', 'f', '3', '2'), + + // Apple extensions for ICCv2: + aarg = IccTag('a', 'a', 'r', 'g'), + aagg = IccTag('a', 'a', 'g', 'g'), + aabg = IccTag('a', 'a', 'b', 'g'), +}; + +inline uint qHash(const Tag &key, uint seed = 0) +{ + return qHash(quint32(key), seed); +} + +namespace QIcc { + +struct TagTableEntry +{ + quint32_be signature; + quint32_be offset; + quint32_be size; +}; + +struct GenericTagData { + quint32_be type; + quint32_be null; +}; + +struct XYZTagData : GenericTagData { + qint32_be fixedX; + qint32_be fixedY; + qint32_be fixedZ; +}; + +struct CurvTagData : GenericTagData { + quint32_be valueCount; + quint16_be value[1]; +}; + +struct ParaTagData : GenericTagData { + quint16_be curveType; + quint16_be null2; + quint32_be parameter[1]; +}; + +// For both mAB and mBA +struct mABTagData : GenericTagData { + quint8 inputChannels; + quint8 outputChannels; + quint8 padding[2]; + quint32_be bCurvesOffset; + quint32_be matrixOffset; + quint32_be mCurvesOffset; + quint32_be clutOffset; + quint32_be aCurvesOffset; +}; + +struct Sf32TagData : GenericTagData { + quint32_be value[1]; +}; + +static int toFixedS1516(float x) +{ + return int(x * 65536.0f + 0.5f); +} + +static float fromFixedS1516(int x) +{ + return x * (1.0f / 65536.0f); +} + +QColorVector fromXyzData(const XYZTagData *xyz) +{ + const float x = fromFixedS1516(xyz->fixedX); + const float y = fromFixedS1516(xyz->fixedY); + const float z = fromFixedS1516(xyz->fixedZ); + qCDebug(lcIcc) << "XYZ_ " << x << y << z; + + return QColorVector(x, y, z); +} + +static bool isValidIccProfile(const ICCProfileHeader &header) +{ + if (header.signature != uint(Tag::acsp)) { + qCWarning(lcIcc, "Failed ICC signature test"); + return false; + } + if (header.profileSize < (sizeof(ICCProfileHeader) + header.tagCount * sizeof(TagTableEntry))) { + qCWarning(lcIcc, "Failed basic size sanity"); + return false; + } + + if (header.profileClass != uint(ProfileClass::Input) + && header.profileClass != uint(ProfileClass::Display)) { + qCWarning(lcIcc, "Unsupported ICC profile class %x", quint32(header.profileClass)); + return false; + } + if (header.inputColorSpace != 0x52474220 /* 'RGB '*/) { + qCWarning(lcIcc, "Unsupported ICC input color space %x", quint32(header.inputColorSpace)); + return false; + } + if (header.pcs != 0x58595a20 /* 'XYZ '*/) { + // ### support PCSLAB + qCWarning(lcIcc, "Unsupported ICC profile connection space %x", quint32(header.pcs)); + return false; + } + + QColorVector illuminant; + illuminant.x = fromFixedS1516(header.illuminantXyz[0]); + illuminant.y = fromFixedS1516(header.illuminantXyz[1]); + illuminant.z = fromFixedS1516(header.illuminantXyz[2]); + if (illuminant != QColorVector::D50()) { + qCWarning(lcIcc, "Invalid ICC illuminant"); + return false; + } + + return true; +} + +static int writeColorTrc(QDataStream &stream, const QColorTrc &trc) +{ + if (trc.isLinear()) { + stream << uint(Tag::curv) << uint(0); + stream << uint(0); + return 12; + } + + if (trc.m_type == QColorTrc::Type::Function) { + const QColorTransferFunction &fun = trc.m_fun; + stream << uint(Tag::para) << uint(0); + if (fun.isGamma()) { + stream << ushort(0) << ushort(0); + stream << toFixedS1516(fun.m_g); + return 12 + 4; + } + bool type3 = qFuzzyIsNull(fun.m_e) && qFuzzyIsNull(fun.m_f); + stream << ushort(type3 ? 3 : 4) << ushort(0); + stream << toFixedS1516(fun.m_g); + stream << toFixedS1516(fun.m_a); + stream << toFixedS1516(fun.m_b); + stream << toFixedS1516(fun.m_c); + stream << toFixedS1516(fun.m_d); + if (type3) + return 12 + 5 * 4; + stream << toFixedS1516(fun.m_e); + stream << toFixedS1516(fun.m_f); + return 12 + 7 * 4; + } + + Q_ASSERT(trc.m_type == QColorTrc::Type::Table); + stream << uint(Tag::curv) << uint(0); + stream << uint(trc.m_table.m_tableSize); + if (!trc.m_table.m_table16.isEmpty()) { + for (uint i = 0; i < trc.m_table.m_tableSize; ++i) { + stream << ushort(trc.m_table.m_table16[i]); + } + } else { + for (uint i = 0; i < trc.m_table.m_tableSize; ++i) { + stream << ushort(trc.m_table.m_table8[i] * 257U); + } + } + return 12 + 2 * trc.m_table.m_tableSize; +} + +QByteArray toIccProfile(const QColorSpace &space) +{ + if (!space.isValid()) + return QByteArray(); + + const QColorSpacePrivate *spaceDPtr = space.d_func(); + + constexpr int tagCount = 9; + constexpr uint profileDataOffset = 128 + 4 + 12 * tagCount; + constexpr uint variableTagTableOffsets = 128 + 4 + 12 * 5; + uint currentOffset = 0; + uint rTrcOffset, gTrcOffset, bTrcOffset; + uint rTrcSize, gTrcSize, bTrcSize; + uint descOffset, descSize; + + QBuffer buffer; + buffer.open(QIODevice::WriteOnly); + QDataStream stream(&buffer); + + // Profile header: + stream << uint(0); // Size, we will update this later + stream << uint(0); + stream << uint(0x02400000); // Version 2.4 (note we use 'para' from version 4) + stream << uint(ProfileClass::Display); + stream << uint(Tag::RGB_); + stream << uint(Tag::XYZ_); + stream << uint(0) << uint(0) << uint(0); + stream << uint(Tag::acsp); + stream << uint(0) << uint(0) << uint(0); + stream << uint(0) << uint(0) << uint(0); + stream << uint(1); // Rendering intent + stream << uint(0x0000f6d6); // D50 X + stream << uint(0x00010000); // D50 Y + stream << uint(0x0000d32d); // D50 Z + stream << IccTag('Q','t', QT_VERSION_MAJOR, QT_VERSION_MINOR); + stream << uint(0) << uint(0) << uint(0) << uint(0); + stream << uint(0) << uint(0) << uint(0) << uint(0) << uint(0) << uint(0) << uint(0); + + // Tag table: + stream << uint(tagCount); + stream << uint(Tag::rXYZ) << uint(profileDataOffset + 00) << uint(20); + stream << uint(Tag::gXYZ) << uint(profileDataOffset + 20) << uint(20); + stream << uint(Tag::bXYZ) << uint(profileDataOffset + 40) << uint(20); + stream << uint(Tag::wtpt) << uint(profileDataOffset + 60) << uint(20); + stream << uint(Tag::cprt) << uint(profileDataOffset + 80) << uint(12); + // From here the offset and size will be updated later: + stream << uint(Tag::rTRC) << uint(0) << uint(0); + stream << uint(Tag::gTRC) << uint(0) << uint(0); + stream << uint(Tag::bTRC) << uint(0) << uint(0); + stream << uint(Tag::desc) << uint(0) << uint(0); + // TODO: consider adding 'chad' tag (required in ICC >=4 when we have non-D50 whitepoint) + currentOffset = profileDataOffset; + + // Tag data: + stream << uint(Tag::XYZ_) << uint(0); + stream << toFixedS1516(spaceDPtr->toXyz.r.x); + stream << toFixedS1516(spaceDPtr->toXyz.r.y); + stream << toFixedS1516(spaceDPtr->toXyz.r.z); + stream << uint(Tag::XYZ_) << uint(0); + stream << toFixedS1516(spaceDPtr->toXyz.g.x); + stream << toFixedS1516(spaceDPtr->toXyz.g.y); + stream << toFixedS1516(spaceDPtr->toXyz.g.z); + stream << uint(Tag::XYZ_) << uint(0); + stream << toFixedS1516(spaceDPtr->toXyz.b.x); + stream << toFixedS1516(spaceDPtr->toXyz.b.y); + stream << toFixedS1516(spaceDPtr->toXyz.b.z); + stream << uint(Tag::XYZ_) << uint(0); + stream << toFixedS1516(spaceDPtr->whitePoint.x); + stream << toFixedS1516(spaceDPtr->whitePoint.y); + stream << toFixedS1516(spaceDPtr->whitePoint.z); + stream << uint(Tag::text) << uint(0); + stream << uint(IccTag('N', '/', 'A', '\0')); + currentOffset += 92; + + // From now on the data is variable sized: + rTrcOffset = currentOffset; + rTrcSize = writeColorTrc(stream, spaceDPtr->trc[0]); + currentOffset += rTrcSize; + if (spaceDPtr->trc[0] == spaceDPtr->trc[1]) { + gTrcOffset = rTrcOffset; + gTrcSize = rTrcSize; + } else { + gTrcOffset = currentOffset; + gTrcSize = writeColorTrc(stream, spaceDPtr->trc[1]); + currentOffset += gTrcSize; + } + if (spaceDPtr->trc[0] == spaceDPtr->trc[2]) { + bTrcOffset = rTrcOffset; + bTrcSize = rTrcSize; + } else { + bTrcOffset = currentOffset; + bTrcSize = writeColorTrc(stream, spaceDPtr->trc[2]); + currentOffset += bTrcSize; + } + + descOffset = currentOffset; + QByteArray description = spaceDPtr->description.toUtf8(); + stream << uint(Tag::desc) << uint(0); + stream << uint(description.size() + 1); + stream.writeRawData(description.constData(), description.size() + 1); + stream << uint(0) << uint(0); + stream << ushort(0) << uchar(0); + QByteArray macdesc(67, '\0'); + stream.writeRawData(macdesc.constData(), 67); + descSize = 90 + description.size() + 1; + currentOffset += descSize; + + buffer.close(); + QByteArray iccProfile = buffer.buffer(); + // Now write final size + *(quint32_be *)iccProfile.data() = iccProfile.size(); + // And the final indices and sizes of variable size tags: + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 4) = rTrcOffset; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 8) = rTrcSize; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 12 + 4) = gTrcOffset; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 12 + 8) = gTrcSize; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 2 * 12 + 4) = bTrcOffset; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 2 * 12 + 8) = bTrcSize; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 3 * 12 + 4) = descOffset; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 3 * 12 + 8) = descSize; + +#if !defined(QT_NO_DEBUG) || defined(QT_FORCE_ASSERTS) + const ICCProfileHeader *iccHeader = (const ICCProfileHeader *)iccProfile.constData(); + Q_ASSERT(qsizetype(iccHeader->profileSize) == qsizetype(iccProfile.size())); + Q_ASSERT(isValidIccProfile(*iccHeader)); +#endif + + return iccProfile; +} + +bool parseTRC(const GenericTagData *trcData, QColorTrc &gamma) +{ + if (trcData->type == quint32(Tag::curv)) { + const CurvTagData *curv = reinterpret_cast<const CurvTagData *>(trcData); + qCDebug(lcIcc) << "curv" << uint(curv->valueCount); + if (curv->valueCount == 0) { + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction(); // Linear + } else if (curv->valueCount == 1) { + float g = curv->value[0] * (1.0f / 256.0f); + qCDebug(lcIcc) << g; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction::fromGamma(g); + } else { + QVector<quint16> tabl; + tabl.resize(curv->valueCount); + for (uint i = 0; i < curv->valueCount; ++i) + tabl[i] = curv->value[i]; + QColorTransferTable table = QColorTransferTable(curv->valueCount, std::move(tabl)); + QColorTransferFunction curve; + if (!table.asColorTransferFunction(&curve)) { + gamma.m_type = QColorTrc::Type::Table; + gamma.m_table = table; + } else { + qCDebug(lcIcc) << "Detected curv table as function"; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = curve; + } + } + return true; + } + if (trcData->type == quint32(Tag::para)) { + const ParaTagData *para = reinterpret_cast<const ParaTagData *>(trcData); + qCDebug(lcIcc) << "para" << uint(para->curveType); + switch (para->curveType) { + case 0: { + float g = fromFixedS1516(para->parameter[0]); + qCDebug(lcIcc) << g; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction::fromGamma(g); + break; + } + case 1: { + float g = fromFixedS1516(para->parameter[0]); + float a = fromFixedS1516(para->parameter[1]); + float b = fromFixedS1516(para->parameter[2]); + float d = -b / a; + qCDebug(lcIcc) << g << a << b; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction(a, b, 0.0f, d, 0.0f, 0.0f, g); + break; + } + case 2: { + float g = fromFixedS1516(para->parameter[0]); + float a = fromFixedS1516(para->parameter[1]); + float b = fromFixedS1516(para->parameter[2]); + float c = fromFixedS1516(para->parameter[3]); + float d = -b / a; + qCDebug(lcIcc) << g << a << b << c; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction(a, b, 0.0f, d, c, c, g); + break; + } + case 3: { + float g = fromFixedS1516(para->parameter[0]); + float a = fromFixedS1516(para->parameter[1]); + float b = fromFixedS1516(para->parameter[2]); + float c = fromFixedS1516(para->parameter[3]); + float d = fromFixedS1516(para->parameter[4]); + qCDebug(lcIcc) << g << a << b << c << d; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction(a, b, c, d, 0.0f, 0.0f, g); + break; + } + case 4: { + float g = fromFixedS1516(para->parameter[0]); + float a = fromFixedS1516(para->parameter[1]); + float b = fromFixedS1516(para->parameter[2]); + float c = fromFixedS1516(para->parameter[3]); + float d = fromFixedS1516(para->parameter[4]); + float e = fromFixedS1516(para->parameter[5]); + float f = fromFixedS1516(para->parameter[6]); + qCDebug(lcIcc) << g << a << b << c << d << e << f; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction(a, b, c, d, e, f, g); + break; + } + default: + qCWarning(lcIcc) << "Unknown para type" << uint(para->curveType); + return false; + } + return true; + } + qCWarning(lcIcc) << "Invalid TRC data type"; + return false; +} + +bool fromIccProfile(const QByteArray &data, QColorSpace *colorSpace) +{ + if (data.size() < qsizetype(sizeof(ICCProfileHeader))) { + qCWarning(lcIcc) << "fromIccProfile: failed size sanity 1"; + return false; + } + const ICCProfileHeader *header = (const ICCProfileHeader *)data.constData(); + if (!isValidIccProfile(*header)) { + qCWarning(lcIcc) << "fromIccProfile: failed general sanity check"; + return false; + } + if (qsizetype(header->profileSize) > data.size()) { + qCWarning(lcIcc) << "fromIccProfile: failed size sanity 2"; + return false; + } + + // Read tag index + const TagTableEntry *tagTable = (const TagTableEntry *)(data.constData() + sizeof(ICCProfileHeader)); + const qsizetype offsetToData = sizeof(ICCProfileHeader) + header->tagCount * sizeof(TagTableEntry); + + QHash<Tag, quint32> tagIndex; + for (uint i = 0; i < header->tagCount; ++i) { + // Sanity check tag sizes and offsets: + if (qsizetype(tagTable[i].offset) < offsetToData) { + qCWarning(lcIcc) << "fromIccProfile: failed tag offset sanity 1"; + return false; + } + // Checked separately from (+ size) to handle overflow. + if (tagTable[i].offset > header->profileSize) { + qCWarning(lcIcc) << "fromIccProfile: failed tag offset sanity 2"; + return false; + } + if ((tagTable[i].offset + tagTable[i].size) > header->profileSize) { + qCWarning(lcIcc) << "fromIccProfile: failed tag offset + size sanity"; + return false; + } +// printf("'%4s' %d %d\n", (const char *)&tagTable[i].signature, +// quint32(tagTable[i].offset), +// quint32(tagTable[i].size)); + tagIndex.insert(Tag(quint32(tagTable[i].signature)), tagTable[i].offset); + } + // Check the profile is three-component matrix based (what we currently support): + if (!tagIndex.contains(Tag::rXYZ) || !tagIndex.contains(Tag::gXYZ) || !tagIndex.contains(Tag::bXYZ) || + !tagIndex.contains(Tag::rTRC) || !tagIndex.contains(Tag::gTRC) || !tagIndex.contains(Tag::bTRC) || + !tagIndex.contains(Tag::wtpt)) { + qCWarning(lcIcc) << "fromIccProfile: Unsupported ICC profile - not three component matrix based"; + return false; + } + + // Parse XYZ tags + const XYZTagData *rXyz = (const XYZTagData *)(data.constData() + tagIndex[Tag::rXYZ]); + const XYZTagData *gXyz = (const XYZTagData *)(data.constData() + tagIndex[Tag::gXYZ]); + const XYZTagData *bXyz = (const XYZTagData *)(data.constData() + tagIndex[Tag::bXYZ]); + const XYZTagData *wXyz = (const XYZTagData *)(data.constData() + tagIndex[Tag::wtpt]); + if (rXyz->type != quint32(Tag::XYZ_) || gXyz->type != quint32(Tag::XYZ_) || + wXyz->type != quint32(Tag::XYZ_) || wXyz->type != quint32(Tag::XYZ_)) { + qCWarning(lcIcc) << "fromIccProfile: Bad XYZ data type"; + return false; + } + QColorSpacePrivate *colorspaceDPtr = colorSpace->d_func(); + + colorspaceDPtr->toXyz.r = fromXyzData(rXyz); + colorspaceDPtr->toXyz.g = fromXyzData(gXyz); + colorspaceDPtr->toXyz.b = fromXyzData(bXyz); + QColorVector whitePoint = fromXyzData(wXyz); + colorspaceDPtr->whitePoint = whitePoint; + + colorspaceDPtr->gamut = QColorSpace::Gamut::Custom; + if (colorspaceDPtr->toXyz == QColorMatrix::toXyzFromSRgb()) { + qCDebug(lcIcc) << "fromIccProfile: sRGB gamut detected"; + colorspaceDPtr->gamut = QColorSpace::Gamut::SRgb; + } else if (colorspaceDPtr->toXyz == QColorMatrix::toXyzFromAdobeRgb()) { + qCDebug(lcIcc) << "fromIccProfile: Adobe RGB gamut detected"; + colorspaceDPtr->gamut = QColorSpace::Gamut::AdobeRgb; + } else if (colorspaceDPtr->toXyz == QColorMatrix::toXyzFromDciP3D65()) { + qCDebug(lcIcc) << "fromIccProfile: DCI-P3 D65 gamut detected"; + colorspaceDPtr->gamut = QColorSpace::Gamut::DciP3D65; + } else if (colorspaceDPtr->toXyz == QColorMatrix::toXyzFromBt2020()) { + qCDebug(lcIcc) << "fromIccProfile: BT.2020 gamut detected"; + colorspaceDPtr->gamut = QColorSpace::Gamut::Bt2020; + } + if (colorspaceDPtr->toXyz == QColorMatrix::toXyzFromProPhotoRgb()) { + qCDebug(lcIcc) << "fromIccProfile: ProPhoto RGB gamut detected"; + colorspaceDPtr->gamut = QColorSpace::Gamut::ProPhotoRgb; + } + // Reset the matrix to our canonical values: + if (colorspaceDPtr->gamut != QColorSpace::Gamut::Custom) + colorspaceDPtr->setToXyzMatrix(); + + // Parse TRC tags + const GenericTagData *rTrc; + const GenericTagData *gTrc; + const GenericTagData *bTrc; + if (tagIndex.contains(Tag::aarg) && tagIndex.contains(Tag::aagg) && tagIndex.contains(Tag::aabg)) { + // Apple extension for parametric version of TRCs in ICCv2: + rTrc = (const GenericTagData *)(data.constData() + tagIndex[Tag::aarg]); + gTrc = (const GenericTagData *)(data.constData() + tagIndex[Tag::aagg]); + bTrc = (const GenericTagData *)(data.constData() + tagIndex[Tag::aabg]); + } else { + rTrc = (const GenericTagData *)(data.constData() + tagIndex[Tag::rTRC]); + gTrc = (const GenericTagData *)(data.constData() + tagIndex[Tag::gTRC]); + bTrc = (const GenericTagData *)(data.constData() + tagIndex[Tag::bTRC]); + } + + QColorTrc rCurve; + QColorTrc gCurve; + QColorTrc bCurve; + if (!parseTRC(rTrc, rCurve)) + return false; + if (!parseTRC(gTrc, gCurve)) + return false; + if (!parseTRC(bTrc, bCurve)) + return false; + if (rCurve == gCurve && gCurve == bCurve && rCurve.m_type == QColorTrc::Type::Function) { + if (rCurve.m_fun.isLinear()) { + qCDebug(lcIcc) << "fromIccProfile: Linear gamma detected"; + colorspaceDPtr->trc[0] = QColorTransferFunction(); + colorspaceDPtr->transferFunction = QColorSpace::TransferFunction::Linear; + colorspaceDPtr->gamma = 1.0f; + } else if (rCurve.m_fun.isGamma()) { + qCDebug(lcIcc) << "fromIccProfile: Simple gamma detected"; + colorspaceDPtr->trc[0] = QColorTransferFunction::fromGamma(rCurve.m_fun.m_g); + colorspaceDPtr->transferFunction = QColorSpace::TransferFunction::Gamma; + colorspaceDPtr->gamma = rCurve.m_fun.m_g; + } else if (rCurve.m_fun.isSRgb()) { + qCDebug(lcIcc) << "fromIccProfile: sRGB gamma detected"; + colorspaceDPtr->trc[0] = QColorTransferFunction::fromSRgb(); + colorspaceDPtr->transferFunction = QColorSpace::TransferFunction::SRgb; + } else { + colorspaceDPtr->trc[0] = rCurve; + colorspaceDPtr->transferFunction = QColorSpace::TransferFunction::Custom; + } + + colorspaceDPtr->trc[1] = colorspaceDPtr->trc[0]; + colorspaceDPtr->trc[2] = colorspaceDPtr->trc[0]; + } else { + colorspaceDPtr->trc[0] = rCurve; + colorspaceDPtr->trc[1] = gCurve; + colorspaceDPtr->trc[2] = bCurve; + colorspaceDPtr->transferFunction = QColorSpace::TransferFunction::Custom; + } + + // FIXME: try to parse the description.. + + if (!colorspaceDPtr->identifyColorSpace()) + colorspaceDPtr->id = QColorSpace::Unknown; + else + qCDebug(lcIcc) << "fromIccProfile: Named colorspace detected: " << colorSpace->colorSpaceId(); + + colorspaceDPtr->iccProfile = data; + + return true; +} + +} // namespace QIcc + +QT_END_NAMESPACE diff --git a/src/gui/painting/qicc_p.h b/src/gui/painting/qicc_p.h new file mode 100644 index 0000000000..c3220391f4 --- /dev/null +++ b/src/gui/painting/qicc_p.h @@ -0,0 +1,70 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QICC_P_H +#define QICC_P_H + +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// + +#include <QtCore/qbytearray.h> +#include <QtGui/qtguiglobal.h> + +QT_BEGIN_NAMESPACE + +class QColorSpace; + +namespace QIcc { + +Q_GUI_EXPORT bool fromIccProfile(const QByteArray &data, QColorSpace *colorSpace); +Q_GUI_EXPORT QByteArray toIccProfile(const QColorSpace &space); + +} + +QT_END_NAMESPACE + +#endif // QICC_P_H diff --git a/src/gui/painting/qimagescale.cpp b/src/gui/painting/qimagescale.cpp index 96da5e029c..0d7205b483 100644 --- a/src/gui/painting/qimagescale.cpp +++ b/src/gui/painting/qimagescale.cpp @@ -239,7 +239,6 @@ static QImageScaleInfo* QImageScale::qimageCalcScaleInfo(const QImage &img, isi = new QImageScaleInfo; if (!isi) return 0; - memset(isi, 0, sizeof(QImageScaleInfo)); isi->xup_yup = (qAbs(dw) >= sw) + ((qAbs(dh) >= sh) << 1); @@ -529,6 +528,7 @@ static void qt_qimageScaleAARGBA_down_xy(QImageScaleInfo *isi, unsigned int *des } } +#if QT_CONFIG(raster_64bit) static void qt_qimageScaleRgba64_up_x_down_y(QImageScaleInfo *isi, QRgba64 *dest, int dw, int dh, int dow, int sow); @@ -729,6 +729,7 @@ static void qt_qimageScaleRgba64_down_xy(QImageScaleInfo *isi, QRgba64 *dest, } } } +#endif static void qt_qimageScaleAARGB_up_x_down_y(QImageScaleInfo *isi, unsigned int *dest, int dw, int dh, int dow, int sow); @@ -946,10 +947,13 @@ QImage qSmoothScaleImage(const QImage &src, int dw, int dh) return QImage(); } +#if QT_CONFIG(raster_64bit) if (src.depth() > 32) qt_qimageScaleRgba64(scaleinfo, (QRgba64 *)buffer.scanLine(0), dw, dh, dw, src.bytesPerLine() / 8); - else if (src.hasAlphaChannel()) + else +#endif + if (src.hasAlphaChannel()) qt_qimageScaleAARGBA(scaleinfo, (unsigned int *)buffer.scanLine(0), dw, dh, dw, src.bytesPerLine() / 4); else diff --git a/src/gui/painting/qimagescale_p.h b/src/gui/painting/qimagescale_p.h index 415623a575..244d681718 100644 --- a/src/gui/painting/qimagescale_p.h +++ b/src/gui/painting/qimagescale_p.h @@ -61,10 +61,11 @@ QImage qSmoothScaleImage(const QImage &img, int w, int h); namespace QImageScale { struct QImageScaleInfo { - int *xpoints; - const unsigned int **ypoints; - int *xapoints, *yapoints; - int xup_yup; + int *xpoints{nullptr}; + const unsigned int **ypoints{nullptr}; + int *xapoints{nullptr}; + int *yapoints{nullptr}; + int xup_yup{0}; }; } diff --git a/src/gui/painting/qimagescale_sse4.cpp b/src/gui/painting/qimagescale_sse4.cpp index 34d6b3882e..5861a2e2ff 100644 --- a/src/gui/painting/qimagescale_sse4.cpp +++ b/src/gui/painting/qimagescale_sse4.cpp @@ -39,6 +39,7 @@ #include "qimagescale_p.h" #include "qimage.h" +#include <private/qdrawhelper_x86_p.h> #include <private/qsimd_p.h> #if defined(QT_COMPILER_SUPPORTS_SSE4_1) @@ -47,7 +48,8 @@ QT_BEGIN_NAMESPACE using namespace QImageScale; -inline static __m128i qt_qimageScaleAARGBA_helper(const unsigned int *pix, int xyap, int Cxy, int step, const __m128i vxyap, const __m128i vCxy) +inline static __m128i Q_DECL_VECTORCALL +qt_qimageScaleAARGBA_helper(const unsigned int *pix, int xyap, int Cxy, int step, const __m128i vxyap, const __m128i vCxy) { __m128i vpix = _mm_cvtepu8_epi32(_mm_cvtsi32_si128(*pix)); __m128i vx = _mm_mullo_epi32(vpix, vxyap); diff --git a/src/gui/painting/qmatrix.cpp b/src/gui/painting/qmatrix.cpp index 24b33243da..b1f01332b6 100644 --- a/src/gui/painting/qmatrix.cpp +++ b/src/gui/painting/qmatrix.cpp @@ -248,7 +248,7 @@ QMatrix::QMatrix(qreal m11, qreal m12, qreal m21, qreal m22, qreal dx, qreal dy) /*! Constructs a matrix that is a copy of the given \a matrix. */ -QMatrix::QMatrix(const QMatrix &matrix) Q_DECL_NOTHROW +QMatrix::QMatrix(const QMatrix &matrix) noexcept : _m11(matrix._m11) , _m12(matrix._m12) , _m21(matrix._m21) @@ -989,7 +989,7 @@ bool QMatrix::operator==(const QMatrix &m) const Returns the hash value for \a key, using \a seed to seed the calculation. */ -uint qHash(const QMatrix &key, uint seed) Q_DECL_NOTHROW +uint qHash(const QMatrix &key, uint seed) noexcept { QtPrivate::QHashCombine hash; seed = hash(seed, key.m11()); @@ -1068,7 +1068,7 @@ QMatrix QMatrix::operator *(const QMatrix &m) const /*! Assigns the given \a matrix's values to this matrix. */ -QMatrix &QMatrix::operator=(const QMatrix &matrix) Q_DECL_NOTHROW +QMatrix &QMatrix::operator=(const QMatrix &matrix) noexcept { _m11 = matrix._m11; _m12 = matrix._m12; diff --git a/src/gui/painting/qmatrix.h b/src/gui/painting/qmatrix.h index d8a4fcfb1c..a167260ade 100644 --- a/src/gui/painting/qmatrix.h +++ b/src/gui/painting/qmatrix.h @@ -64,12 +64,12 @@ public: #if QT_VERSION < QT_VERSION_CHECK(6, 0, 0) // ### Qt 6: remove; the compiler-generated ones are fine! - QMatrix &operator=(QMatrix &&other) Q_DECL_NOTHROW // = default + QMatrix &operator=(QMatrix &&other) noexcept // = default { memcpy(static_cast<void *>(this), static_cast<void *>(&other), sizeof(QMatrix)); return *this; } - QMatrix &operator=(const QMatrix &) Q_DECL_NOTHROW; // = default - QMatrix(QMatrix &&other) Q_DECL_NOTHROW // = default + QMatrix &operator=(const QMatrix &) noexcept; // = default + QMatrix(QMatrix &&other) noexcept // = default { memcpy(static_cast<void *>(this), static_cast<void *>(&other), sizeof(QMatrix)); } - QMatrix(const QMatrix &other) Q_DECL_NOTHROW; // = default + QMatrix(const QMatrix &other) noexcept; // = default #endif void setMatrix(qreal m11, qreal m12, qreal m21, qreal m22, @@ -140,7 +140,7 @@ private: }; Q_DECLARE_TYPEINFO(QMatrix, Q_MOVABLE_TYPE); -Q_GUI_EXPORT Q_DECL_CONST_FUNCTION uint qHash(const QMatrix &key, uint seed = 0) Q_DECL_NOTHROW; +Q_GUI_EXPORT Q_DECL_CONST_FUNCTION uint qHash(const QMatrix &key, uint seed = 0) noexcept; // mathematical semantics inline QPoint operator*(const QPoint &p, const QMatrix &m) diff --git a/src/gui/painting/qmemrotate.cpp b/src/gui/painting/qmemrotate.cpp index 43aeff3268..9cb787fb2c 100644 --- a/src/gui/painting/qmemrotate.cpp +++ b/src/gui/painting/qmemrotate.cpp @@ -44,7 +44,7 @@ QT_BEGIN_NAMESPACE static const int tileSize = 32; template <class T> -Q_STATIC_TEMPLATE_FUNCTION +static inline void qt_memrotate90_tiled(const T *src, int w, int h, int sstride, T *dest, int dstride) { sstride /= sizeof(T); @@ -103,7 +103,7 @@ inline void qt_memrotate90_tiled(const T *src, int w, int h, int sstride, T *des } template <class T> -Q_STATIC_TEMPLATE_FUNCTION +static inline void qt_memrotate90_tiled_unpacked(const T *src, int w, int h, int sstride, T *dest, int dstride) { @@ -131,7 +131,7 @@ inline void qt_memrotate90_tiled_unpacked(const T *src, int w, int h, int sstrid } template <class T> -Q_STATIC_TEMPLATE_FUNCTION +static inline void qt_memrotate270_tiled(const T *src, int w, int h, int sstride, T *dest, int dstride) { sstride /= sizeof(T); @@ -190,7 +190,7 @@ inline void qt_memrotate270_tiled(const T *src, int w, int h, int sstride, T *de } template <class T> -Q_STATIC_TEMPLATE_FUNCTION +static inline void qt_memrotate270_tiled_unpacked(const T *src, int w, int h, int sstride, T *dest, int dstride) { @@ -219,7 +219,7 @@ inline void qt_memrotate270_tiled_unpacked(const T *src, int w, int h, int sstri template <class T> -Q_STATIC_TEMPLATE_FUNCTION +static inline void qt_memrotate90_template(const T *src, int srcWidth, int srcHeight, int srcStride, T *dest, int dstStride) { @@ -246,7 +246,7 @@ inline void qt_memrotate90_template<quint64>(const quint64 *src, int w, int h, i } template <class T> -Q_STATIC_TEMPLATE_FUNCTION +static inline void qt_memrotate180_template(const T *src, int w, int h, int sstride, T *dest, int dstride) { const char *s = (const char*)(src) + (h - 1) * sstride; @@ -261,7 +261,7 @@ inline void qt_memrotate180_template(const T *src, int w, int h, int sstride, T } template <class T> -Q_STATIC_TEMPLATE_FUNCTION +static inline void qt_memrotate270_template(const T *src, int srcWidth, int srcHeight, int srcStride, T *dest, int dstStride) { diff --git a/src/gui/painting/qoutlinemapper.cpp b/src/gui/painting/qoutlinemapper.cpp index b2d02182c3..2074f98069 100644 --- a/src/gui/painting/qoutlinemapper.cpp +++ b/src/gui/painting/qoutlinemapper.cpp @@ -42,6 +42,7 @@ #include "qbezier_p.h" #include "qmath.h" #include "qpainterpath_p.h" +#include "qscopedvaluerollback.h" #include <stdlib.h> @@ -354,7 +355,7 @@ void QOutlineMapper::clipElements(const QPointF *elements, // instead of going through convenience functionallity, but since // this part of code hardly every used, it shouldn't matter. - m_in_clip_elements = true; + QScopedValueRollback<bool> in_clip_elements(m_in_clip_elements, true); QPainterPath path; @@ -397,8 +398,6 @@ void QOutlineMapper::clipElements(const QPointF *elements, convertPath(clippedPath); m_transform = oldTransform; } - - m_in_clip_elements = false; } QT_END_NAMESPACE diff --git a/src/gui/painting/qoutlinemapper_p.h b/src/gui/painting/qoutlinemapper_p.h index 71999fbdee..04a68797c2 100644 --- a/src/gui/painting/qoutlinemapper_p.h +++ b/src/gui/painting/qoutlinemapper_p.h @@ -180,13 +180,13 @@ public: QT_FT_Outline *outline() { if (m_valid) return &m_outline; - return 0; + return nullptr; } QT_FT_Outline *convertPath(const QPainterPath &path); QT_FT_Outline *convertPath(const QVectorPath &path); - inline QPainterPath::ElementType *elementTypes() const { return m_element_types.size() == 0 ? 0 : m_element_types.data(); } + inline QPainterPath::ElementType *elementTypes() const { return m_element_types.size() == 0 ? nullptr : m_element_types.data(); } public: QDataBuffer<QPainterPath::ElementType> m_element_types; diff --git a/src/gui/painting/qpagedpaintdevice.cpp b/src/gui/painting/qpagedpaintdevice.cpp index 613a686848..72b2834470 100644 --- a/src/gui/painting/qpagedpaintdevice.cpp +++ b/src/gui/painting/qpagedpaintdevice.cpp @@ -290,7 +290,8 @@ QPagedPaintDevicePrivate *QPagedPaintDevice::dd() \value PdfVersion_A1b A PDF/A-1b compatible document is produced. - \since 5.10 + \value PdfVersion_1_6 A PDF 1.6 compatible document is produced. + This value was added in Qt 5.12. */ /*! diff --git a/src/gui/painting/qpagedpaintdevice.h b/src/gui/painting/qpagedpaintdevice.h index c8957edab8..1c37c17fa3 100644 --- a/src/gui/painting/qpagedpaintdevice.h +++ b/src/gui/painting/qpagedpaintdevice.h @@ -213,7 +213,7 @@ public: Envelope10 = Comm10E }; - enum PdfVersion { PdfVersion_1_4, PdfVersion_A1b }; + enum PdfVersion { PdfVersion_1_4, PdfVersion_A1b, PdfVersion_1_6 }; // ### Qt6 Make these virtual bool setPageLayout(const QPageLayout &pageLayout); diff --git a/src/gui/painting/qpagelayout.h b/src/gui/painting/qpagelayout.h index b41689d33b..faf0827c1a 100644 --- a/src/gui/painting/qpagelayout.h +++ b/src/gui/painting/qpagelayout.h @@ -83,12 +83,12 @@ public: const QMarginsF &minMargins = QMarginsF(0, 0, 0, 0)); QPageLayout(const QPageLayout &other); #ifdef Q_COMPILER_RVALUE_REFS - QPageLayout &operator=(QPageLayout &&other) Q_DECL_NOTHROW { swap(other); return *this; } + QPageLayout &operator=(QPageLayout &&other) noexcept { swap(other); return *this; } #endif QPageLayout &operator=(const QPageLayout &other); ~QPageLayout(); - void swap(QPageLayout &other) Q_DECL_NOTHROW { qSwap(d, other.d); } + void swap(QPageLayout &other) noexcept { qSwap(d, other.d); } friend Q_GUI_EXPORT bool operator==(const QPageLayout &lhs, const QPageLayout &rhs); bool isEquivalentTo(const QPageLayout &other) const; diff --git a/src/gui/painting/qpagesize.h b/src/gui/painting/qpagesize.h index 82054824b4..a2ea691677 100644 --- a/src/gui/painting/qpagesize.h +++ b/src/gui/painting/qpagesize.h @@ -237,13 +237,13 @@ public: SizeMatchPolicy matchPolicy = FuzzyMatch); QPageSize(const QPageSize &other); #ifdef Q_COMPILER_RVALUE_REFS - QPageSize &operator=(QPageSize &&other) Q_DECL_NOTHROW { swap(other); return *this; } + QPageSize &operator=(QPageSize &&other) noexcept { swap(other); return *this; } #endif QPageSize &operator=(const QPageSize &other); ~QPageSize(); - void swap(QPageSize &other) Q_DECL_NOTHROW { qSwap(d, other.d); } + void swap(QPageSize &other) noexcept { qSwap(d, other.d); } friend Q_GUI_EXPORT bool operator==(const QPageSize &lhs, const QPageSize &rhs); bool isEquivalentTo(const QPageSize &other) const; diff --git a/src/gui/painting/qpaintdevice.cpp b/src/gui/painting/qpaintdevice.cpp index faaa316085..0ddfba6ee9 100644 --- a/src/gui/painting/qpaintdevice.cpp +++ b/src/gui/painting/qpaintdevice.cpp @@ -41,7 +41,7 @@ QT_BEGIN_NAMESPACE -QPaintDevice::QPaintDevice() Q_DECL_NOEXCEPT +QPaintDevice::QPaintDevice() noexcept { reserved = 0; painters = 0; diff --git a/src/gui/painting/qpaintdevice.h b/src/gui/painting/qpaintdevice.h index 9458b4ba9a..5f8dad205d 100644 --- a/src/gui/painting/qpaintdevice.h +++ b/src/gui/painting/qpaintdevice.h @@ -90,7 +90,7 @@ public: static inline qreal devicePixelRatioFScale() { return 0x10000; } protected: - QPaintDevice() Q_DECL_NOEXCEPT; + QPaintDevice() noexcept; virtual int metric(PaintDeviceMetric metric) const; virtual void initPainter(QPainter *painter) const; virtual QPaintDevice *redirected(QPoint *offset) const; diff --git a/src/gui/painting/qpaintengine.cpp b/src/gui/painting/qpaintengine.cpp index 1aee7d5f74..bfe1c9cadf 100644 --- a/src/gui/painting/qpaintengine.cpp +++ b/src/gui/painting/qpaintengine.cpp @@ -913,7 +913,7 @@ void QPaintEngine::setPaintDevice(QPaintDevice *device) /*! Returns the device that this engine is painting on, if painting is - active; otherwise returns 0. + active; otherwise returns \nullptr. */ QPaintDevice *QPaintEngine::paintDevice() const { diff --git a/src/gui/painting/qpaintengine_p.h b/src/gui/painting/qpaintengine_p.h index 8ac3fcff5c..40b9474165 100644 --- a/src/gui/painting/qpaintengine_p.h +++ b/src/gui/painting/qpaintengine_p.h @@ -65,7 +65,7 @@ class Q_GUI_EXPORT QPaintEnginePrivate { Q_DECLARE_PUBLIC(QPaintEngine) public: - QPaintEnginePrivate() : pdev(0), q_ptr(0), currentClipDevice(0), hasSystemTransform(0), + QPaintEnginePrivate() : pdev(nullptr), q_ptr(nullptr), currentClipDevice(nullptr), hasSystemTransform(0), hasSystemViewport(0) {} virtual ~QPaintEnginePrivate(); @@ -138,8 +138,8 @@ public: static QPaintEnginePrivate *get(QPaintEngine *paintEngine) { return paintEngine->d_func(); } - virtual QPaintEngine *aggregateEngine() { return 0; } - virtual Qt::HANDLE nativeHandle() { return 0; } + virtual QPaintEngine *aggregateEngine() { return nullptr; } + virtual Qt::HANDLE nativeHandle() { return nullptr; } }; QT_END_NAMESPACE diff --git a/src/gui/painting/qpaintengine_raster.cpp b/src/gui/painting/qpaintengine_raster.cpp index 7caaf3a8fa..b0dec5cf78 100644 --- a/src/gui/painting/qpaintengine_raster.cpp +++ b/src/gui/painting/qpaintengine_raster.cpp @@ -555,35 +555,6 @@ bool QRasterPaintEngine::end() /*! \internal */ -void QRasterPaintEngine::releaseBuffer() -{ - Q_D(QRasterPaintEngine); - d->rasterBuffer.reset(new QRasterBuffer); -} - -/*! - \internal -*/ -QSize QRasterPaintEngine::size() const -{ - Q_D(const QRasterPaintEngine); - return QSize(d->rasterBuffer->width(), d->rasterBuffer->height()); -} - -/*! - \internal -*/ -#ifndef QT_NO_DEBUG -void QRasterPaintEngine::saveBuffer(const QString &s) const -{ - Q_D(const QRasterPaintEngine); - d->rasterBuffer->bufferImage().save(s, "PNG"); -} -#endif - -/*! - \internal -*/ void QRasterPaintEngine::updateMatrix(const QTransform &matrix) { QRasterPaintEngineState *s = state(); @@ -873,7 +844,7 @@ void QRasterPaintEngine::updateRasterState() && s->intOpacity == 256 && (mode == QPainter::CompositionMode_Source || (mode == QPainter::CompositionMode_SourceOver - && s->penData.solid.color.isOpaque())); + && s->penData.solidColor.isOpaque())); } s->dirty = 0; @@ -997,6 +968,10 @@ void QRasterPaintEnginePrivate::drawImage(const QPointF &pt, { if (alpha == 0 || !clip.isValid()) return; + if (pt.x() > qreal(clip.right()) || pt.y() > qreal(clip.bottom())) + return; + if ((pt.x() + img.width()) < qreal(clip.left()) || (pt.y() + img.height()) < qreal(clip.top())) + return; Q_ASSERT(img.depth() >= 8); @@ -1063,6 +1038,10 @@ void QRasterPaintEnginePrivate::blitImage(const QPointF &pt, { if (!clip.isValid()) return; + if (pt.x() > qreal(clip.right()) || pt.y() > qreal(clip.bottom())) + return; + if ((pt.x() + img.width()) < qreal(clip.left()) || (pt.y() + img.height()) < qreal(clip.top())) + return; Q_ASSERT(img.depth() >= 8); @@ -1528,9 +1507,9 @@ static void fillRect_normalized(const QRect &r, QSpanData *data, if (data->fillRect && (mode == QPainter::CompositionMode_Source || (mode == QPainter::CompositionMode_SourceOver - && data->solid.color.isOpaque()))) + && data->solidColor.isOpaque()))) { - data->fillRect(data->rasterBuffer, x1, y1, width, height, data->solid.color); + data->fillRect(data->rasterBuffer, x1, y1, width, height, data->solidColor); return; } } @@ -1892,9 +1871,9 @@ void QRasterPaintEngine::fillRect(const QRectF &r, const QColor &color) Q_D(QRasterPaintEngine); QRasterPaintEngineState *s = state(); - d->solid_color_filler.solid.color = qPremultiply(combineAlpha256(color.rgba64(), s->intOpacity)); + d->solid_color_filler.solidColor = qPremultiply(combineAlpha256(color.rgba64(), s->intOpacity)); - if (d->solid_color_filler.solid.color.isTransparent() + if (d->solid_color_filler.solidColor.isTransparent() && s->composition_mode == QPainter::CompositionMode_SourceOver) { return; } @@ -2348,14 +2327,14 @@ void QRasterPaintEngine::drawImage(const QRectF &r, const QImage &img, const QRe case QImage::Format_A2BGR30_Premultiplied: case QImage::Format_A2RGB30_Premultiplied: // Combine premultiplied color with the opacity set on the painter. - d->solid_color_filler.solid.color = multiplyAlpha256(QRgba64::fromArgb32(color), s->intOpacity); + d->solid_color_filler.solidColor = multiplyAlpha256(QRgba64::fromArgb32(color), s->intOpacity); break; default: - d->solid_color_filler.solid.color = qPremultiply(combineAlpha256(QRgba64::fromArgb32(color), s->intOpacity)); + d->solid_color_filler.solidColor = qPremultiply(combineAlpha256(QRgba64::fromArgb32(color), s->intOpacity)); break; } - if (d->solid_color_filler.solid.color.isTransparent() && s->composition_mode == QPainter::CompositionMode_SourceOver) + if (d->solid_color_filler.solidColor.isTransparent() && s->composition_mode == QPainter::CompositionMode_SourceOver) return; d->solid_color_filler.clip = d->clip(); @@ -2705,20 +2684,20 @@ void QRasterPaintEngine::alphaPenBlt(const void* src, int bpl, int depth, int rx if (unclipped) { if (depth == 1) { if (s->penData.bitmapBlit) { - s->penData.bitmapBlit(rb, rx, ry, s->penData.solid.color, + s->penData.bitmapBlit(rb, rx, ry, s->penData.solidColor, scanline, w, h, bpl); return; } } else if (depth == 8) { if (s->penData.alphamapBlit) { - s->penData.alphamapBlit(rb, rx, ry, s->penData.solid.color, + s->penData.alphamapBlit(rb, rx, ry, s->penData.solidColor, scanline, w, h, bpl, 0, useGammaCorrection); return; } } else if (depth == 32) { // (A)RGB Alpha mask where the alpha component is not used. if (s->penData.alphaRGBBlit) { - s->penData.alphaRGBBlit(rb, rx, ry, s->penData.solid.color, + s->penData.alphaRGBBlit(rb, rx, ry, s->penData.solidColor, (const uint *) scanline, w, h, bpl / 4, 0, useGammaCorrection); return; } @@ -2747,10 +2726,10 @@ void QRasterPaintEngine::alphaPenBlt(const void* src, int bpl, int depth, int rx ry = ny; } if (depth == 8) - s->penData.alphamapBlit(rb, rx, ry, s->penData.solid.color, + s->penData.alphamapBlit(rb, rx, ry, s->penData.solidColor, scanline, w, h, bpl, clip, useGammaCorrection); else if (depth == 32) - s->penData.alphaRGBBlit(rb, rx, ry, s->penData.solid.color, + s->penData.alphaRGBBlit(rb, rx, ry, s->penData.solidColor, (const uint *) scanline, w, h, bpl / 4, clip, useGammaCorrection); return; } @@ -3428,7 +3407,7 @@ bool QRasterPaintEngine::requiresPretransformedGlyphPositions(QFontEngine *fontE } /*! - Indicates whether glyph caching is supported by the font engine + Returns whether glyph caching is supported by the font engine \a fontEngine with the given transform \a m applied. */ bool QRasterPaintEngine::shouldDrawCachedGlyphs(QFontEngine *fontEngine, const QTransform &m) const @@ -3827,7 +3806,6 @@ QImage::Format QRasterBuffer::prepare(QImage *image) bytes_per_line = image->bytesPerLine(); format = image->format(); - drawHelper = qDrawHelper + format; if (image->depth() == 1 && image->colorTable().size() == 2) { monoDestinationWithClut = true; const QVector<QRgb> colorTable = image->colorTable(); @@ -3838,11 +3816,6 @@ QImage::Format QRasterBuffer::prepare(QImage *image) return format; } -void QRasterBuffer::resetBuffer(int val) -{ - memset(m_buffer, val, m_height*bytes_per_line); -} - QClipData::QClipData(int height) { clipSpanHeight = height; @@ -3875,51 +3848,15 @@ void QClipData::initialize() Q_CHECK_PTR(m_clipLines); QT_TRY { - m_spans = (QSpan *)malloc(clipSpanHeight*sizeof(QSpan)); allocated = clipSpanHeight; - Q_CHECK_PTR(m_spans); - QT_TRY { - if (hasRectClip) { - int y = 0; - while (y < ymin) { - m_clipLines[y].spans = 0; - m_clipLines[y].count = 0; - ++y; - } - - const int len = clipRect.width(); - count = 0; - while (y < ymax) { - QSpan *span = m_spans + count; - span->x = xmin; - span->len = len; - span->y = y; - span->coverage = 255; - ++count; - - m_clipLines[y].spans = span; - m_clipLines[y].count = 1; - ++y; - } - - while (y < clipSpanHeight) { - m_clipLines[y].spans = 0; - m_clipLines[y].count = 0; - ++y; - } - } else if (hasRegionClip) { - + if (hasRegionClip) { const auto rects = clipRegion.begin(); const int numRects = clipRegion.rectCount(); - - { // resize - const int maxSpans = (ymax - ymin) * numRects; - if (maxSpans > allocated) { - m_spans = q_check_ptr((QSpan *)realloc(m_spans, maxSpans * sizeof(QSpan))); - allocated = maxSpans; - } - } + const int maxSpans = (ymax - ymin) * numRects; + allocated = qMax(allocated, maxSpans); + m_spans = (QSpan *)malloc(allocated * sizeof(QSpan)); + Q_CHECK_PTR(m_spans); int y = 0; int firstInBand = 0; @@ -3966,6 +3903,40 @@ void QClipData::initialize() ++y; } + return; + } + + m_spans = (QSpan *)malloc(allocated * sizeof(QSpan)); + Q_CHECK_PTR(m_spans); + + if (hasRectClip) { + int y = 0; + while (y < ymin) { + m_clipLines[y].spans = 0; + m_clipLines[y].count = 0; + ++y; + } + + const int len = clipRect.width(); + count = 0; + while (y < ymax) { + QSpan *span = m_spans + count; + span->x = xmin; + span->len = len; + span->y = y; + span->coverage = 255; + ++count; + + m_clipLines[y].spans = span; + m_clipLines[y].count = 1; + ++y; + } + + while (y < clipSpanHeight) { + m_clipLines[y].spans = 0; + m_clipLines[y].count = 0; + ++y; + } } } QT_CATCH(...) { free(m_spans); // have to free m_spans again or someone might think that we were successfully initialized. @@ -4267,55 +4238,13 @@ static void qt_span_clip(int count, const QSpan *spans, void *userData) } } -#ifndef QT_NO_DEBUG -QImage QRasterBuffer::bufferImage() const -{ - QImage image(m_width, m_height, QImage::Format_ARGB32_Premultiplied); - - for (int y = 0; y < m_height; ++y) { - uint *span = (uint *)const_cast<QRasterBuffer *>(this)->scanLine(y); - - for (int x=0; x<m_width; ++x) { - uint argb = span[x]; - image.setPixel(x, y, argb); - } - } - return image; -} -#endif - - -void QRasterBuffer::flushToARGBImage(QImage *target) const -{ - int w = qMin(m_width, target->width()); - int h = qMin(m_height, target->height()); - - for (int y=0; y<h; ++y) { - uint *sourceLine = (uint *)const_cast<QRasterBuffer *>(this)->scanLine(y); - QRgb *dest = (QRgb *) target->scanLine(y); - for (int x=0; x<w; ++x) { - QRgb pixel = sourceLine[x]; - int alpha = qAlpha(pixel); - if (!alpha) { - dest[x] = 0; - } else { - dest[x] = (alpha << 24) - | ((255*qRed(pixel)/alpha) << 16) - | ((255*qGreen(pixel)/alpha) << 8) - | ((255*qBlue(pixel)/alpha) << 0); - } - } - } -} - - class QGradientCache { public: struct CacheInfo : QSpanData::Pinnable { inline CacheInfo(QGradientStops s, int op, QGradient::InterpolationMode mode) : - stops(qMove(s)), opacity(op), interpolationMode(mode) {} + stops(std::move(s)), opacity(op), interpolationMode(mode) {} QRgba64 buffer64[GRADIENT_STOPTABLE_SIZE]; QRgb buffer32[GRADIENT_STOPTABLE_SIZE]; QGradientStops stops; @@ -4588,8 +4517,8 @@ void QSpanData::setup(const QBrush &brush, int alpha, QPainter::CompositionMode case Qt::SolidPattern: { type = Solid; QColor c = qbrush_color(brush); - solid.color = qPremultiply(combineAlpha256(c.rgba64(), alpha)); - if (solid.color.isTransparent() && compositionMode == QPainter::CompositionMode_SourceOver) + solidColor = qPremultiply(combineAlpha256(c.rgba64(), alpha)); + if (solidColor.isTransparent() && compositionMode == QPainter::CompositionMode_SourceOver) type = None; break; } @@ -4602,7 +4531,9 @@ void QSpanData::setup(const QBrush &brush, int alpha, QPainter::CompositionMode auto cacheInfo = qt_gradient_cache()->getBuffer(*g, alpha); gradient.colorTable32 = cacheInfo->buffer32; +#if QT_CONFIG(raster_64bit) gradient.colorTable64 = cacheInfo->buffer64; +#endif cachedGradient = std::move(cacheInfo); gradient.spread = g->spread(); @@ -4624,7 +4555,9 @@ void QSpanData::setup(const QBrush &brush, int alpha, QPainter::CompositionMode auto cacheInfo = qt_gradient_cache()->getBuffer(*g, alpha); gradient.colorTable32 = cacheInfo->buffer32; +#if QT_CONFIG(raster_64bit) gradient.colorTable64 = cacheInfo->buffer64; +#endif cachedGradient = std::move(cacheInfo); gradient.spread = g->spread(); @@ -4650,7 +4583,9 @@ void QSpanData::setup(const QBrush &brush, int alpha, QPainter::CompositionMode auto cacheInfo = qt_gradient_cache()->getBuffer(*g, alpha); gradient.colorTable32 = cacheInfo->buffer32; +#if QT_CONFIG(raster_64bit) gradient.colorTable64 = cacheInfo->buffer64; +#endif cachedGradient = std::move(cacheInfo); gradient.spread = QGradient::RepeatSpread; @@ -4715,17 +4650,19 @@ void QSpanData::adjustSpanMethods() case None: unclipped_blend = 0; break; - case Solid: - unclipped_blend = rasterBuffer->drawHelper->blendColor; - bitmapBlit = rasterBuffer->drawHelper->bitmapBlit; - alphamapBlit = rasterBuffer->drawHelper->alphamapBlit; - alphaRGBBlit = rasterBuffer->drawHelper->alphaRGBBlit; - fillRect = rasterBuffer->drawHelper->fillRect; + case Solid: { + const DrawHelper &drawHelper = qDrawHelper[rasterBuffer->format]; + unclipped_blend = drawHelper.blendColor; + bitmapBlit = drawHelper.bitmapBlit; + alphamapBlit = drawHelper.alphamapBlit; + alphaRGBBlit = drawHelper.alphaRGBBlit; + fillRect = drawHelper.fillRect; break; + } case LinearGradient: case RadialGradient: case ConicalGradient: - unclipped_blend = rasterBuffer->drawHelper->blendGradient; + unclipped_blend = qBlendGradient; break; case Texture: unclipped_blend = qBlendTexture; diff --git a/src/gui/painting/qpaintengine_raster_p.h b/src/gui/painting/qpaintengine_raster_p.h index 14eddf07b1..500e0fae54 100644 --- a/src/gui/painting/qpaintengine_raster_p.h +++ b/src/gui/painting/qpaintengine_raster_p.h @@ -208,15 +208,6 @@ public: ClipType clipType() const; QRect clipBoundingRect() const; - void releaseBuffer(); - - QSize size() const; - -#ifndef QT_NO_DEBUG - void saveBuffer(const QString &s) const; -#endif - - #ifdef Q_OS_WIN void setDC(HDC hdc); HDC getDC() const; @@ -435,27 +426,16 @@ inline void QClipData::appendSpans(const QSpan *s, int num) class QRasterBuffer { public: - QRasterBuffer() : m_width(0), m_height(0), m_buffer(0) { init(); } + QRasterBuffer() : m_width(0), m_height(0), m_buffer(nullptr) { init(); } ~QRasterBuffer(); void init(); QImage::Format prepare(QImage *image); - QImage::Format prepare(QPixmap *pix); - void prepare(int w, int h); - void prepareBuffer(int w, int h); - - void resetBuffer(int val=0); uchar *scanLine(int y) { Q_ASSERT(y>=0); Q_ASSERT(y<m_height); return m_buffer + y * bytes_per_line; } -#ifndef QT_NO_DEBUG - QImage bufferImage() const; -#endif - - void flushToARGBImage(QImage *image) const; - int width() const { return m_width; } int height() const { return m_height; } int bytesPerLine() const { return bytes_per_line; } @@ -471,7 +451,6 @@ public: QPainter::CompositionMode compositionMode; QImage::Format format; - DrawHelper *drawHelper; QImage colorizeBitmap(const QImage &image, const QColor &color); private: diff --git a/src/gui/painting/qpaintengineex.cpp b/src/gui/painting/qpaintengineex.cpp index 9f07af92e4..22d3fb3001 100644 --- a/src/gui/painting/qpaintengineex.cpp +++ b/src/gui/painting/qpaintengineex.cpp @@ -439,6 +439,9 @@ void QPaintEngineEx::stroke(const QVectorPath &path, const QPen &pen) } } + if (d->activeStroker == &d->stroker) + d->stroker.setForceOpen(path.hasExplicitOpen()); + const QPainterPath::ElementType *types = path.elements(); const qreal *points = path.points(); int pointCount = path.elementCount(); @@ -1090,9 +1093,14 @@ bool QPaintEngineEx::shouldDrawCachedGlyphs(QFontEngine *fontEngine, const QTran if (fontEngine->glyphFormat == QFontEngine::Format_ARGB) return true; + static const int maxCachedGlyphSizeSquared = std::pow([]{ + if (int env = qEnvironmentVariableIntValue("QT_MAX_CACHED_GLYPH_SIZE")) + return env; + return QT_MAX_CACHED_GLYPH_SIZE; + }(), 2); + qreal pixelSize = fontEngine->fontDef.pixelSize; - return (pixelSize * pixelSize * qAbs(m.determinant())) < - QT_MAX_CACHED_GLYPH_SIZE * QT_MAX_CACHED_GLYPH_SIZE; + return (pixelSize * pixelSize * qAbs(m.determinant())) <= maxCachedGlyphSizeSquared; } QT_END_NAMESPACE diff --git a/src/gui/painting/qpainter.cpp b/src/gui/painting/qpainter.cpp index b70b29e54e..95e6bda78b 100644 --- a/src/gui/painting/qpainter.cpp +++ b/src/gui/painting/qpainter.cpp @@ -1437,6 +1437,13 @@ void QPainterPrivate::updateState(QPainterState *newState) by slightly less than half a pixel. Also will treat default constructed pens as cosmetic. Potentially useful when porting a Qt 4 application to Qt 5. + \value LosslessImageRendering Use a lossless image rendering, whenever possible. + Currently, this hint is only used when QPainter is employed to output a PDF + file through QPrinter or QPdfWriter, where drawImage()/drawPixmap() calls + will encode images using a lossless compression algorithm instead of lossy + JPEG compression. + This value was added in Qt 5.13. + \sa renderHints(), setRenderHint(), {QPainter#Rendering Quality}{Rendering Quality}, {Concentric Circles Example} @@ -1514,7 +1521,7 @@ QPainter::~QPainter() /*! Returns the paint device on which this painter is currently - painting, or 0 if the painter is not active. + painting, or \nullptr if the painter is not active. \sa isActive() */ @@ -1540,6 +1547,7 @@ bool QPainter::isActive() const return d->engine; } +#if QT_DEPRECATED_SINCE(5, 13) /*! Initializes the painters pen, background and font to the same as the given \a device. @@ -1567,7 +1575,7 @@ void QPainter::initFrom(const QPaintDevice *device) d->engine->setDirty(QPaintEngine::DirtyFont); } } - +#endif /*! Saves the current painter state (pushes the state onto a stack). A @@ -2878,6 +2886,7 @@ void QPainter::setClipRegion(const QRegion &r, Qt::ClipOperation op) d->updateState(d->state); } +#if QT_DEPRECATED_SINCE(5, 13) /*! \since 4.2 \obsolete @@ -2972,7 +2981,10 @@ void QPainter::setMatrix(const QMatrix &matrix, bool combine) const QMatrix &QPainter::matrix() const { +QT_WARNING_PUSH +QT_WARNING_DISABLE_DEPRECATED return worldMatrix(); +QT_WARNING_POP } @@ -3041,7 +3053,7 @@ void QPainter::resetMatrix() { resetTransform(); } - +#endif /*! \since 4.2 @@ -3092,6 +3104,7 @@ bool QPainter::worldMatrixEnabled() const return d->state->WxF; } +#if QT_DEPRECATED_SINCE(5, 13) /*! \obsolete @@ -3117,6 +3130,7 @@ bool QPainter::matrixEnabled() const { return worldMatrixEnabled(); } +#endif /*! Scales the coordinate system by (\a{sx}, \a{sy}). @@ -4175,6 +4189,7 @@ void QPainter::drawRoundedRect(const QRectF &rect, qreal xRadius, qreal yRadius, Draws the given rectangle \a x, \a y, \a w, \a h with rounded corners. */ +#if QT_DEPRECATED_SINCE(5, 13) /*! \obsolete @@ -4202,6 +4217,10 @@ void QPainter::drawRoundRect(const QRectF &r, int xRnd, int yRnd) Draws the rectangle \a r with rounded corners. */ +void QPainter::drawRoundRect(const QRect &rect, int xRnd, int yRnd) +{ + drawRoundedRect(QRectF(rect), xRnd, yRnd, Qt::RelativeSize); +} /*! \obsolete @@ -4212,6 +4231,11 @@ void QPainter::drawRoundRect(const QRectF &r, int xRnd, int yRnd) Draws the rectangle \a x, \a y, \a w, \a h with rounded corners. */ +void QPainter::drawRoundRect(int x, int y, int w, int h, int xRnd, int yRnd) +{ + drawRoundedRect(QRectF(x, y, w, h), xRnd, yRnd, Qt::RelativeSize); +} +#endif /*! \fn void QPainter::drawEllipse(const QRectF &rectangle) @@ -6203,7 +6227,7 @@ static QPixmap generateWavyPixmap(qreal maxRadius, const QPen &pen) % HexString<qreal>(pen.widthF()); QPixmap pixmap; - if (QPixmapCache::find(key, pixmap)) + if (QPixmapCache::find(key, &pixmap)) return pixmap; const qreal halfPeriod = qMax(qreal(2), qreal(radiusBase * 1.61803399)); // the golden ratio @@ -7371,6 +7395,7 @@ void QPainter::setViewTransformEnabled(bool enable) d->updateMatrix(); } +#if QT_DEPRECATED_SINCE(5, 13) /*! \threadsafe @@ -7451,6 +7476,7 @@ QPaintDevice *QPainter::redirected(const QPaintDevice *device, QPoint *offset) Q_UNUSED(offset) return 0; } +#endif void qt_format_text(const QFont &fnt, const QRectF &_r, int tf, const QString& str, QRectF *brect, @@ -8060,6 +8086,7 @@ QFont QPaintEngineState::font() const return static_cast<const QPainterState *>(this)->font; } +#if QT_DEPRECATED_SINCE(5, 13) /*! \since 4.2 \obsolete @@ -8082,6 +8109,7 @@ QMatrix QPaintEngineState::matrix() const return st->matrix.toAffine(); } +#endif /*! \since 4.3 @@ -8321,7 +8349,7 @@ void QPainter::resetTransform() d->state->ww = d->state->vw = d->device->metric(QPaintDevice::PdmWidth); d->state->wh = d->state->vh = d->device->metric(QPaintDevice::PdmHeight); d->state->worldMatrix = QTransform(); - setMatrixEnabled(false); + setWorldMatrixEnabled(false); setViewTransformEnabled(false); if (d->extended) d->extended->transformChanged(); diff --git a/src/gui/painting/qpainter.h b/src/gui/painting/qpainter.h index 482f5fb63d..843f24e3e1 100644 --- a/src/gui/painting/qpainter.h +++ b/src/gui/painting/qpainter.h @@ -91,7 +91,8 @@ public: SmoothPixmapTransform = 0x04, HighQualityAntialiasing = 0x08, NonCosmeticDefaultPen = 0x10, - Qt4CompatiblePainting = 0x20 + Qt4CompatiblePainting = 0x20, + LosslessImageRendering = 0x40, }; Q_FLAG(RenderHint) @@ -131,7 +132,10 @@ public: bool end(); bool isActive() const; +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use begin(QPaintDevice*) instead") void initFrom(const QPaintDevice *device); +#endif enum CompositionMode { CompositionMode_SourceOver, @@ -231,28 +235,40 @@ public: void restore(); // XForm functions +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use setTransform() instead") void setMatrix(const QMatrix &matrix, bool combine = false); + QT_DEPRECATED_X("Use transform() instead") const QMatrix &matrix() const; + QT_DEPRECATED_X("Use deviceTransform() instead") const QMatrix &deviceMatrix() const; + QT_DEPRECATED_X("Use resetTransform() instead") void resetMatrix(); +#endif void setTransform(const QTransform &transform, bool combine = false); const QTransform &transform() const; const QTransform &deviceTransform() const; void resetTransform(); +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use setWorldTransform() instead") void setWorldMatrix(const QMatrix &matrix, bool combine = false); + QT_DEPRECATED_X("Use worldTransform() instead") const QMatrix &worldMatrix() const; + QT_DEPRECATED_X("Use combinedTransform() instead") + QMatrix combinedMatrix() const; + QT_DEPRECATED_X("Use setWorldMatrixEnabled() instead") + void setMatrixEnabled(bool enabled); + QT_DEPRECATED_X("Use worldMatrixEnabled() instead") + bool matrixEnabled() const; +#endif void setWorldTransform(const QTransform &matrix, bool combine = false); const QTransform &worldTransform() const; - QMatrix combinedMatrix() const; QTransform combinedTransform() const; - void setMatrixEnabled(bool enabled); - bool matrixEnabled() const; - void setWorldMatrixEnabled(bool enabled); bool worldMatrixEnabled() const; @@ -354,9 +370,14 @@ public: inline void drawRoundedRect(const QRect &rect, qreal xRadius, qreal yRadius, Qt::SizeMode mode = Qt::AbsoluteSize); +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use drawRoundedRect(..., Qt::RelativeSize) instead") void drawRoundRect(const QRectF &r, int xround = 25, int yround = 25); - inline void drawRoundRect(int x, int y, int w, int h, int = 25, int = 25); - inline void drawRoundRect(const QRect &r, int xround = 25, int yround = 25); + QT_DEPRECATED_X("Use drawRoundedRect(..., Qt::RelativeSize) instead") + void drawRoundRect(int x, int y, int w, int h, int = 25, int = 25); + QT_DEPRECATED_X("Use drawRoundedRect(..., Qt::RelativeSize) instead") + void drawRoundRect(const QRect &r, int xround = 25, int yround = 25); +#endif void drawTiledPixmap(const QRectF &rect, const QPixmap &pm, const QPointF &offset = QPointF()); inline void drawTiledPixmap(int x, int y, int w, int h, const QPixmap &, int sx=0, int sy=0); @@ -463,10 +484,15 @@ public: QPaintEngine *paintEngine() const; +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use QWidget::render() instead") static void setRedirected(const QPaintDevice *device, QPaintDevice *replacement, const QPoint& offset = QPoint()); + QT_DEPRECATED_X("Use QWidget::render() instead") static QPaintDevice *redirected(const QPaintDevice *device, QPoint *offset = nullptr); + QT_DEPRECATED_X("Use QWidget::render() instead") static void restoreRedirected(const QPaintDevice *device); +#endif void beginNativePainting(); void endNativePainting(); @@ -628,16 +654,6 @@ inline void QPainter::drawPoints(const QPolygon &points) drawPoints(points.constData(), points.size()); } -inline void QPainter::drawRoundRect(int x, int y, int w, int h, int xRnd, int yRnd) -{ - drawRoundRect(QRectF(x, y, w, h), xRnd, yRnd); -} - -inline void QPainter::drawRoundRect(const QRect &rect, int xRnd, int yRnd) -{ - drawRoundRect(QRectF(rect), xRnd, yRnd); -} - inline void QPainter::drawRoundedRect(int x, int y, int w, int h, qreal xRadius, qreal yRadius, Qt::SizeMode mode) { diff --git a/src/gui/painting/qpainter_p.h b/src/gui/painting/qpainter_p.h index 2d44577310..bd2bc4c9b3 100644 --- a/src/gui/painting/qpainter_p.h +++ b/src/gui/painting/qpainter_p.h @@ -51,8 +51,11 @@ // We mean it. // +#include <QtCore/qvarlengtharray.h> #include <QtGui/private/qtguiglobal_p.h> #include "QtGui/qbrush.h" +#include "QtGui/qcolorspace.h" +#include "QtGui/qcolortransform.h" #include "QtGui/qfont.h" #include "QtGui/qpen.h" #include "QtGui/qregion.h" @@ -190,9 +193,9 @@ class QPainterPrivate Q_DECLARE_PUBLIC(QPainter) public: QPainterPrivate(QPainter *painter) - : q_ptr(painter), d_ptrs(0), state(0), dummyState(0), txinv(0), inDestructor(false), d_ptrs_size(0), - refcount(1), device(0), original_device(0), helper_device(0), engine(0), emulationEngine(0), - extended(0) + : q_ptr(painter), d_ptrs(nullptr), state(nullptr), dummyState(nullptr), txinv(0), inDestructor(false), d_ptrs_size(0), + refcount(1), device(nullptr), original_device(nullptr), helper_device(nullptr), engine(nullptr), emulationEngine(nullptr), + extended(nullptr) { } @@ -202,7 +205,7 @@ public: QPainterPrivate **d_ptrs; QPainterState *state; - QVector<QPainterState*> states; + QVarLengthArray<QPainterState *, 8> states; mutable QPainterDummyState *dummyState; diff --git a/src/gui/painting/qpainterpath.cpp b/src/gui/painting/qpainterpath.cpp index 2574a00838..649cfd554b 100644 --- a/src/gui/painting/qpainterpath.cpp +++ b/src/gui/painting/qpainterpath.cpp @@ -527,7 +527,7 @@ void QPainterPath::setElementPositionAt(int i, qreal x, qreal y) /*! Constructs an empty QPainterPath object. */ -QPainterPath::QPainterPath() Q_DECL_NOEXCEPT +QPainterPath::QPainterPath() noexcept : d_ptr(0) { } @@ -629,6 +629,55 @@ QPainterPath::~QPainterPath() } /*! + Clears the path elements stored. + + This allows the path to reuse previous memory allocations. + + \sa reserve(), capacity() + \since 5.13 +*/ +void QPainterPath::clear() +{ + if (!d_ptr) + return; + + detach(); + d_func()->clear(); +} + +/*! + Reserves a given amount of elements in QPainterPath's internal memory. + + Attempts to allocate memory for at least \a size elements. + + \sa clear(), capacity(), QVector::reserve() + \since 5.13 +*/ +void QPainterPath::reserve(int size) +{ + Q_D(QPainterPath); + if ((!d && size > 0) || (d && d->elements.capacity() < size)) { + detach(); + d->elements.reserve(size); + } +} + +/*! + Returns the number of elements allocated by the QPainterPath. + + \sa clear(), reserve() + \since 5.13 +*/ +int QPainterPath::capacity() const +{ + Q_D(QPainterPath); + if (d) + return d->elements.capacity(); + + return 0; +} + +/*! Closes the current subpath by drawing a line to the beginning of the subpath, automatically starting a new path. The current point of the new path is (0, 0). @@ -2271,13 +2320,19 @@ static inline bool epsilonCompare(const QPointF &a, const QPointF &b, const QSiz bool QPainterPath::operator==(const QPainterPath &path) const { QPainterPathData *d = reinterpret_cast<QPainterPathData *>(d_func()); - if (path.d_func() == d) + QPainterPathData *other_d = path.d_func(); + if (other_d == d) return true; - else if (!d || !path.d_func()) + else if (!d || !other_d) { + if (!d && other_d->elements.empty() && other_d->fillRule == Qt::OddEvenFill) + return true; + if (!other_d && d && d->elements.empty() && d->fillRule == Qt::OddEvenFill) + return true; return false; - else if (d->fillRule != path.d_func()->fillRule) + } + else if (d->fillRule != other_d->fillRule) return false; - else if (d->elements.size() != path.d_func()->elements.size()) + else if (d->elements.size() != other_d->elements.size()) return false; const qreal qt_epsilon = sizeof(qreal) == sizeof(double) ? 1e-12 : qreal(1e-5); @@ -2287,8 +2342,8 @@ bool QPainterPath::operator==(const QPainterPath &path) const epsilon.rheight() *= qt_epsilon; for (int i = 0; i < d->elements.size(); ++i) - if (d->elements.at(i).type != path.d_func()->elements.at(i).type - || !epsilonCompare(d->elements.at(i), path.d_func()->elements.at(i), epsilon)) + if (d->elements.at(i).type != other_d->elements.at(i).type + || !epsilonCompare(d->elements.at(i), other_d->elements.at(i), epsilon)) return false; return true; @@ -2476,7 +2531,7 @@ QDataStream &operator>>(QDataStream &s, QPainterPath &p) s >> p.d_func()->cStart; int fillRule; s >> fillRule; - Q_ASSERT(fillRule == Qt::OddEvenFill || Qt::WindingFill); + Q_ASSERT(fillRule == Qt::OddEvenFill || fillRule == Qt::WindingFill); p.d_func()->fillRule = Qt::FillRule(fillRule); p.d_func()->dirtyBounds = true; p.d_func()->dirtyControlBounds = true; @@ -3187,6 +3242,7 @@ void QPainterPath::addRoundedRect(const QRectF &rect, qreal xRadius, qreal yRadi Adds the given rectangle \a x, \a y, \a w, \a h with rounded corners to the path. */ +#if QT_DEPRECATED_SINCE(5, 13) /*! \obsolete @@ -3253,6 +3309,17 @@ void QPainterPath::addRoundRect(const QRectF &r, int xRnd, int yRnd) \sa addRoundedRect() */ +void QPainterPath::addRoundRect(const QRectF &rect, + int roundness) +{ + int xRnd = roundness; + int yRnd = roundness; + if (rect.width() > rect.height()) + xRnd = int(roundness * rect.height()/rect.width()); + else + yRnd = int(roundness * rect.width()/rect.height()); + addRoundedRect(rect, xRnd, yRnd, Qt::RelativeSize); +} /*! \obsolete @@ -3269,6 +3336,11 @@ void QPainterPath::addRoundRect(const QRectF &r, int xRnd, int yRnd) \sa addRoundedRect() */ +void QPainterPath::addRoundRect(qreal x, qreal y, qreal w, qreal h, + int xRnd, int yRnd) +{ + addRoundedRect(QRectF(x, y, w, h), xRnd, yRnd, Qt::RelativeSize); +} /*! \obsolete @@ -3288,6 +3360,12 @@ void QPainterPath::addRoundRect(const QRectF &r, int xRnd, int yRnd) \sa addRoundedRect() */ +void QPainterPath::addRoundRect(qreal x, qreal y, qreal w, qreal h, + int roundness) +{ + addRoundedRect(QRectF(x, y, w, h), roundness, Qt::RelativeSize); +} +#endif /*! \since 4.3 @@ -3342,6 +3420,7 @@ QPainterPath QPainterPath::subtracted(const QPainterPath &p) const return clipper.clip(QPathClipper::BoolSub); } +#if QT_DEPRECATED_SINCE(5, 13) /*! \since 4.3 \obsolete @@ -3354,6 +3433,7 @@ QPainterPath QPainterPath::subtractedInverted(const QPainterPath &p) const { return p.subtracted(*this); } +#endif /*! \since 4.4 diff --git a/src/gui/painting/qpainterpath.h b/src/gui/painting/qpainterpath.h index db39c1c5a0..2785669260 100644 --- a/src/gui/painting/qpainterpath.h +++ b/src/gui/painting/qpainterpath.h @@ -88,16 +88,21 @@ public: inline bool operator!=(const Element &e) const { return !operator==(e); } }; - QPainterPath() Q_DECL_NOEXCEPT; + QPainterPath() noexcept; explicit QPainterPath(const QPointF &startPoint); QPainterPath(const QPainterPath &other); QPainterPath &operator=(const QPainterPath &other); #ifdef Q_COMPILER_RVALUE_REFS - inline QPainterPath &operator=(QPainterPath &&other) Q_DECL_NOEXCEPT + inline QPainterPath &operator=(QPainterPath &&other) noexcept { qSwap(d_ptr, other.d_ptr); return *this; } #endif ~QPainterPath(); - inline void swap(QPainterPath &other) Q_DECL_NOEXCEPT { d_ptr.swap(other.d_ptr); } + + inline void swap(QPainterPath &other) noexcept { d_ptr.swap(other.d_ptr); } + + void clear(); + void reserve(int size); + int capacity() const; void closeSubpath(); @@ -138,12 +143,18 @@ public: qreal xRadius, qreal yRadius, Qt::SizeMode mode = Qt::AbsoluteSize); +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use addRoundedRect(..., Qt::RelativeSize) instead") void addRoundRect(const QRectF &rect, int xRnd, int yRnd); - inline void addRoundRect(qreal x, qreal y, qreal w, qreal h, - int xRnd, int yRnd); - inline void addRoundRect(const QRectF &rect, int roundness); - inline void addRoundRect(qreal x, qreal y, qreal w, qreal h, - int roundness); + QT_DEPRECATED_X("Use addRoundedRect(..., Qt::RelativeSize) instead") + void addRoundRect(qreal x, qreal y, qreal w, qreal h, + int xRnd, int yRnd); + QT_DEPRECATED_X("Use addRoundedRect(..., Qt::RelativeSize) instead") + void addRoundRect(const QRectF &rect, int roundness); + QT_DEPRECATED_X("Use addRoundedRect(..., Qt::RelativeSize) instead") + void addRoundRect(qreal x, qreal y, qreal w, qreal h, + int roundness); +#endif void connectPath(const QPainterPath &path); @@ -188,7 +199,10 @@ public: Q_REQUIRED_RESULT QPainterPath united(const QPainterPath &r) const; Q_REQUIRED_RESULT QPainterPath intersected(const QPainterPath &r) const; Q_REQUIRED_RESULT QPainterPath subtracted(const QPainterPath &r) const; +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use r.subtracted() instead") Q_REQUIRED_RESULT QPainterPath subtractedInverted(const QPainterPath &r) const; +#endif Q_REQUIRED_RESULT QPainterPath simplified() const; @@ -333,30 +347,6 @@ inline void QPainterPath::addRoundedRect(qreal x, qreal y, qreal w, qreal h, addRoundedRect(QRectF(x, y, w, h), xRadius, yRadius, mode); } -inline void QPainterPath::addRoundRect(qreal x, qreal y, qreal w, qreal h, - int xRnd, int yRnd) -{ - addRoundRect(QRectF(x, y, w, h), xRnd, yRnd); -} - -inline void QPainterPath::addRoundRect(const QRectF &rect, - int roundness) -{ - int xRnd = roundness; - int yRnd = roundness; - if (rect.width() > rect.height()) - xRnd = int(roundness * rect.height()/rect.width()); - else - yRnd = int(roundness * rect.width()/rect.height()); - addRoundRect(rect, xRnd, yRnd); -} - -inline void QPainterPath::addRoundRect(qreal x, qreal y, qreal w, qreal h, - int roundness) -{ - addRoundRect(QRectF(x, y, w, h), roundness); -} - inline void QPainterPath::addText(qreal x, qreal y, const QFont &f, const QString &text) { addText(QPointF(x, y), f, text); diff --git a/src/gui/painting/qpainterpath_p.h b/src/gui/painting/qpainterpath_p.h index 92d9a4ea66..98056483bc 100644 --- a/src/gui/painting/qpainterpath_p.h +++ b/src/gui/painting/qpainterpath_p.h @@ -157,7 +157,7 @@ public: QVectorPath path; private: - Q_DISABLE_COPY(QVectorPathConverter) + Q_DISABLE_COPY_MOVE(QVectorPathConverter) }; class QPainterPathData : public QPainterPathPrivate @@ -168,7 +168,7 @@ public: fillRule(Qt::OddEvenFill), dirtyBounds(false), dirtyControlBounds(false), - pathConverter(0) + pathConverter(nullptr) { require_moveTo = false; convex = false; @@ -181,7 +181,7 @@ public: dirtyBounds(other.dirtyBounds), dirtyControlBounds(other.dirtyControlBounds), convex(other.convex), - pathConverter(0) + pathConverter(nullptr) { require_moveTo = false; elements = other.elements; @@ -194,6 +194,7 @@ public: inline bool isClosed() const; inline void close(); inline void maybeMoveTo(); + inline void clear(); const QVectorPath &vectorPath() { if (!pathConverter) @@ -290,6 +291,25 @@ inline void QPainterPathData::maybeMoveTo() } } +inline void QPainterPathData::clear() +{ + Q_ASSERT(ref.load() == 1); + + elements.clear(); + + cStart = 0; + + bounds = {}; + controlBounds = {}; + + require_moveTo = false; + dirtyBounds = false; + dirtyControlBounds = false; + convex = false; + + delete pathConverter; + pathConverter = nullptr; +} #define KAPPA qreal(0.5522847498) diff --git a/src/gui/painting/qpathclipper_p.h b/src/gui/painting/qpathclipper_p.h index 64e684e1ad..9444a87b71 100644 --- a/src/gui/painting/qpathclipper_p.h +++ b/src/gui/painting/qpathclipper_p.h @@ -82,11 +82,11 @@ public: bool intersect(); bool contains(); - static bool pathToRect(const QPainterPath &path, QRectF *rect = 0); + static bool pathToRect(const QPainterPath &path, QRectF *rect = nullptr); static QPainterPath intersect(const QPainterPath &path, const QRectF &rect); private: - Q_DISABLE_COPY(QPathClipper) + Q_DISABLE_COPY_MOVE(QPathClipper) enum ClipperMode { ClipMode, // do the full clip @@ -394,7 +394,7 @@ inline const QPathSegments::Intersection *QPathSegments::intersectionAt(int inde { const int intersection = m_segments.at(index).intersection; if (intersection < 0) - return 0; + return nullptr; else return &m_intersections.at(intersection); } @@ -428,12 +428,12 @@ inline int QWingedEdge::edgeCount() const inline QPathEdge *QWingedEdge::edge(int edge) { - return edge < 0 ? 0 : &m_edges.at(edge); + return edge < 0 ? nullptr : &m_edges.at(edge); } inline const QPathEdge *QWingedEdge::edge(int edge) const { - return edge < 0 ? 0 : &m_edges.at(edge); + return edge < 0 ? nullptr : &m_edges.at(edge); } inline int QWingedEdge::vertexCount() const @@ -449,12 +449,12 @@ inline int QWingedEdge::addVertex(const QPointF &p) inline QPathVertex *QWingedEdge::vertex(int vertex) { - return vertex < 0 ? 0 : &m_vertices.at(vertex); + return vertex < 0 ? nullptr : &m_vertices.at(vertex); } inline const QPathVertex *QWingedEdge::vertex(int vertex) const { - return vertex < 0 ? 0 : &m_vertices.at(vertex); + return vertex < 0 ? nullptr : &m_vertices.at(vertex); } inline QPathEdge::Traversal QWingedEdge::flip(QPathEdge::Traversal traversal) diff --git a/src/gui/painting/qpathsimplifier.cpp b/src/gui/painting/qpathsimplifier.cpp index 40585ec502..4251840bbc 100644 --- a/src/gui/painting/qpathsimplifier.cpp +++ b/src/gui/painting/qpathsimplifier.cpp @@ -3,7 +3,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtDeclarative module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/painting/qpathsimplifier_p.h b/src/gui/painting/qpathsimplifier_p.h index 6ef298f6bf..6c0062c592 100644 --- a/src/gui/painting/qpathsimplifier_p.h +++ b/src/gui/painting/qpathsimplifier_p.h @@ -3,7 +3,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtDeclarative module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/painting/qpdf.cpp b/src/gui/painting/qpdf.cpp index 4fd0d3c8fe..25d488961c 100644 --- a/src/gui/painting/qpdf.cpp +++ b/src/gui/painting/qpdf.cpp @@ -71,6 +71,11 @@ static const bool do_compress = true; // Can't use it though, as gs generates completely wrong images if this is true. static const bool interpolateImages = false; +static void initResources() +{ + Q_INIT_RESOURCE(qpdf); +} + QT_BEGIN_NAMESPACE inline QPaintEngine::PaintEngineFeatures qt_pdf_decide_features() @@ -851,7 +856,6 @@ void QPdfEngine::drawRects (const QRectF *rects, int rectCount) if (!d->hasPen && !d->hasBrush) return; - QBrush penBrush = d->pen.brush(); if (d->simplePen || !d->hasPen) { // draw strokes natively in this case for better output if(!d->simplePen && !d->stroker.matrix.isIdentity()) @@ -944,11 +948,23 @@ void QPdfEngine::drawPixmap (const QRectF &rectangle, const QPixmap &pixmap, con QPixmap pm = sourceRect != pixmap.rect() ? pixmap.copy(sourceRect) : pixmap; QImage image = pm.toImage(); bool bitmap = true; - const int object = d->addImage(image, &bitmap, pm.cacheKey()); + const bool lossless = painter()->testRenderHint(QPainter::LosslessImageRendering); + const int object = d->addImage(image, &bitmap, lossless, pm.cacheKey()); if (object < 0) return; - *d->currentPage << "q\n/GSa gs\n"; + *d->currentPage << "q\n"; + + if ((d->pdfVersion != QPdfEngine::Version_A1b) && (d->opacity != 1.0)) { + int stateObject = d->addConstantAlphaObject(qRound(255 * d->opacity), qRound(255 * d->opacity)); + if (stateObject) + *d->currentPage << "/GState" << stateObject << "gs\n"; + else + *d->currentPage << "/GSa gs\n"; + } else { + *d->currentPage << "/GSa gs\n"; + } + *d->currentPage << QPdf::generateMatrix(QTransform(rectangle.width() / sr.width(), 0, 0, rectangle.height() / sr.height(), rectangle.x(), rectangle.y()) * (d->simplePen ? QTransform() : d->stroker.matrix)); @@ -972,11 +988,23 @@ void QPdfEngine::drawImage(const QRectF &rectangle, const QImage &image, const Q QRect sourceRect = sr.toRect(); QImage im = sourceRect != image.rect() ? image.copy(sourceRect) : image; bool bitmap = true; - const int object = d->addImage(im, &bitmap, im.cacheKey()); + const bool lossless = painter()->testRenderHint(QPainter::LosslessImageRendering); + const int object = d->addImage(im, &bitmap, lossless, im.cacheKey()); if (object < 0) return; - *d->currentPage << "q\n/GSa gs\n"; + *d->currentPage << "q\n"; + + if ((d->pdfVersion != QPdfEngine::Version_A1b) && (d->opacity != 1.0)) { + int stateObject = d->addConstantAlphaObject(qRound(255 * d->opacity), qRound(255 * d->opacity)); + if (stateObject) + *d->currentPage << "/GState" << stateObject << "gs\n"; + else + *d->currentPage << "/GSa gs\n"; + } else { + *d->currentPage << "/GSa gs\n"; + } + *d->currentPage << QPdf::generateMatrix(QTransform(rectangle.width() / sr.width(), 0, 0, rectangle.height() / sr.height(), rectangle.x(), rectangle.y()) * (d->simplePen ? QTransform() : d->stroker.matrix)); @@ -1446,6 +1474,7 @@ QPdfEnginePrivate::QPdfEnginePrivate() grayscale(false), m_pageLayout(QPageSize(QPageSize::A4), QPageLayout::Portrait, QMarginsF(10, 10, 10, 10)) { + initResources(); resolution = 1200; currentObject = 1; currentPage = 0; @@ -1513,7 +1542,7 @@ bool QPdfEngine::end() Q_D(QPdfEngine); d->writeTail(); - d->stream->unsetDevice(); + d->stream->setDevice(nullptr); qDeleteAll(d->fonts); d->fonts.clear(); @@ -1541,7 +1570,14 @@ void QPdfEnginePrivate::writeHeader() { addXrefEntry(0,false); - xprintf("%%PDF-1.4\n"); + static const QHash<QPdfEngine::PdfVersion, const char *> mapping { + {QPdfEngine::Version_1_4, "1.4"}, + {QPdfEngine::Version_A1b, "1.4"}, + {QPdfEngine::Version_1_6, "1.6"} + }; + const char *verStr = mapping.value(pdfVersion, "1.4"); + + xprintf("%%PDF-%s\n", verStr); xprintf("%%\303\242\303\243\n"); writeInfo(); @@ -1635,19 +1671,19 @@ int QPdfEnginePrivate::writeXmpMetaData() const QDateTime now = QDateTime::currentDateTime(); const QDate date = now.date(); const QTime time = now.time(); - - QString timeStr; - timeStr.sprintf("%d-%02d-%02dT%02d:%02d:%02d", date.year(), date.month(), date.day(), - time.hour(), time.minute(), time.second()); + const QString timeStr = + QString::asprintf("%d-%02d-%02dT%02d:%02d:%02d", + date.year(), date.month(), date.day(), + time.hour(), time.minute(), time.second()); const int offset = now.offsetFromUtc(); const int hours = (offset / 60) / 60; const int mins = (offset / 60) % 60; QString tzStr; if (offset < 0) - tzStr.sprintf("-%02d:%02d", -hours, -mins); + tzStr = QString::asprintf("-%02d:%02d", -hours, -mins); else if (offset > 0) - tzStr.sprintf("+%02d:%02d", hours , mins); + tzStr = QString::asprintf("+%02d:%02d", hours , mins); else tzStr = QLatin1String("Z"); @@ -1874,6 +1910,19 @@ void QPdfEnginePrivate::embedFont(QFontSubset *font) } } +qreal QPdfEnginePrivate::calcUserUnit() const +{ + // PDF standards < 1.6 support max 200x200in pages (no UserUnit) + if (pdfVersion < QPdfEngine::Version_1_6) + return 1.0; + + const int maxLen = qMax(currentPage->pageSize.width(), currentPage->pageSize.height()); + if (maxLen <= 14400) + return 1.0; // for pages up to 200x200in (14400x14400 units) use default scaling + + // for larger pages, rescale units so we can have up to 381x381km + return qMin(maxLen / 14400.0, 75000.0); +} void QPdfEnginePrivate::writeFonts() { @@ -1896,6 +1945,8 @@ void QPdfEnginePrivate::writePage() uint resources = requestObject(); uint annots = requestObject(); + qreal userUnit = calcUserUnit(); + addXrefEntry(pages.constLast()); xprintf("<<\n" "/Type /Page\n" @@ -1903,12 +1954,17 @@ void QPdfEnginePrivate::writePage() "/Contents %d 0 R\n" "/Resources %d 0 R\n" "/Annots %d 0 R\n" - "/MediaBox [0 0 %d %d]\n" - ">>\n" - "endobj\n", + "/MediaBox [0 0 %s %s]\n", pageRoot, pageStream, resources, annots, // make sure we use the pagesize from when we started the page, since the user may have changed it - currentPage->pageSize.width(), currentPage->pageSize.height()); + QByteArray::number(currentPage->pageSize.width() / userUnit, 'f').constData(), + QByteArray::number(currentPage->pageSize.height() / userUnit, 'f').constData()); + + if (pdfVersion >= QPdfEngine::Version_1_6) + xprintf("/UserUnit %s\n", QByteArray::number(userUnit, 'f').constData()); + + xprintf(">>\n" + "endobj\n"); addXrefEntry(resources); xprintf("<<\n" @@ -2578,6 +2634,8 @@ int QPdfEnginePrivate::addConstantAlphaObject(int brushAlpha, int penAlpha) int QPdfEnginePrivate::addBrushPattern(const QTransform &m, bool *specifyColor, int *gStateObject) { + Q_Q(QPdfEngine); + int paintType = 2; // Uncolored tiling int w = 8; int h = 8; @@ -2607,7 +2665,8 @@ int QPdfEnginePrivate::addBrushPattern(const QTransform &m, bool *specifyColor, return 0; QImage image = brush.textureImage(); bool bitmap = true; - imageObject = addImage(image, &bitmap, image.cacheKey()); + const bool lossless = q->painter()->testRenderHint(QPainter::LosslessImageRendering); + imageObject = addImage(image, &bitmap, lossless, image.cacheKey()); if (imageObject != -1) { QImage::Format f = image.format(); if (f != QImage::Format_MonoLSB && f != QImage::Format_Mono) { @@ -2669,7 +2728,7 @@ static inline bool is_monochrome(const QVector<QRgb> &colorTable) /*! * Adds an image to the pdf and return the pdf-object id. Returns -1 if adding the image failed. */ -int QPdfEnginePrivate::addImage(const QImage &img, bool *bitmap, qint64 serial_no) +int QPdfEnginePrivate::addImage(const QImage &img, bool *bitmap, bool lossless, qint64 serial_no) { if (img.isNull()) return -1; @@ -2730,7 +2789,7 @@ int QPdfEnginePrivate::addImage(const QImage &img, bool *bitmap, qint64 serial_n bool hasAlpha = false; bool hasMask = false; - if (QImageWriter::supportedImageFormats().contains("jpeg") && !grayscale) { + if (QImageWriter::supportedImageFormats().contains("jpeg") && !grayscale && !lossless) { QBuffer buffer(&imageData); QImageWriter writer(&buffer, "jpeg"); writer.setQuality(94); @@ -2977,8 +3036,9 @@ void QPdfEnginePrivate::drawTextItem(const QPointF &p, const QTextItemInt &ti) QTransform QPdfEnginePrivate::pageMatrix() const { - qreal scale = 72./resolution; - QTransform tmp(scale, 0.0, 0.0, -scale, 0.0, m_pageLayout.fullRectPoints().height()); + qreal userUnit = calcUserUnit(); + qreal scale = 72. / userUnit / resolution; + QTransform tmp(scale, 0.0, 0.0, -scale, 0.0, m_pageLayout.fullRectPoints().height() / userUnit); if (m_pageLayout.mode() != QPageLayout::FullPageMode) { QRect r = m_pageLayout.paintRectPixels(resolution); tmp.translate(r.left(), r.top()); diff --git a/src/gui/painting/qpdf_p.h b/src/gui/painting/qpdf_p.h index 5a909f2ede..e337c61f64 100644 --- a/src/gui/painting/qpdf_p.h +++ b/src/gui/painting/qpdf_p.h @@ -171,7 +171,8 @@ public: enum PdfVersion { Version_1_4, - Version_A1b + Version_A1b, + Version_1_6 }; QPdfEngine(); @@ -241,7 +242,7 @@ public: void writeHeader(); void writeTail(); - int addImage(const QImage &image, bool *bitmap, qint64 serial_no); + int addImage(const QImage &image, bool *bitmap, bool lossless, qint64 serial_no); int addConstantAlphaObject(int brushAlpha, int penAlpha = 255); int addBrushPattern(const QTransform &matrix, bool *specifyColor, int *gStateObject); @@ -300,6 +301,7 @@ private: void writePageRoot(); void writeFonts(); void embedFont(QFontSubset *font); + qreal calcUserUnit() const; QVector<int> xrefPositions; QDataStream* stream; diff --git a/src/gui/painting/qpdfwriter.cpp b/src/gui/painting/qpdfwriter.cpp index 5f0fad2a4e..7f18ce42be 100644 --- a/src/gui/painting/qpdfwriter.cpp +++ b/src/gui/painting/qpdfwriter.cpp @@ -170,11 +170,17 @@ void QPdfWriter::setPdfVersion(PdfVersion version) { Q_D(QPdfWriter); + static const QHash<QPdfWriter::PdfVersion, QPdfEngine::PdfVersion> engineMapping { + {QPdfWriter::PdfVersion_1_4, QPdfEngine::Version_1_4}, + {QPdfWriter::PdfVersion_A1b, QPdfEngine::Version_A1b}, + {QPdfWriter::PdfVersion_1_6, QPdfEngine::Version_1_6} + }; + if (d->pdfVersion == version) return; d->pdfVersion = version; - d->engine->setPdfVersion(d->pdfVersion == QPdfWriter::PdfVersion_1_4 ? QPdfEngine::Version_1_4 : QPdfEngine::Version_A1b); + d->engine->setPdfVersion(engineMapping.value(version, QPdfEngine::Version_1_4)); } /*! @@ -373,6 +379,9 @@ int QPdfWriter::resolution() const */ #endif +#if QT_DEPRECATED_SINCE(5, 14) +QT_WARNING_PUSH +QT_WARNING_DISABLE_DEPRECATED /*! \reimp @@ -398,6 +407,8 @@ void QPdfWriter::setPageSizeMM(const QSizeF &size) { setPageSize(QPageSize(size, QPageSize::Millimeter)); } +QT_WARNING_POP +#endif /*! \internal @@ -421,6 +432,9 @@ bool QPdfWriter::newPage() } +#if QT_DEPRECATED_SINCE(5, 14) +QT_WARNING_PUSH +QT_WARNING_DISABLE_DEPRECATED /*! \reimp @@ -432,6 +446,8 @@ void QPdfWriter::setMargins(const Margins &m) { setPageMargins(QMarginsF(m.left, m.top, m.right, m.bottom), QPageLayout::Millimeter); } +QT_WARNING_POP +#endif QT_END_NAMESPACE diff --git a/src/gui/painting/qpdfwriter.h b/src/gui/painting/qpdfwriter.h index b260805b2b..668081e008 100644 --- a/src/gui/painting/qpdfwriter.h +++ b/src/gui/painting/qpdfwriter.h @@ -86,10 +86,14 @@ public: using QPagedPaintDevice::setPageSize; #endif +#if QT_DEPRECATED_SINCE(5, 14) + QT_DEPRECATED_X("Use setPageSize(QPageSize(id)) instead") void setPageSize(PageSize size) override; + QT_DEPRECATED_X("Use setPageSize(QPageSize(size, QPageSize::Millimeter)) instead") void setPageSizeMM(const QSizeF &size) override; - + QT_DEPRECATED_X("Use setPageMargins(QMarginsF(l, t, r, b), QPageLayout::Millimeter) instead") void setMargins(const Margins &m) override; +#endif protected: QPaintEngine *paintEngine() const override; diff --git a/src/gui/painting/qpen.cpp b/src/gui/painting/qpen.cpp index 778c770b82..58a1716037 100644 --- a/src/gui/painting/qpen.cpp +++ b/src/gui/painting/qpen.cpp @@ -322,7 +322,7 @@ QPen::QPen(const QBrush &brush, qreal width, Qt::PenStyle s, Qt::PenCapStyle c, Constructs a pen that is a copy of the given \a pen. */ -QPen::QPen(const QPen &p) Q_DECL_NOTHROW +QPen::QPen(const QPen &p) noexcept { d = p.d; if (d) @@ -381,7 +381,7 @@ void QPen::detach() this pen. */ -QPen &QPen::operator=(const QPen &p) Q_DECL_NOTHROW +QPen &QPen::operator=(const QPen &p) noexcept { QPen(p).swap(*this); return *this; diff --git a/src/gui/painting/qpen.h b/src/gui/painting/qpen.h index 03abfb3d7d..884ec8cdfa 100644 --- a/src/gui/painting/qpen.h +++ b/src/gui/painting/qpen.h @@ -65,18 +65,18 @@ public: QPen(const QColor &color); QPen(const QBrush &brush, qreal width, Qt::PenStyle s = Qt::SolidLine, Qt::PenCapStyle c = Qt::SquareCap, Qt::PenJoinStyle j = Qt::BevelJoin); - QPen(const QPen &pen) Q_DECL_NOTHROW; + QPen(const QPen &pen) noexcept; ~QPen(); - QPen &operator=(const QPen &pen) Q_DECL_NOTHROW; + QPen &operator=(const QPen &pen) noexcept; #ifdef Q_COMPILER_RVALUE_REFS - QPen(QPen &&other) Q_DECL_NOTHROW + QPen(QPen &&other) noexcept : d(other.d) { other.d = nullptr; } - QPen &operator=(QPen &&other) Q_DECL_NOTHROW + QPen &operator=(QPen &&other) noexcept { qSwap(d, other.d); return *this; } #endif - void swap(QPen &other) Q_DECL_NOTHROW { qSwap(d, other.d); } + void swap(QPen &other) noexcept { qSwap(d, other.d); } Qt::PenStyle style() const; void setStyle(Qt::PenStyle); diff --git a/src/gui/painting/qplatformbackingstore.cpp b/src/gui/painting/qplatformbackingstore.cpp index 373722cdb4..c71d82546a 100644 --- a/src/gui/painting/qplatformbackingstore.cpp +++ b/src/gui/painting/qplatformbackingstore.cpp @@ -71,7 +71,7 @@ #define GL_UNSIGNED_INT_2_10_10_10_REV 0x8368 #endif -#ifndef GL_FRAMEBUFFER_SRB +#ifndef GL_FRAMEBUFFER_SRGB #define GL_FRAMEBUFFER_SRGB 0x8DB9 #endif #ifndef GL_FRAMEBUFFER_SRGB_CAPABLE @@ -411,6 +411,7 @@ void QPlatformBackingStore::composeAndFlush(QWindow *window, const QRegion ®i } else if (!region.isEmpty()){ funcs->glBindTexture(GL_TEXTURE_2D, d_ptr->textureId); QPlatformGraphicsBufferHelper::lockAndBindToTexture(graphicsBuffer, &d_ptr->needsSwizzle, &d_ptr->premultiplied); + graphicsBuffer->unlock(); } if (graphicsBuffer->origin() == QPlatformGraphicsBuffer::OriginBottomLeft) @@ -445,6 +446,11 @@ void QPlatformBackingStore::composeAndFlush(QWindow *window, const QRegion ®i d_ptr->blitter->setRedBlueSwizzle(false); } + // There is no way to tell if the OpenGL-rendered content is premultiplied or not. + // For compatibility, assume that it is not, and use normal alpha blend always. + if (d_ptr->premultiplied) + funcs->glBlendFuncSeparate(GL_SRC_ALPHA, GL_ONE_MINUS_SRC_ALPHA, GL_ONE, GL_ONE); + // Textures for renderToTexture widgets that have WA_AlwaysStackOnTop set. for (int i = 0; i < textures->count(); ++i) { if (textures->flags(i).testFlag(QPlatformTextureList::StacksOnTop)) diff --git a/src/gui/painting/qplatformbackingstore.h b/src/gui/painting/qplatformbackingstore.h index de5ba964dc..414d2bf0de 100644 --- a/src/gui/painting/qplatformbackingstore.h +++ b/src/gui/painting/qplatformbackingstore.h @@ -85,7 +85,7 @@ public: }; Q_DECLARE_FLAGS(Flags, Flag) - explicit QPlatformTextureList(QObject *parent = 0); + explicit QPlatformTextureList(QObject *parent = nullptr); ~QPlatformTextureList(); int count() const; @@ -99,7 +99,7 @@ public: bool isLocked() const; void appendTexture(void *source, GLuint textureId, const QRect &geometry, - const QRect &clipRect = QRect(), Flags flags = 0); + const QRect &clipRect = QRect(), Flags flags = nullptr); void clear(); Q_SIGNALS: diff --git a/src/gui/painting/qpolygon.h b/src/gui/painting/qpolygon.h index 8e74a499fd..118861c0f2 100644 --- a/src/gui/painting/qpolygon.h +++ b/src/gui/painting/qpolygon.h @@ -61,17 +61,17 @@ public: inline explicit QPolygon(int size); inline /*implicit*/ QPolygon(const QVector<QPoint> &v) : QVector<QPoint>(v) {} #ifdef Q_COMPILER_RVALUE_REFS - /*implicit*/ QPolygon(QVector<QPoint> &&v) Q_DECL_NOTHROW : QVector<QPoint>(std::move(v)) {} + /*implicit*/ QPolygon(QVector<QPoint> &&v) noexcept : QVector<QPoint>(std::move(v)) {} #endif QPolygon(const QRect &r, bool closed=false); QPolygon(int nPoints, const int *points); QPolygon(const QPolygon &other) : QVector<QPoint>(other) {} #ifdef Q_COMPILER_RVALUE_REFS - QPolygon(QPolygon &&other) Q_DECL_NOTHROW : QVector<QPoint>(std::move(other)) {} - QPolygon &operator=(QPolygon &&other) Q_DECL_NOTHROW { swap(other); return *this; } + QPolygon(QPolygon &&other) noexcept : QVector<QPoint>(std::move(other)) {} + QPolygon &operator=(QPolygon &&other) noexcept { swap(other); return *this; } #endif QPolygon &operator=(const QPolygon &other) { QVector<QPoint>::operator=(other); return *this; } - void swap(QPolygon &other) Q_DECL_NOTHROW { QVector<QPoint>::swap(other); } // prevent QVector<QPoint><->QPolygon swaps + void swap(QPolygon &other) noexcept { QVector<QPoint>::swap(other); } // prevent QVector<QPoint><->QPolygon swaps operator QVariant() const; @@ -146,14 +146,14 @@ public: inline explicit QPolygonF(int size); inline /*implicit*/ QPolygonF(const QVector<QPointF> &v) : QVector<QPointF>(v) {} #ifdef Q_COMPILER_RVALUE_REFS - /* implicit */ QPolygonF(QVector<QPointF> &&v) Q_DECL_NOTHROW : QVector<QPointF>(std::move(v)) {} + /* implicit */ QPolygonF(QVector<QPointF> &&v) noexcept : QVector<QPointF>(std::move(v)) {} #endif QPolygonF(const QRectF &r); /*implicit*/ QPolygonF(const QPolygon &a); inline QPolygonF(const QPolygonF &a) : QVector<QPointF>(a) {} #ifdef Q_COMPILER_RVALUE_REFS - QPolygonF(QPolygonF &&other) Q_DECL_NOTHROW : QVector<QPointF>(std::move(other)) {} - QPolygonF &operator=(QPolygonF &&other) Q_DECL_NOTHROW { swap(other); return *this; } + QPolygonF(QPolygonF &&other) noexcept : QVector<QPointF>(std::move(other)) {} + QPolygonF &operator=(QPolygonF &&other) noexcept { swap(other); return *this; } #endif QPolygonF &operator=(const QPolygonF &other) { QVector<QPointF>::operator=(other); return *this; } inline void swap(QPolygonF &other) { QVector<QPointF>::swap(other); } // prevent QVector<QPointF><->QPolygonF swaps diff --git a/src/gui/painting/qrasterizer.cpp b/src/gui/painting/qrasterizer.cpp index 52501880e4..b4014272f4 100644 --- a/src/gui/painting/qrasterizer.cpp +++ b/src/gui/painting/qrasterizer.cpp @@ -755,11 +755,9 @@ static inline int qSafeFloatToQ16Dot16(qreal x) void QRasterizer::rasterizeLine(const QPointF &a, const QPointF &b, qreal width, bool squareCap) { - if (a == b || width == 0 || d->clipRect.isEmpty()) + if (a == b || !(width > 0.0) || d->clipRect.isEmpty()) return; - Q_ASSERT(width > 0.0); - QPointF pa = a; QPointF pb = b; diff --git a/src/gui/painting/qrbtree_p.h b/src/gui/painting/qrbtree_p.h index d3ee23a91c..42e88889a1 100644 --- a/src/gui/painting/qrbtree_p.h +++ b/src/gui/painting/qrbtree_p.h @@ -60,7 +60,7 @@ struct QRBTree { struct Node { - inline Node() : parent(0), left(0), right(0), red(true) { } + inline Node() : parent(nullptr), left(nullptr), right(nullptr), red(true) { } inline ~Node() {if (left) delete left; if (right) delete right;} T data; Node *parent; @@ -69,7 +69,7 @@ struct QRBTree bool red; }; - inline QRBTree() : root(0), freeList(0) { } + inline QRBTree() : root(nullptr), freeList(nullptr) { } inline ~QRBTree(); inline void clear(); @@ -120,7 +120,7 @@ inline QRBTree<T>::~QRBTree() while (freeList) { // Avoid recursively calling the destructor, as this list may become large. Node *next = freeList->right; - freeList->right = 0; + freeList->right = nullptr; delete freeList; freeList = next; } @@ -131,7 +131,7 @@ inline void QRBTree<T>::clear() { if (root) delete root; - root = 0; + root = nullptr; } template <class T> @@ -359,7 +359,7 @@ void QRBTree<T>::detach(Node *node) // call this before removing a node. ref = child; if (child) child->parent = node->parent; - node->left = node->right = node->parent = 0; + node->left = node->right = node->parent = nullptr; } // 'node' must be black. rebalance will reduce the depth of black nodes by one in the sibling tree. @@ -513,7 +513,7 @@ inline void QRBTree<T>::deleteNode(Node *&node) detach(node); node->right = freeList; freeList = node; - node = 0; + node = nullptr; } template <class T> @@ -522,7 +522,7 @@ inline typename QRBTree<T>::Node *QRBTree<T>::newNode() if (freeList) { Node *node = freeList; freeList = freeList->right; - node->parent = node->left = node->right = 0; + node->parent = node->left = node->right = nullptr; node->red = true; return node; } diff --git a/src/gui/painting/qregion.cpp b/src/gui/painting/qregion.cpp index 77718ce747..51eed962f0 100644 --- a/src/gui/painting/qregion.cpp +++ b/src/gui/painting/qregion.cpp @@ -1287,10 +1287,10 @@ struct QRegionPrivate { } } - const QRect *begin() const Q_DECL_NOTHROW + const QRect *begin() const noexcept { return numRects == 1 ? &extents : rects.data(); } // avoid vectorize() - const QRect *end() const Q_DECL_NOTHROW + const QRect *end() const noexcept { return begin() + numRects; } inline void append(const QRect *r); @@ -4321,7 +4321,7 @@ QRegion QRegion::xored(const QRegion &r) const } } -QRect QRegion::boundingRect() const Q_DECL_NOTHROW +QRect QRegion::boundingRect() const noexcept { if (isEmpty()) return QRect(); @@ -4379,12 +4379,12 @@ QVector<QRect> QRegion::rects() const } #endif -QRegion::const_iterator QRegion::begin() const Q_DECL_NOTHROW +QRegion::const_iterator QRegion::begin() const noexcept { return d->qt_rgn ? d->qt_rgn->begin() : nullptr; } -QRegion::const_iterator QRegion::end() const Q_DECL_NOTHROW +QRegion::const_iterator QRegion::end() const noexcept { return d->qt_rgn ? d->qt_rgn->end() : nullptr; } @@ -4421,7 +4421,7 @@ void QRegion::setRects(const QRect *rects, int num) } } -int QRegion::rectCount() const Q_DECL_NOTHROW +int QRegion::rectCount() const noexcept { return (d->qt_rgn ? d->qt_rgn->numRects : 0); } diff --git a/src/gui/painting/qregion.h b/src/gui/painting/qregion.h index 9fe6ed5675..9b6b25d743 100644 --- a/src/gui/painting/qregion.h +++ b/src/gui/painting/qregion.h @@ -69,30 +69,30 @@ public: QRegion(const QRect &r, RegionType t = Rectangle); QRegion(const QPolygon &pa, Qt::FillRule fillRule = Qt::OddEvenFill); QRegion(const QRegion ®ion); - QRegion(QRegion &&other) Q_DECL_NOTHROW + QRegion(QRegion &&other) noexcept : d(other.d) { other.d = const_cast<QRegionData*>(&shared_empty); } QRegion(const QBitmap &bitmap); ~QRegion(); QRegion &operator=(const QRegion &); #ifdef Q_COMPILER_RVALUE_REFS - inline QRegion &operator=(QRegion &&other) Q_DECL_NOEXCEPT + inline QRegion &operator=(QRegion &&other) noexcept { qSwap(d, other.d); return *this; } #endif - inline void swap(QRegion &other) Q_DECL_NOEXCEPT { qSwap(d, other.d); } + inline void swap(QRegion &other) noexcept { qSwap(d, other.d); } bool isEmpty() const; bool isNull() const; typedef const QRect *const_iterator; typedef std::reverse_iterator<const_iterator> const_reverse_iterator; - const_iterator begin() const Q_DECL_NOTHROW; - const_iterator cbegin() const Q_DECL_NOTHROW { return begin(); } - const_iterator end() const Q_DECL_NOTHROW; - const_iterator cend() const Q_DECL_NOTHROW { return end(); } - const_reverse_iterator rbegin() const Q_DECL_NOTHROW { return const_reverse_iterator(end()); } - const_reverse_iterator crbegin() const Q_DECL_NOTHROW { return rbegin(); } - const_reverse_iterator rend() const Q_DECL_NOTHROW { return const_reverse_iterator(begin()); } - const_reverse_iterator crend() const Q_DECL_NOTHROW { return rend(); } + const_iterator begin() const noexcept; + const_iterator cbegin() const noexcept { return begin(); } + const_iterator end() const noexcept; + const_iterator cend() const noexcept { return end(); } + const_reverse_iterator rbegin() const noexcept { return const_reverse_iterator(end()); } + const_reverse_iterator crbegin() const noexcept { return rbegin(); } + const_reverse_iterator rend() const noexcept { return const_reverse_iterator(begin()); } + const_reverse_iterator crend() const noexcept { return rend(); } bool contains(const QPoint &p) const; bool contains(const QRect &r) const; @@ -121,13 +121,13 @@ public: bool intersects(const QRegion &r) const; bool intersects(const QRect &r) const; - QRect boundingRect() const Q_DECL_NOTHROW; + QRect boundingRect() const noexcept; #if QT_DEPRECATED_SINCE(5, 11) QT_DEPRECATED_X("Use begin()/end() instead") QVector<QRect> rects() const; #endif void setRects(const QRect *rect, int num); - int rectCount() const Q_DECL_NOTHROW; + int rectCount() const noexcept; #ifdef Q_COMPILER_MANGLES_RETURN_TYPE // ### Qt 6: remove these, they're kept for MSVC compat const QRegion operator|(const QRegion &r) const; diff --git a/src/gui/painting/qrgba64.h b/src/gui/painting/qrgba64.h index 0e5344cacb..0e0b567890 100644 --- a/src/gui/painting/qrgba64.h +++ b/src/gui/painting/qrgba64.h @@ -118,7 +118,27 @@ public: Q_DECL_CONSTEXPR quint8 alpha8() const { return div_257(alpha()); } Q_DECL_CONSTEXPR uint toArgb32() const { +#if defined(__cpp_constexpr) && __cpp_constexpr-0 >= 201304 + quint64 br = rgba & Q_UINT64_C(0xffff0000ffff); + quint64 ag = (rgba >> 16) & Q_UINT64_C(0xffff0000ffff); + br += Q_UINT64_C(0x8000000080); + ag += Q_UINT64_C(0x8000000080); + br = (br - ((br >> 8) & Q_UINT64_C(0xffff0000ffff))) >> 8; + ag = (ag - ((ag >> 8) & Q_UINT64_C(0xffff0000ffff))); +#if Q_BYTE_ORDER == Q_BIG_ENDIAN + return ((br << 24) & 0xff000000) + | ((ag >> 24) & 0xff0000) + | ((br >> 24) & 0xff00) + | ((ag >> 8) & 0xff); +#else + return ((ag >> 16) & 0xff000000) + | ((br << 16) & 0xff0000) + | (ag & 0xff00) + | ((br >> 32) & 0xff); +#endif +#else return uint((alpha8() << 24) | (red8() << 16) | (green8() << 8) | blue8()); +#endif } Q_DECL_CONSTEXPR ushort toRgb16() const { @@ -131,11 +151,20 @@ public: return *this; if (isTransparent()) return QRgba64::fromRgba64(0); - const quint32 a = alpha(); - const quint16 r = div_65535(red() * a); - const quint16 g = div_65535(green() * a); - const quint16 b = div_65535(blue() * a); - return fromRgba64(r, g, b, quint16(a)); + const quint64 a = alpha(); + quint64 br = (rgba & Q_UINT64_C(0xffff0000ffff)) * a; + quint64 ag = ((rgba >> 16) & Q_UINT64_C(0xffff0000ffff)) * a; + br = (br + ((br >> 16) & Q_UINT64_C(0xffff0000ffff)) + Q_UINT64_C(0x800000008000)); + ag = (ag + ((ag >> 16) & Q_UINT64_C(0xffff0000ffff)) + Q_UINT64_C(0x800000008000)); +#if Q_BYTE_ORDER == Q_BIG_ENDIAN + ag = ag & Q_UINT64_C(0xffff0000ffff0000); + br = (br >> 16) & Q_UINT64_C(0xffff00000000); + return fromRgba64(a | br | ag); +#else + br = (br >> 16) & Q_UINT64_C(0xffff0000ffff); + ag = ag & Q_UINT64_C(0xffff0000); + return fromRgba64((a << 48) | br | ag); +#endif } Q_DECL_RELAXED_CONSTEXPR QRgba64 unpremultiplied() const @@ -163,7 +192,6 @@ private: static Q_DECL_CONSTEXPR Q_ALWAYS_INLINE quint8 div_257_floor(uint x) { return quint8((x - (x >> 8)) >> 8); } static Q_DECL_CONSTEXPR Q_ALWAYS_INLINE quint8 div_257(quint16 x) { return div_257_floor(x + 128U); } - static Q_DECL_CONSTEXPR Q_ALWAYS_INLINE quint16 div_65535(uint x) { return quint16((x + (x>>16) + 0x8000U) >> 16); } Q_DECL_RELAXED_CONSTEXPR Q_ALWAYS_INLINE QRgba64 unpremultiplied_32bit() const { if (isOpaque() || isTransparent()) diff --git a/src/gui/painting/qrgba64.qdoc b/src/gui/painting/qrgba64.qdoc index 26c78a5dcd..3ee8a355e6 100644 --- a/src/gui/painting/qrgba64.qdoc +++ b/src/gui/painting/qrgba64.qdoc @@ -35,7 +35,7 @@ QRgba64 is a 64-bit data-structure containing four 16-bit color channels: Red, green, blue and alpha. - QRgba64 can be used a replacement for QRgb when higher precision is needed. In particular a + QRgba64 can be used as a replacement for QRgb when higher precision is needed. In particular a premultiplied QRgba64 can operate on unpremultiplied QRgb without loss of precision except for alpha 0. diff --git a/src/gui/painting/qrgba64_p.h b/src/gui/painting/qrgba64_p.h index b7e4d4d905..ca879de27c 100644 --- a/src/gui/painting/qrgba64_p.h +++ b/src/gui/painting/qrgba64_p.h @@ -266,10 +266,10 @@ inline QRgba64 rgbBlend(QRgba64 d, QRgba64 s, uint rgbAlpha) const int mr = qRed(rgbAlpha); const int mg = qGreen(rgbAlpha); const int mb = qBlue(rgbAlpha); - blend.setRed (qt_div_255(s.red() * mr + d.red() * (255 - mr))); - blend.setGreen(qt_div_255(s.green() * mg + d.green() * (255 - mg))); - blend.setBlue (qt_div_255(s.blue() * mb + d.blue() * (255 - mb))); - blend.setAlpha(s.alpha()); + blend = qRgba64(qt_div_255(s.red() * mr + d.red() * (255 - mr)), + qt_div_255(s.green() * mg + d.green() * (255 - mg)), + qt_div_255(s.blue() * mb + d.blue() * (255 - mb)), + s.alpha()); #endif return blend; } diff --git a/src/gui/painting/qstroker.cpp b/src/gui/painting/qstroker.cpp index 4776545be6..f8f8d72d14 100644 --- a/src/gui/painting/qstroker.cpp +++ b/src/gui/painting/qstroker.cpp @@ -173,15 +173,12 @@ template <class Iterator> bool qt_stroke_side(Iterator *it, QStroker *stroker, bool capFirst, QLineF *startTangent); /******************************************************************************* - * QLineF::angle gives us the smalles angle between two lines. Here we - * want to identify the line's angle direction on the unit circle. + * QLineF::angleTo gives us the angle between two lines with respecting the direction. + * Here we want to identify the line's angle direction on the unit circle. */ static inline qreal adapted_angle_on_x(const QLineF &line) { - qreal angle = line.angle(QLineF(0, 0, 1, 0)); - if (line.dy() > 0) - angle = 360 - angle; - return angle; + return QLineF(0, 0, 1, 0).angleTo(line); } QStrokerOps::QStrokerOps() @@ -369,7 +366,8 @@ void QStrokerOps::strokeEllipse(const QRectF &rect, void *data, const QTransform QStroker::QStroker() : m_capStyle(SquareJoin), m_joinStyle(FlatJoin), m_back1X(0), m_back1Y(0), - m_back2X(0), m_back2Y(0) + m_back2X(0), m_back2Y(0), + m_forceOpen(false) { m_strokeWidth = qt_real_to_fixed(1); m_miterLimit = qt_real_to_fixed(2); @@ -455,12 +453,12 @@ void QStroker::joinPoints(qfixed focal_x, qfixed focal_y, const QLineF &nextLine return; } #endif + QLineF prevLine(qt_fixed_to_real(m_back2X), qt_fixed_to_real(m_back2Y), + qt_fixed_to_real(m_back1X), qt_fixed_to_real(m_back1Y)); + QPointF isect; + QLineF::IntersectType type = prevLine.intersect(nextLine, &isect); if (join == FlatJoin) { - QLineF prevLine(qt_fixed_to_real(m_back2X), qt_fixed_to_real(m_back2Y), - qt_fixed_to_real(m_back1X), qt_fixed_to_real(m_back1Y)); - QPointF isect; - QLineF::IntersectType type = prevLine.intersect(nextLine, &isect); QLineF shortCut(prevLine.p2(), nextLine.p1()); qreal angle = shortCut.angleTo(prevLine); if (type == QLineF::BoundedIntersection || (angle > 90 && !qFuzzyCompare(angle, (qreal)90))) { @@ -472,12 +470,6 @@ void QStroker::joinPoints(qfixed focal_x, qfixed focal_y, const QLineF &nextLine qt_real_to_fixed(nextLine.y1())); } else { - QLineF prevLine(qt_fixed_to_real(m_back2X), qt_fixed_to_real(m_back2Y), - qt_fixed_to_real(m_back1X), qt_fixed_to_real(m_back1Y)); - - QPointF isect; - QLineF::IntersectType type = prevLine.intersect(nextLine, &isect); - if (join == MiterJoin) { qreal appliedMiterLimit = qt_fixed_to_real(m_strokeWidth * m_miterLimit); @@ -512,7 +504,11 @@ void QStroker::joinPoints(qfixed focal_x, qfixed focal_y, const QLineF &nextLine qfixed offset = m_strokeWidth / 2; QLineF l1(prevLine); - l1.translate(l1.dx(), l1.dy()); + qreal dp = QPointF::dotProduct(QPointF(prevLine.dx(), prevLine.dy()), QPointF(nextLine.dx(), nextLine.dy())); + if (dp > 0) // same direction, means that prevLine is from a bezier that has been "reversed" by shifting + l1 = QLineF(prevLine.p2(), prevLine.p1()); + else + l1.translate(l1.dx(), l1.dy()); l1.setLength(qt_fixed_to_real(offset)); QLineF l2(nextLine.p2(), nextLine.p1()); l2.translate(l2.dx(), l2.dy()); @@ -570,7 +566,11 @@ void QStroker::joinPoints(qfixed focal_x, qfixed focal_y, const QLineF &nextLine // first control line QLineF l1 = prevLine; - l1.translate(l1.dx(), l1.dy()); + qreal dp = QPointF::dotProduct(QPointF(prevLine.dx(), prevLine.dy()), QPointF(nextLine.dx(), nextLine.dy())); + if (dp > 0) // same direction, means that prevLine is from a bezier that has been "reversed" by shifting + l1 = QLineF(prevLine.p2(), prevLine.p1()); + else + l1.translate(l1.dx(), l1.dy()); l1.setLength(QT_PATH_KAPPA * offset); // second control line, find through normal between prevLine and focal. @@ -705,7 +705,6 @@ template <class Iterator> bool qt_stroke_side(Iterator *it, QPointF(qt_fixed_to_real(e.x), qt_fixed_to_real(e.y)), QPointF(qt_fixed_to_real(cp2.x), qt_fixed_to_real(cp2.y)), QPointF(qt_fixed_to_real(ep.x), qt_fixed_to_real(ep.y))); - int count = bezier.shifted(offsetCurves, MAX_OFFSET, offset, @@ -748,7 +747,7 @@ template <class Iterator> bool qt_stroke_side(Iterator *it, } } - if (start == prev) { + if (start == prev && !stroker->forceOpen()) { // closed subpath, join first and last point #ifdef QPP_STROKE_DEBUG qDebug("\n ---> (side) closed subpath"); diff --git a/src/gui/painting/qstroker_p.h b/src/gui/painting/qstroker_p.h index 1a7c184e1a..722a0904f3 100644 --- a/src/gui/painting/qstroker_p.h +++ b/src/gui/painting/qstroker_p.h @@ -222,6 +222,9 @@ public: void setMiterLimit(qfixed length) { m_miterLimit = length; } qfixed miterLimit() const { return m_miterLimit; } + void setForceOpen(bool state) { m_forceOpen = state; } + bool forceOpen() { return m_forceOpen; } + void joinPoints(qfixed x, qfixed y, const QLineF &nextLine, LineJoinMode join); inline void emitMoveTo(qfixed x, qfixed y); inline void emitLineTo(qfixed x, qfixed y); @@ -247,6 +250,8 @@ protected: qfixed m_back2X; qfixed m_back2Y; + + bool m_forceOpen; }; class Q_GUI_EXPORT QDashStroker : public QStrokerOps diff --git a/src/gui/painting/qtextureglyphcache.cpp b/src/gui/painting/qtextureglyphcache.cpp index 2a7e0eaa0c..c21f2cdda4 100644 --- a/src/gui/painting/qtextureglyphcache.cpp +++ b/src/gui/painting/qtextureglyphcache.cpp @@ -73,7 +73,7 @@ int QTextureGlyphCache::calculateSubPixelPositionCount(glyph_t glyph) const if (path.isEmpty()) break; - images[numImages++] = qMove(img); + images[numImages++] = std::move(img); } else { bool found = false; for (int j = 0; j < numImages; ++j) { @@ -83,7 +83,7 @@ int QTextureGlyphCache::calculateSubPixelPositionCount(glyph_t glyph) const } } if (!found) - images[numImages++] = qMove(img); + images[numImages++] = std::move(img); } } @@ -335,7 +335,7 @@ void QImageTextureGlyphCache::fillTexture(const Coord &c, glyph_t g, QFixed subP // TODO optimize this mask = mask.alphaChannel(); mask.invertPixels(); - mask = mask.convertToFormat(QImage::Format_Mono); + mask = mask.convertToFormat(QImage::Format_Mono, Qt::ThresholdDither); } int mw = qMin(mask.width(), c.w); diff --git a/src/gui/painting/qtextureglyphcache_p.h b/src/gui/painting/qtextureglyphcache_p.h index 3da28872b1..1e83ab46d1 100644 --- a/src/gui/painting/qtextureglyphcache_p.h +++ b/src/gui/painting/qtextureglyphcache_p.h @@ -75,7 +75,7 @@ class Q_GUI_EXPORT QTextureGlyphCache : public QFontEngineGlyphCache { public: QTextureGlyphCache(QFontEngine::GlyphFormat format, const QTransform &matrix) - : QFontEngineGlyphCache(format, matrix), m_current_fontengine(0), + : QFontEngineGlyphCache(format, matrix), m_current_fontengine(nullptr), m_w(0), m_h(0), m_cx(0), m_cy(0), m_currentRowHeight(0) { } diff --git a/src/gui/painting/qtransform.cpp b/src/gui/painting/qtransform.cpp index 040d33fc2a..6110a548fd 100644 --- a/src/gui/painting/qtransform.cpp +++ b/src/gui/painting/qtransform.cpp @@ -795,7 +795,7 @@ bool QTransform::operator==(const QTransform &o) const Returns the hash value for \a key, using \a seed to seed the calculation. */ -uint qHash(const QTransform &key, uint seed) Q_DECL_NOTHROW +uint qHash(const QTransform &key, uint seed) noexcept { QtPrivate::QHashCombine hash; seed = hash(seed, key.m11()); @@ -1021,7 +1021,7 @@ QTransform QTransform::operator*(const QTransform &m) const /*! Assigns the given \a matrix's values to this matrix. */ -QTransform & QTransform::operator=(const QTransform &matrix) Q_DECL_NOTHROW +QTransform & QTransform::operator=(const QTransform &matrix) noexcept { affine._m11 = matrix.affine._m11; affine._m12 = matrix.affine._m12; @@ -1517,8 +1517,23 @@ QRegion QTransform::map(const QRegion &r) const return copy; } - if (t == TxScale && r.rectCount() == 1) - return QRegion(mapRect(r.boundingRect())); + if (t == TxScale) { + QRegion res; + if (m11() < 0 || m22() < 0) { + for (const QRect &rect : r) + res += mapRect(rect); + } else { + QVarLengthArray<QRect, 32> rects; + rects.reserve(r.rectCount()); + for (const QRect &rect : r) { + QRect nr = mapRect(rect); + if (!nr.isEmpty()) + rects.append(nr); + } + res.setRects(rects.constData(), rects.count()); + } + return res; + } QPainterPath p = map(qt_regionToPath(r)); return p.toFillPolygon(QTransform()).toPolygon(); @@ -2144,13 +2159,14 @@ QTransform::operator QVariant() const \sa inverted() */ +#if QT_DEPRECATED_SINCE(5, 13) /*! \fn qreal QTransform::det() const \obsolete Returns the matrix's determinant. Use determinant() instead. */ - +#endif /*! \fn qreal QTransform::m11() const diff --git a/src/gui/painting/qtransform.h b/src/gui/painting/qtransform.h index 63c4a241c1..18c53f4a6f 100644 --- a/src/gui/painting/qtransform.h +++ b/src/gui/painting/qtransform.h @@ -77,13 +77,13 @@ public: #if QT_VERSION < QT_VERSION_CHECK(6, 0, 0) // ### Qt 6: remove; the compiler-generated ones are fine! - QTransform &operator=(QTransform &&other) Q_DECL_NOTHROW // = default + QTransform &operator=(QTransform &&other) noexcept // = default { memcpy(static_cast<void *>(this), static_cast<void *>(&other), sizeof(QTransform)); return *this; } - QTransform &operator=(const QTransform &) Q_DECL_NOTHROW; // = default - QTransform(QTransform &&other) Q_DECL_NOTHROW // = default + QTransform &operator=(const QTransform &) noexcept; // = default + QTransform(QTransform &&other) noexcept // = default : affine(Qt::Uninitialized) { memcpy(static_cast<void *>(this), static_cast<void *>(&other), sizeof(QTransform)); } - QTransform(const QTransform &other) Q_DECL_NOTHROW // = default + QTransform(const QTransform &other) noexcept // = default : affine(Qt::Uninitialized) { memcpy(static_cast<void *>(this), static_cast<const void *>(&other), sizeof(QTransform)); } #endif @@ -98,7 +98,10 @@ public: TransformationType type() const; inline qreal determinant() const; +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use determinant() instead") qreal det() const; +#endif qreal m11() const; qreal m12() const; @@ -199,7 +202,7 @@ private: }; Q_DECLARE_TYPEINFO(QTransform, Q_MOVABLE_TYPE); -Q_GUI_EXPORT Q_DECL_CONST_FUNCTION uint qHash(const QTransform &key, uint seed = 0) Q_DECL_NOTHROW; +Q_GUI_EXPORT Q_DECL_CONST_FUNCTION uint qHash(const QTransform &key, uint seed = 0) noexcept; /******* inlines *****/ inline QTransform::TransformationType QTransform::inline_type() const @@ -242,10 +245,12 @@ inline qreal QTransform::determinant() const return affine._m11*(m_33*affine._m22-affine._dy*m_23) - affine._m21*(m_33*affine._m12-affine._dy*m_13)+affine._dx*(m_23*affine._m12-affine._m22*m_13); } +#if QT_DEPRECATED_SINCE(5, 13) inline qreal QTransform::det() const { return determinant(); } +#endif inline qreal QTransform::m11() const { return affine._m11; diff --git a/src/gui/painting/qtriangulator.cpp b/src/gui/painting/qtriangulator.cpp index 6d57eba123..9be3eeaffd 100644 --- a/src/gui/painting/qtriangulator.cpp +++ b/src/gui/painting/qtriangulator.cpp @@ -472,7 +472,7 @@ class QInt64Set { public: inline QInt64Set(int capacity = 64); - inline ~QInt64Set() {if (m_array) delete[] m_array;} + inline ~QInt64Set() {delete[] m_array;} inline bool isValid() const {return m_array;} void insert(quint64 key); bool contains(quint64 key) const; @@ -493,10 +493,7 @@ inline QInt64Set::QInt64Set(int capacity) { m_capacity = primeForCount(capacity); m_array = new quint64[m_capacity]; - if (m_array) - clear(); - else - m_capacity = 0; + clear(); } bool QInt64Set::rehash(int capacity) @@ -506,28 +503,19 @@ bool QInt64Set::rehash(int capacity) m_capacity = capacity; m_array = new quint64[m_capacity]; - if (m_array) { - clear(); - if (oldArray) { - for (int i = 0; i < oldCapacity; ++i) { - if (oldArray[i] != UNUSED) - insert(oldArray[i]); - } - delete[] oldArray; - } - return true; - } else { - m_capacity = oldCapacity; - m_array = oldArray; - return false; + clear(); + for (int i = 0; i < oldCapacity; ++i) { + if (oldArray[i] != UNUSED) + insert(oldArray[i]); } + delete[] oldArray; + return true; } void QInt64Set::insert(quint64 key) { if (m_count > 3 * m_capacity / 4) rehash(primeForCount(2 * m_capacity)); - Q_ASSERT_X(m_array, "QInt64Hash<T>::insert", "Hash set not allocated."); int index = int(key % m_capacity); for (int i = 0; i < m_capacity; ++i) { index += i; @@ -546,7 +534,6 @@ void QInt64Set::insert(quint64 key) bool QInt64Set::contains(quint64 key) const { - Q_ASSERT_X(m_array, "QInt64Hash<T>::contains", "Hash set not allocated."); int index = int(key % m_capacity); for (int i = 0; i < m_capacity; ++i) { index += i; @@ -562,7 +549,6 @@ bool QInt64Set::contains(quint64 key) const inline void QInt64Set::clear() { - Q_ASSERT_X(m_array, "QInt64Hash<T>::clear", "Hash set not allocated."); for (int i = 0; i < m_capacity; ++i) m_array[i] = UNUSED; m_count = 0; diff --git a/src/gui/painting/qvectorpath_p.h b/src/gui/painting/qvectorpath_p.h index d1b08ed423..df5772d4cc 100644 --- a/src/gui/painting/qvectorpath_p.h +++ b/src/gui/painting/qvectorpath_p.h @@ -99,13 +99,14 @@ public: // Shape rendering specifiers... OddEvenFill = 0x1000, WindingFill = 0x2000, - ImplicitClose = 0x4000 + ImplicitClose = 0x4000, + ExplicitOpen = 0x8000 }; // ### Falcon: introduca a struct XY for points so lars is not so confused... QVectorPath(const qreal *points, int count, - const QPainterPath::ElementType *elements = 0, + const QPainterPath::ElementType *elements = nullptr, uint hints = ArbitraryShapeHint) : m_elements(elements), m_points(points), @@ -124,14 +125,15 @@ public: inline bool isCacheable() const { return m_hints & ShouldUseCacheHint; } inline bool hasImplicitClose() const { return m_hints & ImplicitClose; } + inline bool hasExplicitOpen() const { return m_hints & ExplicitOpen; } inline bool hasWindingFill() const { return m_hints & WindingFill; } - inline void makeCacheable() const { m_hints |= ShouldUseCacheHint; m_cache = 0; } + inline void makeCacheable() const { m_hints |= ShouldUseCacheHint; m_cache = nullptr; } inline uint hints() const { return m_hints; } inline const QPainterPath::ElementType *elements() const { return m_elements; } inline const qreal *points() const { return m_points; } - inline bool isEmpty() const { return m_points == 0; } + inline bool isEmpty() const { return m_points == nullptr; } inline int elementCount() const { return m_count; } inline const QPainterPath convertToPainterPath() const; @@ -142,7 +144,7 @@ public: case QPaintEngine::ConvexMode: return ConvexPolygonHint | ImplicitClose; case QPaintEngine::OddEvenMode: return PolygonHint | OddEvenFill | ImplicitClose; case QPaintEngine::WindingMode: return PolygonHint | WindingFill | ImplicitClose; - case QPaintEngine::PolylineMode: return PolygonHint; + case QPaintEngine::PolylineMode: return PolygonHint | ExplicitOpen; default: return 0; } } @@ -163,7 +165,7 @@ public: return e; e = e->next; } - return 0; + return nullptr; } template <typename T> static inline bool isRect(const T *pts, int elementCount) { @@ -194,7 +196,7 @@ public: private: - Q_DISABLE_COPY(QVectorPath) + Q_DISABLE_COPY_MOVE(QVectorPath) const QPainterPath::ElementType *m_elements; const qreal *m_points; diff --git a/src/gui/platform/platform.pri b/src/gui/platform/platform.pri new file mode 100644 index 0000000000..1fe2db81b0 --- /dev/null +++ b/src/gui/platform/platform.pri @@ -0,0 +1 @@ +wasm:include(wasm/wasm.pri) diff --git a/src/gui/platform/wasm/qwasmlocalfileaccess.cpp b/src/gui/platform/wasm/qwasmlocalfileaccess.cpp new file mode 100644 index 0000000000..83f9415c69 --- /dev/null +++ b/src/gui/platform/wasm/qwasmlocalfileaccess.cpp @@ -0,0 +1,169 @@ +/**************************************************************************** +** +** Copyright (C) 2016 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#include "qwasmlocalfileaccess_p.h" +#include <private/qstdweb_p.h> +#include <emscripten.h> +#include <emscripten/bind.h> +#include <emscripten/html5.h> +#include <emscripten/val.h> + +QT_BEGIN_NAMESPACE + +namespace QWasmLocalFileAccess { + +void streamFile(const qstdweb::File &file, uint32_t offset, uint32_t length, char *buffer, const std::function<void ()> &completed) +{ + // Read file in chunks in order to avoid holding two copies in memory at the same time + const uint32_t chunkSize = 256 * 1024; + const uint32_t end = offset + length; + // assert end < file.size + auto fileReader = std::make_shared<qstdweb::FileReader>(); + + auto chunkCompleted = std::make_shared<std::function<void (uint32_t, char *buffer)>>(); + *chunkCompleted = [=](uint32_t chunkBegin, char *chunkBuffer) mutable { + + // Copy current chunk from JS memory to Wasm memory + qstdweb::ArrayBuffer result = fileReader->result(); + qstdweb::Uint8Array(result).copyTo(chunkBuffer); + + // Read next chunk if not at buffer end + uint32_t nextChunkBegin = std::min(chunkBegin + result.byteLength(), end); + uint32_t nextChunkEnd = std::min(nextChunkBegin + chunkSize, end); + if (nextChunkBegin == end) { + completed(); + chunkCompleted.reset(); + return; + } + char *nextChunkBuffer = chunkBuffer + result.byteLength(); + fileReader->onLoad([=]() { (*chunkCompleted)(nextChunkBegin, nextChunkBuffer); }); + qstdweb::Blob blob = file.slice(nextChunkBegin, nextChunkEnd); + fileReader->readAsArrayBuffer(blob); + }; + + // Read first chunk. First iteration is a dummy iteration with no available data. + (*chunkCompleted)(offset, buffer); +} + +void streamFile(const qstdweb::File &file, char *buffer, const std::function<void ()> &completed) +{ + streamFile(file, 0, file.size(), buffer, completed); +} + +void readFiles(const qstdweb::FileList &fileList, + const std::function<char *(uint64_t size, const std::string name)> &acceptFile, + const std::function<void ()> &fileDataReady) +{ + auto readFile = std::make_shared<std::function<void(int)>>(); + + *readFile = [=](int fileIndex) mutable { + // Stop when all files have been processed + if (fileIndex >= fileList.length()) { + readFile.reset(); + return; + } + + const qstdweb::File file = fileList[fileIndex]; + + // Ask caller if the file should be accepted + char *buffer = acceptFile(file.size(), file.name()); + if (buffer == nullptr) { + (*readFile)(fileIndex + 1); + return; + } + + // Read file data into caller-provided buffer + streamFile(file, buffer, [=]() { + fileDataReady(); + (*readFile)(fileIndex + 1); + }); + }; + + (*readFile)(0); +} + +typedef std::function<void (const qstdweb::FileList &fileList)> OpenFileDialogCallback; +void openFileDialog(const std::string &accept, FileSelectMode fileSelectMode, + const OpenFileDialogCallback &filesSelected) +{ + // Create file input html element which will display a native file dialog + // and call back to our onchange handler once the user has selected + // one or more files. + emscripten::val document = emscripten::val::global("document"); + emscripten::val input = document.call<emscripten::val>("createElement", std::string("input")); + input.set("type", "file"); + input.set("style", "display:none"); + input.set("accept", emscripten::val(accept)); + input.set("multiple", emscripten::val(fileSelectMode == MultipleFiles)); + + // Note: there is no event in case the user cancels the file dialog. + static std::unique_ptr<qstdweb::EventCallback> changeEvent; + auto callback = [=]() { filesSelected(qstdweb::FileList(input["files"])); }; + changeEvent.reset(new qstdweb::EventCallback(input, "change", callback)); + + // Activate file input + emscripten::val body = document["body"]; + body.call<void>("appendChild", input); + input.call<void>("click"); + body.call<void>("removeChild", input); +} + +void openFiles(const std::string &accept, FileSelectMode fileSelectMode, + const std::function<void (int fileCount)> &fileDialogClosed, + const std::function<char *(uint64_t size, const std::string name)> &acceptFile, + const std::function<void()> &fileDataReady) +{ + openFileDialog(accept, fileSelectMode, [=](const qstdweb::FileList &files) { + fileDialogClosed(files.length()); + readFiles(files, acceptFile, fileDataReady); + }); +} + +void openFile(const std::string &accept, + const std::function<void (bool fileSelected)> &fileDialogClosed, + const std::function<char *(uint64_t size, const std::string name)> &acceptFile, + const std::function<void()> &fileDataReady) +{ + auto fileDialogClosedWithInt = [=](int fileCount) { fileDialogClosed(fileCount != 0); }; + openFiles(accept, FileSelectMode::SingleFile, fileDialogClosedWithInt, acceptFile, fileDataReady); +} + +} // namespace QWasmLocalFileAccess + +QT_END_NAMESPACE diff --git a/src/gui/platform/wasm/qwasmlocalfileaccess_p.h b/src/gui/platform/wasm/qwasmlocalfileaccess_p.h new file mode 100644 index 0000000000..794db8d9b2 --- /dev/null +++ b/src/gui/platform/wasm/qwasmlocalfileaccess_p.h @@ -0,0 +1,78 @@ +/**************************************************************************** +** +** Copyright (C) 2016 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QWASMLOCALFILEACCESS_P_H +#define QWASMLOCALFILEACCESS_P_H + +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// + +#include <qglobal.h> +#include <cstdint> +#include <functional> + +QT_BEGIN_NAMESPACE + +namespace QWasmLocalFileAccess { + +enum FileSelectMode { SingleFile, MultipleFiles }; + +void openFiles(const std::string &accept, FileSelectMode fileSelectMode, + const std::function<void (int fileCount)> &fileDialogClosed, + const std::function<char *(uint64_t size, const std::string name)> &acceptFile, + const std::function<void()> &fileDataReady); + +void openFile(const std::string &accept, + const std::function<void (bool fileSelected)> &fileDialogClosed, + const std::function<char *(uint64_t size, const std::string name)> &acceptFile, + const std::function<void()> &fileDataReady); + +} // namespace QWasmLocalFileAccess + +QT_END_NAMESPACE + +#endif // QWASMLOCALFILEACCESS_P_H diff --git a/src/gui/platform/wasm/wasm.pri b/src/gui/platform/wasm/wasm.pri new file mode 100644 index 0000000000..1b5d7eadb5 --- /dev/null +++ b/src/gui/platform/wasm/wasm.pri @@ -0,0 +1,3 @@ +INCLUDEDIR += $$PWD +HEADERS += $$PWD/qwasmlocalfileaccess_p.h +SOURCES += $$PWD/qwasmlocalfileaccess.cpp diff --git a/src/gui/qtgui.tracepoints b/src/gui/qtgui.tracepoints index 2c232a0af8..0a96a589b1 100644 --- a/src/gui/qtgui.tracepoints +++ b/src/gui/qtgui.tracepoints @@ -1,3 +1,9 @@ +{ +QT_BEGIN_NAMESPACE +class QImageReader; +QT_END_NAMESPACE +} + QGuiApplicationPrivate_init_entry() QGuiApplicationPrivate_init_exit() @@ -8,3 +14,6 @@ QFontDatabase_addApplicationFont(const QString &filename) QFontDatabase_load(const QString &family, int pointSize) QFontDatabase_loadEngine(const QString &family, int pointSize) QFontDatabasePrivate_addAppFont(const QString &fileName) + +QImageReader_read_before_reading(QImageReader *reader, const QString &filename) +QImageReader_read_after_reading(QImageReader *reader, bool result) diff --git a/src/gui/text/qabstracttextdocumentlayout.h b/src/gui/text/qabstracttextdocumentlayout.h index 8fea27f772..3371401420 100644 --- a/src/gui/text/qabstracttextdocumentlayout.h +++ b/src/gui/text/qabstracttextdocumentlayout.h @@ -143,7 +143,9 @@ public: virtual void drawObject(QPainter *painter, const QRectF &rect, QTextDocument *doc, int posInDocument, const QTextFormat &format) = 0; }; +#ifndef Q_CLANG_QDOC Q_DECLARE_INTERFACE(QTextObjectInterface, "org.qt-project.Qt.QTextObjectInterface") +#endif QT_END_NAMESPACE diff --git a/src/gui/text/qabstracttextdocumentlayout_p.h b/src/gui/text/qabstracttextdocumentlayout_p.h index 191c463dc6..d631ce3197 100644 --- a/src/gui/text/qabstracttextdocumentlayout_p.h +++ b/src/gui/text/qabstracttextdocumentlayout_p.h @@ -59,7 +59,7 @@ QT_BEGIN_NAMESPACE struct QTextObjectHandler { - QTextObjectHandler() : iface(0) {} + QTextObjectHandler() : iface(nullptr) {} QTextObjectInterface *iface; QPointer<QObject> component; }; @@ -71,12 +71,12 @@ public: Q_DECLARE_PUBLIC(QAbstractTextDocumentLayout) inline QAbstractTextDocumentLayoutPrivate() - : paintDevice(0) {} + : paintDevice(nullptr) {} ~QAbstractTextDocumentLayoutPrivate(); inline void setDocument(QTextDocument *doc) { document = doc; - docPrivate = 0; + docPrivate = nullptr; if (doc) docPrivate = doc->docHandle(); } diff --git a/src/gui/text/qcssparser.cpp b/src/gui/text/qcssparser.cpp index 1c454b0fca..dc7e128bcd 100644 --- a/src/gui/text/qcssparser.cpp +++ b/src/gui/text/qcssparser.cpp @@ -1200,11 +1200,13 @@ static bool setFontWeightFromValue(const QCss::Value &value, QFont *font) static bool setFontFamilyFromValues(const QVector<QCss::Value> &values, QFont *font, int start = 0) { QString family; + QStringList families; bool shouldAddSpace = false; for (int i = start; i < values.count(); ++i) { const QCss::Value &v = values.at(i); if (v.type == Value::TermOperatorComma) { - family += QLatin1Char(','); + families << family; + family.clear(); shouldAddSpace = false; continue; } @@ -1216,9 +1218,12 @@ static bool setFontFamilyFromValues(const QVector<QCss::Value> &values, QFont *f family += str; shouldAddSpace = true; } - if (family.isEmpty()) + if (!family.isEmpty()) + families << family; + if (families.isEmpty()) return false; - font->setFamily(family); + font->setFamily(families.at(0)); + font->setFamilies(families); return true; } @@ -2003,7 +2008,7 @@ bool StyleSelector::basicSelectorMatches(const BasicSelector &sel, NodePtr node) } void StyleSelector::matchRule(NodePtr node, const StyleRule &rule, StyleSheetOrigin origin, - int depth, QMap<uint, StyleRule> *weightedRules) + int depth, QMultiMap<uint, StyleRule> *weightedRules) { for (int j = 0; j < rule.selectors.count(); ++j) { const Selector& selector = rule.selectors.at(j); @@ -2017,7 +2022,7 @@ void StyleSelector::matchRule(NodePtr node, const StyleRule &rule, StyleSheetOri newRule.selectors[0] = selector; } //We might have rules with the same weight if they came from a rule with several selectors - weightedRules->insertMulti(weight, newRule); + weightedRules->insert(weight, newRule); } } } @@ -2030,7 +2035,7 @@ QVector<StyleRule> StyleSelector::styleRulesForNode(NodePtr node) if (styleSheets.isEmpty()) return rules; - QMap<uint, StyleRule> weightedRules; // (spec, rule) that will be sorted below + QMultiMap<uint, StyleRule> weightedRules; // (spec, rule) that will be sorted below //prune using indexed stylesheet for (int sheetIdx = 0; sheetIdx < styleSheets.count(); ++sheetIdx) { @@ -2742,8 +2747,10 @@ bool Parser::parseFunction(QString *name, QString *args) { *name = lexem(); name->chop(1); + // until(RPAREN) needs FUNCTION token at index-1 to work properly + int start = index; skipSpace(); - const int start = index; + std::swap(start, index); if (!until(RPAREN)) return false; for (int i = start; i < index - 1; ++i) args->append(symbols.at(i).lexem()); diff --git a/src/gui/text/qcssparser_p.h b/src/gui/text/qcssparser_p.h index 8f992f8c59..62578f75e5 100644 --- a/src/gui/text/qcssparser_p.h +++ b/src/gui/text/qcssparser_p.h @@ -467,8 +467,8 @@ struct Q_GUI_EXPORT Declaration Attachment attachmentValue() const; int styleFeaturesValue() const; - bool intValue(int *i, const char *unit = 0) const; - bool realValue(qreal *r, const char *unit = 0) const; + bool intValue(int *i, const char *unit = nullptr) const; + bool realValue(qreal *r, const char *unit = nullptr) const; QSize sizeValue() const; QRect rectValue() const; @@ -584,7 +584,7 @@ struct Q_GUI_EXPORT Selector { QVector<BasicSelector> basicSelectors; int specificity() const; - quint64 pseudoClass(quint64 *negated = 0) const; + quint64 pseudoClass(quint64 *negated = nullptr) const; QString pseudoElement() const; }; QT_CSS_DECLARE_TYPEINFO(Selector, Q_MOVABLE_TYPE) @@ -656,7 +656,7 @@ public: }; QVector<StyleRule> styleRulesForNode(NodePtr node); - QVector<Declaration> declarationsForNode(NodePtr node, const char *extraPseudo = 0); + QVector<Declaration> declarationsForNode(NodePtr node, const char *extraPseudo = nullptr); virtual bool nodeNameEquals(NodePtr node, const QString& nodeName) const; virtual QString attribute(NodePtr node, const QString &name) const = 0; @@ -674,7 +674,7 @@ public: Qt::CaseSensitivity nameCaseSensitivity; private: void matchRule(NodePtr node, const StyleRule &rules, StyleSheetOrigin origin, - int depth, QMap<uint, StyleRule> *weightedRules); + int depth, QMultiMap<uint, StyleRule> *weightedRules); bool selectorMatches(const Selector &rule, NodePtr node); bool basicSelectorMatches(const BasicSelector &rule, NodePtr node); }; @@ -744,7 +744,7 @@ QT_CSS_DECLARE_TYPEINFO(Symbol, Q_MOVABLE_TYPE) class Q_GUI_EXPORT Scanner { public: - static QString preprocess(const QString &input, bool *hasEscapeSequences = 0); + static QString preprocess(const QString &input, bool *hasEscapeSequences = nullptr); static void scan(const QString &preprocessedInput, QVector<Symbol> *symbols); }; @@ -845,7 +845,7 @@ struct Q_GUI_EXPORT ValueExtractor bool extractGeometry(int *w, int *h, int *minw, int *minh, int *maxw, int *maxh); bool extractPosition(int *l, int *t, int *r, int *b, QCss::Origin *, Qt::Alignment *, QCss::PositionMode *, Qt::Alignment *); - bool extractBox(int *margins, int *paddings, int *spacing = 0); + bool extractBox(int *margins, int *paddings, int *spacing = nullptr); bool extractBorder(int *borders, QBrush *colors, BorderStyle *Styles, QSize *radii); bool extractOutline(int *borders, QBrush *colors, BorderStyle *Styles, QSize *radii, int *offsets); bool extractPalette(QBrush *fg, QBrush *sfg, QBrush *sbg, QBrush *abg); diff --git a/src/gui/text/qcssscanner.cpp b/src/gui/text/qcssscanner.cpp index 33dc01c8bc..d48cbb71d7 100644 --- a/src/gui/text/qcssscanner.cpp +++ b/src/gui/text/qcssscanner.cpp @@ -1,6 +1,6 @@ /**************************************************************************** ** -** Copyright (C) 2016 The Qt Company Ltd. +** Copyright (C) 2018 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** ** This file is part of the QtGui module of the Qt Toolkit. @@ -37,7 +37,7 @@ ** ****************************************************************************/ -// auto generated. DO NOT EDIT. +// auto generated by qtbase/util/lexgen/. DO NOT EDIT. class QCssScanner_Generated { public: @@ -75,23 +75,23 @@ int QCssScanner_Generated::lex() // initial state ch = next(); if (ch.unicode() >= 9 && ch.unicode() <= 10) - goto state_1; + goto state_4; if (ch.unicode() >= 12 && ch.unicode() <= 13) - goto state_1; + goto state_4; if (ch.unicode() == 32) - goto state_1; + goto state_4; if (ch.unicode() == 33) { token = QCss::EXCLAMATION_SYM; goto found; } if (ch.unicode() == 34) - goto state_3; + goto state_2; if (ch.unicode() == 35) - goto state_4; + goto state_1; if (ch.unicode() == 36) - goto state_5; - if (ch.unicode() == 39) goto state_6; + if (ch.unicode() == 39) + goto state_5; if (ch.unicode() == 40) { token = QCss::LPAREN; goto found; @@ -101,17 +101,17 @@ int QCssScanner_Generated::lex() goto found; } if (ch.unicode() == 42) - goto state_9; + goto state_8; if (ch.unicode() == 43) - goto state_10; + goto state_7; if (ch.unicode() == 44) - goto state_11; + goto state_14; if (ch.unicode() == 45) - goto state_12; - if (ch.unicode() == 46) goto state_13; + if (ch.unicode() == 46) + goto state_12; if (ch.unicode() == 47) - goto state_14; + goto state_11; if (ch.unicode() >= 48 && ch.unicode() <= 57) goto state_15; if (ch.unicode() == 58) { @@ -123,64 +123,56 @@ int QCssScanner_Generated::lex() goto found; } if (ch.unicode() == 60) - goto state_18; + goto state_20; if (ch.unicode() == 61) { token = QCss::EQUAL; goto found; } if (ch.unicode() == 62) - goto state_20; + goto state_18; if (ch.unicode() == 64) - goto state_21; + goto state_26; if (ch.unicode() == 91) { token = QCss::LBRACKET; goto found; } if (ch.unicode() == 92) - goto state_23; + goto state_30; if (ch.unicode() == 93) { token = QCss::RBRACKET; goto found; } if (ch.unicode() == 94) - goto state_25; + goto state_28; if (ch.unicode() == 95) - goto state_26; + goto state_21; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_26; + goto state_21; if (ch.unicode() == 123) - goto state_27; + goto state_22; if (ch.unicode() == 124) - goto state_28; + goto state_25; if (ch.unicode() == 125) { token = QCss::RBRACE; goto found; } if (ch.unicode() == 126) - goto state_30; + goto state_23; goto out; state_1: - lastAcceptingPos = pos; - token = QCss::S; ch = next(); - if (ch.unicode() >= 9 && ch.unicode() <= 10) - goto state_31; - if (ch.unicode() >= 12 && ch.unicode() <= 13) + if (ch.unicode() == 45) goto state_31; - if (ch.unicode() == 32) + if (ch.unicode() >= 48 && ch.unicode() <= 57) goto state_31; - if (ch.unicode() == 43) - goto state_10; - if (ch.unicode() == 44) - goto state_11; - if (ch.unicode() == 62) - goto state_20; - if (ch.unicode() == 123) - goto state_27; - if (ch.unicode() == 126) + if (ch.unicode() == 92) goto state_32; + if (ch.unicode() == 95) + goto state_31; + if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) + goto state_31; goto out; - state_3: + state_2: lastAcceptingPos = pos; token = QCss::INVALID; ch = next(); @@ -204,93 +196,101 @@ int QCssScanner_Generated::lex() goto state_33; goto out; state_4: + lastAcceptingPos = pos; + token = QCss::S; ch = next(); - if (ch.unicode() == 45) - goto state_36; - if (ch.unicode() >= 48 && ch.unicode() <= 57) + if (ch.unicode() >= 9 && ch.unicode() <= 10) goto state_36; - if (ch.unicode() == 92) - goto state_37; - if (ch.unicode() == 95) + if (ch.unicode() >= 12 && ch.unicode() <= 13) goto state_36; - if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) + if (ch.unicode() == 32) goto state_36; + if (ch.unicode() == 43) + goto state_7; + if (ch.unicode() == 44) + goto state_14; + if (ch.unicode() == 62) + goto state_18; + if (ch.unicode() == 123) + goto state_22; + if (ch.unicode() == 126) + goto state_37; goto out; state_5: - ch = next(); - if (ch.unicode() == 61) { - token = QCss::ENDSWITH; - goto found; - } - goto out; - state_6: lastAcceptingPos = pos; token = QCss::INVALID; ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) - goto state_39; + goto state_38; if (ch.unicode() == 11) - goto state_39; + goto state_38; if (ch.unicode() >= 14 && ch.unicode() <= 38) - goto state_39; + goto state_38; if (ch.unicode() == 39) - goto state_40; - if (ch.unicode() >= 40 && ch.unicode() <= 91) goto state_39; + if (ch.unicode() >= 40 && ch.unicode() <= 91) + goto state_38; if (ch.unicode() == 92) - goto state_41; + goto state_40; if (ch.unicode() >= 93 && ch.unicode() <= 96) - goto state_39; + goto state_38; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_39; + goto state_38; if (ch.unicode() >= 123) - goto state_39; + goto state_38; goto out; - state_9: - lastAcceptingPos = pos; - token = QCss::STAR; + state_6: ch = next(); if (ch.unicode() == 61) { - token = QCss::CONTAINS; + token = QCss::ENDSWITH; goto found; } goto out; - state_10: + state_7: lastAcceptingPos = pos; token = QCss::PLUS; goto out; + state_8: + lastAcceptingPos = pos; + token = QCss::STAR; + ch = next(); + if (ch.unicode() == 61) { + token = QCss::CONTAINS; + goto found; + } + goto out; state_11: lastAcceptingPos = pos; - token = QCss::COMMA; + token = QCss::SLASH; + ch = next(); + if (ch.unicode() == 42) { + token = handleCommentStart(); + goto found; + } goto out; state_12: lastAcceptingPos = pos; + token = QCss::DOT; + ch = next(); + if (ch.unicode() >= 48 && ch.unicode() <= 57) + goto state_44; + goto out; + state_13: + lastAcceptingPos = pos; token = QCss::MINUS; ch = next(); if (ch.unicode() == 45) - goto state_43; + goto state_45; if (ch.unicode() == 92) - goto state_23; + goto state_30; if (ch.unicode() == 95) - goto state_26; + goto state_21; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_26; - goto out; - state_13: - lastAcceptingPos = pos; - token = QCss::DOT; - ch = next(); - if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_44; + goto state_21; goto out; state_14: lastAcceptingPos = pos; - token = QCss::SLASH; - ch = next(); - if (ch.unicode() == 42) { - token = handleCommentStart(); - goto found; - } + token = QCss::COMMA; goto out; state_15: lastAcceptingPos = pos; @@ -299,68 +299,70 @@ int QCssScanner_Generated::lex() if (ch.unicode() == 37) goto state_46; if (ch.unicode() == 45) - goto state_47; - if (ch.unicode() == 46) goto state_48; + if (ch.unicode() == 46) + goto state_47; if (ch.unicode() >= 48 && ch.unicode() <= 57) goto state_49; if (ch.unicode() == 92) - goto state_50; - if (ch.unicode() == 95) goto state_51; + if (ch.unicode() == 95) + goto state_50; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_51; + goto state_50; goto out; state_18: + lastAcceptingPos = pos; + token = QCss::GREATER; + goto out; + state_20: ch = next(); if (ch.unicode() == 33) goto state_52; goto out; - state_20: - lastAcceptingPos = pos; - token = QCss::GREATER; - goto out; state_21: + lastAcceptingPos = pos; + token = QCss::IDENT; ch = next(); - if (ch.unicode() == 45) + if (ch.unicode() == 40) goto state_53; - if (ch.unicode() == 92) + if (ch.unicode() == 45) goto state_54; - if (ch.unicode() == 95) + if (ch.unicode() >= 48 && ch.unicode() <= 57) + goto state_54; + if (ch.unicode() == 92) goto state_55; + if (ch.unicode() == 95) + goto state_54; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_55; + goto state_54; + goto out; + state_22: + lastAcceptingPos = pos; + token = QCss::LBRACE; goto out; state_23: + lastAcceptingPos = pos; + token = QCss::TILDE; ch = next(); - if (ch.unicode() >= 1 && ch.unicode() <= 9) - goto state_56; - if (ch.unicode() == 11) - goto state_56; - if (ch.unicode() >= 14 && ch.unicode() <= 47) - goto state_56; - if (ch.unicode() >= 58 && ch.unicode() <= 96) - goto state_56; - if (ch.unicode() >= 103) - goto state_56; + if (ch.unicode() == 61) { + token = QCss::INCLUDES; + goto found; + } goto out; state_25: + lastAcceptingPos = pos; + token = QCss::OR; ch = next(); if (ch.unicode() == 61) { - token = QCss::BEGINSWITH; + token = QCss::DASHMATCH; goto found; } goto out; state_26: - lastAcceptingPos = pos; - token = QCss::IDENT; ch = next(); - if (ch.unicode() == 40) - goto state_58; if (ch.unicode() == 45) - goto state_59; - if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_59; + goto state_58; if (ch.unicode() == 92) goto state_60; if (ch.unicode() == 95) @@ -368,52 +370,53 @@ int QCssScanner_Generated::lex() if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) goto state_59; goto out; - state_27: - lastAcceptingPos = pos; - token = QCss::LBRACE; - goto out; state_28: - lastAcceptingPos = pos; - token = QCss::OR; ch = next(); if (ch.unicode() == 61) { - token = QCss::DASHMATCH; + token = QCss::BEGINSWITH; goto found; } goto out; state_30: - lastAcceptingPos = pos; - token = QCss::TILDE; ch = next(); - if (ch.unicode() == 61) { - token = QCss::INCLUDES; - goto found; - } + if (ch.unicode() >= 1 && ch.unicode() <= 9) + goto state_62; + if (ch.unicode() == 11) + goto state_62; + if (ch.unicode() >= 14 && ch.unicode() <= 47) + goto state_62; + if (ch.unicode() >= 58 && ch.unicode() <= 96) + goto state_62; + if (ch.unicode() >= 103) + goto state_62; goto out; state_31: lastAcceptingPos = pos; - token = QCss::S; + token = QCss::HASH; ch = next(); - if (ch.unicode() >= 9 && ch.unicode() <= 10) - goto state_31; - if (ch.unicode() >= 12 && ch.unicode() <= 13) - goto state_31; - if (ch.unicode() == 32) - goto state_31; - if (ch.unicode() == 43) - goto state_10; - if (ch.unicode() == 44) - goto state_11; - if (ch.unicode() == 62) - goto state_20; - if (ch.unicode() == 123) - goto state_27; - if (ch.unicode() == 126) - goto state_32; + if (ch.unicode() == 45) + goto state_63; + if (ch.unicode() >= 48 && ch.unicode() <= 57) + goto state_63; + if (ch.unicode() == 92) + goto state_64; + if (ch.unicode() == 95) + goto state_63; + if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) + goto state_63; goto out; state_32: - lastAcceptingPos = pos; - token = QCss::TILDE; + ch = next(); + if (ch.unicode() >= 1 && ch.unicode() <= 9) + goto state_65; + if (ch.unicode() == 11) + goto state_65; + if (ch.unicode() >= 14 && ch.unicode() <= 47) + goto state_65; + if (ch.unicode() >= 58 && ch.unicode() <= 96) + goto state_65; + if (ch.unicode() >= 103) + goto state_65; goto out; state_33: lastAcceptingPos = pos; @@ -445,78 +448,75 @@ int QCssScanner_Generated::lex() state_35: ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) - goto state_63; + goto state_66; if (ch.unicode() == 10) - goto state_64; + goto state_67; if (ch.unicode() == 11) - goto state_63; + goto state_66; if (ch.unicode() == 12) - goto state_65; + goto state_69; if (ch.unicode() == 13) - goto state_66; + goto state_68; if (ch.unicode() >= 14 && ch.unicode() <= 47) - goto state_63; + goto state_66; if (ch.unicode() >= 58 && ch.unicode() <= 96) - goto state_63; + goto state_66; if (ch.unicode() >= 103) - goto state_63; + goto state_66; goto out; state_36: lastAcceptingPos = pos; - token = QCss::HASH; + token = QCss::S; ch = next(); - if (ch.unicode() == 45) - goto state_67; - if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_67; - if (ch.unicode() == 92) - goto state_68; - if (ch.unicode() == 95) - goto state_67; - if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_67; + if (ch.unicode() >= 9 && ch.unicode() <= 10) + goto state_36; + if (ch.unicode() >= 12 && ch.unicode() <= 13) + goto state_36; + if (ch.unicode() == 32) + goto state_36; + if (ch.unicode() == 43) + goto state_7; + if (ch.unicode() == 44) + goto state_14; + if (ch.unicode() == 62) + goto state_18; + if (ch.unicode() == 123) + goto state_22; + if (ch.unicode() == 126) + goto state_37; goto out; state_37: - ch = next(); - if (ch.unicode() >= 1 && ch.unicode() <= 9) - goto state_69; - if (ch.unicode() == 11) - goto state_69; - if (ch.unicode() >= 14 && ch.unicode() <= 47) - goto state_69; - if (ch.unicode() >= 58 && ch.unicode() <= 96) - goto state_69; - if (ch.unicode() >= 103) - goto state_69; + lastAcceptingPos = pos; + token = QCss::TILDE; goto out; - state_39: + state_38: lastAcceptingPos = pos; token = QCss::INVALID; ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) - goto state_39; + goto state_38; if (ch.unicode() == 11) - goto state_39; + goto state_38; if (ch.unicode() >= 14 && ch.unicode() <= 38) - goto state_39; + goto state_38; if (ch.unicode() == 39) - goto state_40; - if (ch.unicode() >= 40 && ch.unicode() <= 91) goto state_39; + if (ch.unicode() >= 40 && ch.unicode() <= 91) + goto state_38; if (ch.unicode() == 92) - goto state_41; + goto state_40; if (ch.unicode() >= 93 && ch.unicode() <= 96) - goto state_39; + goto state_38; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_39; + goto state_38; if (ch.unicode() >= 123) - goto state_39; + goto state_38; goto out; - state_40: + state_39: lastAcceptingPos = pos; token = QCss::STRING; goto out; - state_41: + state_40: ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) goto state_70; @@ -525,9 +525,9 @@ int QCssScanner_Generated::lex() if (ch.unicode() == 11) goto state_70; if (ch.unicode() == 12) - goto state_72; - if (ch.unicode() == 13) goto state_73; + if (ch.unicode() == 13) + goto state_72; if (ch.unicode() >= 14 && ch.unicode() <= 47) goto state_70; if (ch.unicode() >= 58 && ch.unicode() <= 96) @@ -535,13 +535,6 @@ int QCssScanner_Generated::lex() if (ch.unicode() >= 103) goto state_70; goto out; - state_43: - ch = next(); - if (ch.unicode() == 62) { - token = QCss::CDC; - goto found; - } - goto out; state_44: lastAcceptingPos = pos; token = QCss::NUMBER; @@ -549,15 +542,22 @@ int QCssScanner_Generated::lex() if (ch.unicode() == 37) goto state_46; if (ch.unicode() == 45) - goto state_47; + goto state_48; if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_75; + goto state_74; if (ch.unicode() == 92) - goto state_50; - if (ch.unicode() == 95) goto state_51; + if (ch.unicode() == 95) + goto state_50; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_51; + goto state_50; + goto out; + state_45: + ch = next(); + if (ch.unicode() == 62) { + token = QCss::CDC; + goto found; + } goto out; state_46: lastAcceptingPos = pos; @@ -565,17 +565,17 @@ int QCssScanner_Generated::lex() goto out; state_47: ch = next(); - if (ch.unicode() == 92) - goto state_50; - if (ch.unicode() == 95) - goto state_51; - if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_51; + if (ch.unicode() >= 48 && ch.unicode() <= 57) + goto state_44; goto out; state_48: ch = next(); - if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_44; + if (ch.unicode() == 92) + goto state_51; + if (ch.unicode() == 95) + goto state_50; + if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) + goto state_50; goto out; state_49: lastAcceptingPos = pos; @@ -584,45 +584,45 @@ int QCssScanner_Generated::lex() if (ch.unicode() == 37) goto state_46; if (ch.unicode() == 45) - goto state_47; - if (ch.unicode() == 46) goto state_48; + if (ch.unicode() == 46) + goto state_47; if (ch.unicode() >= 48 && ch.unicode() <= 57) goto state_49; if (ch.unicode() == 92) - goto state_50; - if (ch.unicode() == 95) goto state_51; + if (ch.unicode() == 95) + goto state_50; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_51; + goto state_50; goto out; state_50: + lastAcceptingPos = pos; + token = QCss::LENGTH; ch = next(); - if (ch.unicode() >= 1 && ch.unicode() <= 9) - goto state_76; - if (ch.unicode() == 11) + if (ch.unicode() == 45) goto state_76; - if (ch.unicode() >= 14 && ch.unicode() <= 47) + if (ch.unicode() >= 48 && ch.unicode() <= 57) goto state_76; - if (ch.unicode() >= 58 && ch.unicode() <= 96) + if (ch.unicode() == 92) + goto state_77; + if (ch.unicode() == 95) goto state_76; - if (ch.unicode() >= 103) + if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) goto state_76; goto out; state_51: - lastAcceptingPos = pos; - token = QCss::LENGTH; ch = next(); - if (ch.unicode() == 45) - goto state_77; - if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_77; - if (ch.unicode() == 92) + if (ch.unicode() >= 1 && ch.unicode() <= 9) + goto state_78; + if (ch.unicode() == 11) + goto state_78; + if (ch.unicode() >= 14 && ch.unicode() <= 47) + goto state_78; + if (ch.unicode() >= 58 && ch.unicode() <= 96) + goto state_78; + if (ch.unicode() >= 103) goto state_78; - if (ch.unicode() == 95) - goto state_77; - if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_77; goto out; state_52: ch = next(); @@ -630,15 +630,27 @@ int QCssScanner_Generated::lex() goto state_79; goto out; state_53: + lastAcceptingPos = pos; + token = QCss::FUNCTION; + goto out; + state_54: + lastAcceptingPos = pos; + token = QCss::IDENT; ch = next(); - if (ch.unicode() == 92) + if (ch.unicode() == 40) + goto state_53; + if (ch.unicode() == 45) goto state_54; - if (ch.unicode() == 95) + if (ch.unicode() >= 48 && ch.unicode() <= 57) + goto state_54; + if (ch.unicode() == 92) goto state_55; + if (ch.unicode() == 95) + goto state_54; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_55; + goto state_54; goto out; - state_54: + state_55: ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) goto state_80; @@ -651,7 +663,16 @@ int QCssScanner_Generated::lex() if (ch.unicode() >= 103) goto state_80; goto out; - state_55: + state_58: + ch = next(); + if (ch.unicode() == 92) + goto state_60; + if (ch.unicode() == 95) + goto state_59; + if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) + goto state_59; + goto out; + state_59: lastAcceptingPos = pos; token = QCss::ATKEYWORD_SYM; ch = next(); @@ -666,58 +687,80 @@ int QCssScanner_Generated::lex() if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) goto state_81; goto out; - state_56: + state_60: + ch = next(); + if (ch.unicode() >= 1 && ch.unicode() <= 9) + goto state_83; + if (ch.unicode() == 11) + goto state_83; + if (ch.unicode() >= 14 && ch.unicode() <= 47) + goto state_83; + if (ch.unicode() >= 58 && ch.unicode() <= 96) + goto state_83; + if (ch.unicode() >= 103) + goto state_83; + goto out; + state_62: lastAcceptingPos = pos; token = QCss::IDENT; ch = next(); if (ch.unicode() == 40) - goto state_58; + goto state_53; if (ch.unicode() == 45) - goto state_59; + goto state_54; if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_59; + goto state_54; if (ch.unicode() == 92) - goto state_60; + goto state_55; if (ch.unicode() == 95) - goto state_59; + goto state_54; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_59; - goto out; - state_58: - lastAcceptingPos = pos; - token = QCss::FUNCTION; + goto state_54; goto out; - state_59: + state_63: lastAcceptingPos = pos; - token = QCss::IDENT; + token = QCss::HASH; ch = next(); - if (ch.unicode() == 40) - goto state_58; if (ch.unicode() == 45) - goto state_59; + goto state_63; if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_59; + goto state_63; if (ch.unicode() == 92) - goto state_60; + goto state_64; if (ch.unicode() == 95) - goto state_59; + goto state_63; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_59; + goto state_63; goto out; - state_60: + state_64: ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) - goto state_83; + goto state_84; if (ch.unicode() == 11) - goto state_83; + goto state_84; if (ch.unicode() >= 14 && ch.unicode() <= 47) - goto state_83; + goto state_84; if (ch.unicode() >= 58 && ch.unicode() <= 96) - goto state_83; + goto state_84; if (ch.unicode() >= 103) - goto state_83; + goto state_84; goto out; - state_63: + state_65: + lastAcceptingPos = pos; + token = QCss::HASH; + ch = next(); + if (ch.unicode() == 45) + goto state_63; + if (ch.unicode() >= 48 && ch.unicode() <= 57) + goto state_63; + if (ch.unicode() == 92) + goto state_64; + if (ch.unicode() == 95) + goto state_63; + if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) + goto state_63; + goto out; + state_66: lastAcceptingPos = pos; token = QCss::INVALID; ch = next(); @@ -740,7 +783,7 @@ int QCssScanner_Generated::lex() if (ch.unicode() >= 123) goto state_33; goto out; - state_64: + state_67: lastAcceptingPos = pos; token = QCss::INVALID; ch = next(); @@ -763,12 +806,14 @@ int QCssScanner_Generated::lex() if (ch.unicode() >= 123) goto state_33; goto out; - state_65: + state_68: lastAcceptingPos = pos; token = QCss::INVALID; ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) goto state_33; + if (ch.unicode() == 10) + goto state_85; if (ch.unicode() == 11) goto state_33; if (ch.unicode() >= 14 && ch.unicode() <= 33) @@ -786,14 +831,12 @@ int QCssScanner_Generated::lex() if (ch.unicode() >= 123) goto state_33; goto out; - state_66: + state_69: lastAcceptingPos = pos; token = QCss::INVALID; ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) goto state_33; - if (ch.unicode() == 10) - goto state_84; if (ch.unicode() == 11) goto state_33; if (ch.unicode() >= 14 && ch.unicode() <= 33) @@ -811,191 +854,133 @@ int QCssScanner_Generated::lex() if (ch.unicode() >= 123) goto state_33; goto out; - state_67: - lastAcceptingPos = pos; - token = QCss::HASH; - ch = next(); - if (ch.unicode() == 45) - goto state_67; - if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_67; - if (ch.unicode() == 92) - goto state_68; - if (ch.unicode() == 95) - goto state_67; - if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_67; - goto out; - state_68: - ch = next(); - if (ch.unicode() >= 1 && ch.unicode() <= 9) - goto state_85; - if (ch.unicode() == 11) - goto state_85; - if (ch.unicode() >= 14 && ch.unicode() <= 47) - goto state_85; - if (ch.unicode() >= 58 && ch.unicode() <= 96) - goto state_85; - if (ch.unicode() >= 103) - goto state_85; - goto out; - state_69: - lastAcceptingPos = pos; - token = QCss::HASH; - ch = next(); - if (ch.unicode() == 45) - goto state_67; - if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_67; - if (ch.unicode() == 92) - goto state_68; - if (ch.unicode() == 95) - goto state_67; - if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_67; - goto out; state_70: lastAcceptingPos = pos; token = QCss::INVALID; ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) - goto state_39; + goto state_38; if (ch.unicode() == 11) - goto state_39; + goto state_38; if (ch.unicode() >= 14 && ch.unicode() <= 38) - goto state_39; + goto state_38; if (ch.unicode() == 39) - goto state_40; - if (ch.unicode() >= 40 && ch.unicode() <= 91) goto state_39; + if (ch.unicode() >= 40 && ch.unicode() <= 91) + goto state_38; if (ch.unicode() == 92) - goto state_41; + goto state_40; if (ch.unicode() >= 93 && ch.unicode() <= 96) - goto state_39; + goto state_38; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_39; + goto state_38; if (ch.unicode() >= 123) - goto state_39; + goto state_38; goto out; state_71: lastAcceptingPos = pos; token = QCss::INVALID; ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) - goto state_39; + goto state_38; if (ch.unicode() == 11) - goto state_39; + goto state_38; if (ch.unicode() >= 14 && ch.unicode() <= 38) - goto state_39; + goto state_38; if (ch.unicode() == 39) - goto state_40; - if (ch.unicode() >= 40 && ch.unicode() <= 91) goto state_39; + if (ch.unicode() >= 40 && ch.unicode() <= 91) + goto state_38; if (ch.unicode() == 92) - goto state_41; + goto state_40; if (ch.unicode() >= 93 && ch.unicode() <= 96) - goto state_39; + goto state_38; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_39; + goto state_38; if (ch.unicode() >= 123) - goto state_39; + goto state_38; goto out; state_72: lastAcceptingPos = pos; token = QCss::INVALID; ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) - goto state_39; + goto state_38; + if (ch.unicode() == 10) + goto state_86; if (ch.unicode() == 11) - goto state_39; + goto state_38; if (ch.unicode() >= 14 && ch.unicode() <= 38) - goto state_39; + goto state_38; if (ch.unicode() == 39) - goto state_40; - if (ch.unicode() >= 40 && ch.unicode() <= 91) goto state_39; + if (ch.unicode() >= 40 && ch.unicode() <= 91) + goto state_38; if (ch.unicode() == 92) - goto state_41; + goto state_40; if (ch.unicode() >= 93 && ch.unicode() <= 96) - goto state_39; + goto state_38; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_39; + goto state_38; if (ch.unicode() >= 123) - goto state_39; + goto state_38; goto out; state_73: lastAcceptingPos = pos; token = QCss::INVALID; ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) - goto state_39; - if (ch.unicode() == 10) - goto state_86; + goto state_38; if (ch.unicode() == 11) - goto state_39; + goto state_38; if (ch.unicode() >= 14 && ch.unicode() <= 38) - goto state_39; + goto state_38; if (ch.unicode() == 39) - goto state_40; - if (ch.unicode() >= 40 && ch.unicode() <= 91) goto state_39; + if (ch.unicode() >= 40 && ch.unicode() <= 91) + goto state_38; if (ch.unicode() == 92) - goto state_41; + goto state_40; if (ch.unicode() >= 93 && ch.unicode() <= 96) - goto state_39; + goto state_38; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_39; + goto state_38; if (ch.unicode() >= 123) - goto state_39; + goto state_38; goto out; - state_75: + state_74: lastAcceptingPos = pos; token = QCss::NUMBER; ch = next(); if (ch.unicode() == 37) goto state_46; if (ch.unicode() == 45) - goto state_47; + goto state_48; if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_75; + goto state_74; if (ch.unicode() == 92) - goto state_50; - if (ch.unicode() == 95) goto state_51; + if (ch.unicode() == 95) + goto state_50; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_51; + goto state_50; goto out; state_76: lastAcceptingPos = pos; token = QCss::LENGTH; ch = next(); if (ch.unicode() == 45) - goto state_77; + goto state_76; if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_77; + goto state_76; if (ch.unicode() == 92) - goto state_78; - if (ch.unicode() == 95) - goto state_77; - if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_77; - goto out; - state_77: - lastAcceptingPos = pos; - token = QCss::LENGTH; - ch = next(); - if (ch.unicode() == 45) goto state_77; - if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_77; - if (ch.unicode() == 92) - goto state_78; if (ch.unicode() == 95) - goto state_77; + goto state_76; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_77; + goto state_76; goto out; - state_78: + state_77: ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) goto state_87; @@ -1008,6 +993,21 @@ int QCssScanner_Generated::lex() if (ch.unicode() >= 103) goto state_87; goto out; + state_78: + lastAcceptingPos = pos; + token = QCss::LENGTH; + ch = next(); + if (ch.unicode() == 45) + goto state_76; + if (ch.unicode() >= 48 && ch.unicode() <= 57) + goto state_76; + if (ch.unicode() == 92) + goto state_77; + if (ch.unicode() == 95) + goto state_76; + if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) + goto state_76; + goto out; state_79: ch = next(); if (ch.unicode() == 45) { @@ -1017,18 +1017,20 @@ int QCssScanner_Generated::lex() goto out; state_80: lastAcceptingPos = pos; - token = QCss::ATKEYWORD_SYM; + token = QCss::IDENT; ch = next(); + if (ch.unicode() == 40) + goto state_53; if (ch.unicode() == 45) - goto state_81; + goto state_54; if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_81; + goto state_54; if (ch.unicode() == 92) - goto state_82; + goto state_55; if (ch.unicode() == 95) - goto state_81; + goto state_54; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_81; + goto state_54; goto out; state_81: lastAcceptingPos = pos; @@ -1060,23 +1062,36 @@ int QCssScanner_Generated::lex() goto out; state_83: lastAcceptingPos = pos; - token = QCss::IDENT; + token = QCss::ATKEYWORD_SYM; ch = next(); - if (ch.unicode() == 40) - goto state_58; if (ch.unicode() == 45) - goto state_59; + goto state_81; if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_59; + goto state_81; if (ch.unicode() == 92) - goto state_60; + goto state_82; if (ch.unicode() == 95) - goto state_59; + goto state_81; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_59; + goto state_81; goto out; state_84: lastAcceptingPos = pos; + token = QCss::HASH; + ch = next(); + if (ch.unicode() == 45) + goto state_63; + if (ch.unicode() >= 48 && ch.unicode() <= 57) + goto state_63; + if (ch.unicode() == 92) + goto state_64; + if (ch.unicode() == 95) + goto state_63; + if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) + goto state_63; + goto out; + state_85: + lastAcceptingPos = pos; token = QCss::INVALID; ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) @@ -1098,58 +1113,43 @@ int QCssScanner_Generated::lex() if (ch.unicode() >= 123) goto state_33; goto out; - state_85: - lastAcceptingPos = pos; - token = QCss::HASH; - ch = next(); - if (ch.unicode() == 45) - goto state_67; - if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_67; - if (ch.unicode() == 92) - goto state_68; - if (ch.unicode() == 95) - goto state_67; - if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_67; - goto out; state_86: lastAcceptingPos = pos; token = QCss::INVALID; ch = next(); if (ch.unicode() >= 1 && ch.unicode() <= 9) - goto state_39; + goto state_38; if (ch.unicode() == 11) - goto state_39; + goto state_38; if (ch.unicode() >= 14 && ch.unicode() <= 38) - goto state_39; + goto state_38; if (ch.unicode() == 39) - goto state_40; - if (ch.unicode() >= 40 && ch.unicode() <= 91) goto state_39; + if (ch.unicode() >= 40 && ch.unicode() <= 91) + goto state_38; if (ch.unicode() == 92) - goto state_41; + goto state_40; if (ch.unicode() >= 93 && ch.unicode() <= 96) - goto state_39; + goto state_38; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_39; + goto state_38; if (ch.unicode() >= 123) - goto state_39; + goto state_38; goto out; state_87: lastAcceptingPos = pos; token = QCss::LENGTH; ch = next(); if (ch.unicode() == 45) - goto state_77; + goto state_76; if (ch.unicode() >= 48 && ch.unicode() <= 57) - goto state_77; + goto state_76; if (ch.unicode() == 92) - goto state_78; - if (ch.unicode() == 95) goto state_77; + if (ch.unicode() == 95) + goto state_76; if ((ch.unicode() >= 'a' && ch.unicode() <= 'z') || (ch.unicode() >= 'A' && ch.unicode() <= 'Z') || ch.unicode() >= 256) - goto state_77; + goto state_76; goto out; state_89: lastAcceptingPos = pos; @@ -1176,4 +1176,3 @@ int QCssScanner_Generated::lex() } return token; } - diff --git a/src/gui/text/qdistancefield.cpp b/src/gui/text/qdistancefield.cpp index e7ca00b3a9..82bb617733 100644 --- a/src/gui/text/qdistancefield.cpp +++ b/src/gui/text/qdistancefield.cpp @@ -3,7 +3,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtDeclarative module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/text/qdistancefield_p.h b/src/gui/text/qdistancefield_p.h index 27ab84332c..1a1b6866a2 100644 --- a/src/gui/text/qdistancefield_p.h +++ b/src/gui/text/qdistancefield_p.h @@ -3,7 +3,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtDeclarative module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage @@ -72,7 +72,7 @@ int Q_GUI_EXPORT QT_DISTANCEFIELD_HIGHGLYPHCOUNT(); class Q_GUI_EXPORT QDistanceFieldData : public QSharedData { public: - QDistanceFieldData() : glyph(0), width(0), height(0), nbytes(0), data(0) {} + QDistanceFieldData() : glyph(0), width(0), height(0), nbytes(0), data(nullptr) {} QDistanceFieldData(const QDistanceFieldData &other); ~QDistanceFieldData(); diff --git a/src/gui/text/qfont.cpp b/src/gui/text/qfont.cpp index a23ef95fde..164a2f60ab 100644 --- a/src/gui/text/qfont.cpp +++ b/src/gui/text/qfont.cpp @@ -116,7 +116,17 @@ bool QFontDef::exactMatch(const QFontDef &other) const if (stretch != 0 && other.stretch != 0 && stretch != other.stretch) return false; + if (families.size() != other.families.size()) + return false; + QString this_family, this_foundry, other_family, other_foundry; + for (int i = 0; i < families.size(); ++i) { + QFontDatabase::parseFontName(families.at(i), this_foundry, this_family); + QFontDatabase::parseFontName(other.families.at(i), other_foundry, other_family); + if (this_family != other_family || this_foundry != other_foundry) + return false; + } + QFontDatabase::parseFontName(family, this_foundry, this_family); QFontDatabase::parseFontName(other.family, other_foundry, other_family); @@ -261,6 +271,9 @@ void QFontPrivate::resolve(uint mask, const QFontPrivate *other) if (! (mask & QFont::FamilyResolved)) request.family = other->request.family; + if (!(mask & QFont::FamiliesResolved)) + request.families = other->request.families; + if (! (mask & QFont::StyleNameResolved)) request.styleName = other->request.styleName; @@ -424,7 +437,8 @@ QFontEngineData::~QFontEngineData() \target fontmatching The font matching algorithm works as follows: \list 1 - \li If the specified font family exists and can be used to represent + \li The specified font families (set by setFamilies()) are searched for. + \li If not found, then if set the specified font family exists and can be used to represent the writing system in use, it will be selected. \li If not, a replacement font that supports the writing system is selected. The font matching algorithm will try to find the @@ -506,6 +520,7 @@ QFontEngineData::~QFontEngineData() individually and then considered resolved. \value FamilyResolved + \value FamiliesResolved \value SizeResolved \value StyleHintResolved \value StyleStrategyResolved @@ -547,14 +562,25 @@ QFontEngineData::~QFontEngineData() \since 5.2 */ +#if QT_VERSION < QT_VERSION_CHECK(6, 0, 0) /*! + \obsolete Constructs a font from \a font for use on the paint device \a pd. */ QFont::QFont(const QFont &font, QPaintDevice *pd) + : QFont(font, static_cast<const QPaintDevice*>(pd)) +{} +#endif + +/*! + \since 5.13 + Constructs a font from \a font for use on the paint device \a pd. +*/ +QFont::QFont(const QFont &font, const QPaintDevice *pd) : resolve_mask(font.resolve_mask) { - Q_ASSERT(pd != 0); - int dpi = pd->logicalDpiY(); + Q_ASSERT(pd); + const int dpi = pd->logicalDpiY(); const int screen = 0; if (font.d->dpi != dpi || font.d->screen != screen ) { d = new QFontPrivate(*font.d); @@ -1261,7 +1287,7 @@ QFont::StyleStrategy QFont::styleStrategy() const /*! Returns the StyleHint. - The style hint affects the \l{#fontmatching}{font matching algorithm}. + The style hint affects the \l{QFont#fontmatching}{font matching algorithm}. See \l QFont::StyleHint for the list of available hints. \sa setStyleHint(), QFont::StyleStrategy, QFontInfo::styleHint() @@ -1691,6 +1717,7 @@ bool QFont::operator<(const QFont &f) const if (r1.stretch != r2.stretch) return r1.stretch < r2.stretch; if (r1.styleHint != r2.styleHint) return r1.styleHint < r2.styleHint; if (r1.styleStrategy != r2.styleStrategy) return r1.styleStrategy < r2.styleStrategy; + if (r1.families != r2.families) return r1.families < r2.families; if (r1.family != r2.family) return r1.family < r2.family; if (f.d->capital != d->capital) return f.d->capital < d->capital; @@ -2056,7 +2083,7 @@ QString QFont::toString() const \relates QFont \since 5.3 */ -uint qHash(const QFont &font, uint seed) Q_DECL_NOTHROW +uint qHash(const QFont &font, uint seed) noexcept { return qHash(QFontPrivate::get(font)->request, seed); } @@ -2153,7 +2180,7 @@ void QFont::cacheStatistics() */ QString QFont::lastResortFamily() const { - return QString::fromLatin1("helvetica"); + return QStringLiteral("helvetica"); } #endif @@ -2188,10 +2215,55 @@ QString QFont::defaultFamily() const */ QString QFont::lastResortFont() const { +QT_WARNING_PUSH +QT_WARNING_DISABLE_DEPRECATED return lastResortFamily(); +QT_WARNING_POP } #endif +/*! + \since 5.13 + + Returns the requested font family names, i.e. the names set in the last + setFamilies() call or via the constructor. Otherwise it returns an + empty list. + + \sa setFamily(), setFamilies(), family(), substitutes(), substitute() +*/ + +QStringList QFont::families() const +{ + return d->request.families; +} + +/*! + \since 5.13 + + Sets the list of family names for the font. The names are case + insensitive and may include a foundry name. The first family in + \a families will be set as the main family for the font. + + Each family name entry in \a families may optionally also include a + foundry name, e.g. "Helvetica [Cronyx]". If the family is + available from more than one foundry and the foundry isn't + specified, an arbitrary foundry is chosen. If the family isn't + available a family will be set using the \l{QFont}{font matching} + algorithm. + + \sa family(), families(), setFamily(), setStyleHint(), QFontInfo +*/ + +void QFont::setFamilies(const QStringList &families) +{ + if ((resolve_mask & QFont::FamiliesResolved) && d->request.families == families) + return; + detach(); + d->request.families = families; + resolve_mask |= QFont::FamiliesResolved; +} + + /***************************************************************************** QFont stream functions *****************************************************************************/ @@ -2256,6 +2328,8 @@ QDataStream &operator<<(QDataStream &s, const QFont &font) s << (quint8)font.d->request.hintingPreference; if (s.version() >= QDataStream::Qt_5_6) s << (quint8)font.d->capital; + if (s.version() >= QDataStream::Qt_5_13) + s << font.d->request.families; return s; } @@ -2351,6 +2425,11 @@ QDataStream &operator>>(QDataStream &s, QFont &font) s >> value; font.d->capital = QFont::Capitalization(value); } + if (s.version() >= QDataStream::Qt_5_13) { + QStringList value; + s >> value; + font.d->request.families = value; + } return s; } @@ -2874,9 +2953,9 @@ void QFontCache::insertEngine(const Key &key, QFontEngine *engine, bool insertMu data.timestamp = ++current_timestamp; if (insertMulti) - engineCache.insertMulti(key, data); - else engineCache.insert(key, data); + else + engineCache.replace(key, data); // only increase the cost if this is the first time we insert the engine if (++engineCacheCount[engine] == 1) increaseCost(engine->cache_cost); @@ -3085,7 +3164,104 @@ void QFontCache::decreaseCache() #ifndef QT_NO_DEBUG_STREAM QDebug operator<<(QDebug stream, const QFont &font) { - return stream << "QFont(" << font.toString() << ')'; + QDebugStateSaver saver(stream); + stream.nospace().noquote(); + stream << "QFont("; + + if (stream.verbosity() == QDebug::DefaultVerbosity) { + stream << font.toString() << ")"; + return stream; + } + + QString fontDescription; + QDebug debug(&fontDescription); + debug.nospace(); + + QFontPrivate priv; + const QFont defaultFont(&priv); + + for (int property = QFont::FamilyResolved; property < QFont::AllPropertiesResolved; property <<= 1) { + const bool resolved = (font.resolve_mask & property) != 0; + if (!resolved && stream.verbosity() == QDebug::MinimumVerbosity) + continue; + + #define QFONT_DEBUG_SKIP_DEFAULT(prop) \ + if ((font.prop() == defaultFont.prop()) && stream.verbosity() == 1) \ + continue; + + QDebugStateSaver saver(debug); + + switch (property) { + case QFont::FamilyResolved: + debug << font.family(); break; + case QFont::SizeResolved: + if (font.pointSizeF() >= 0) + debug << font.pointSizeF() << "pt"; + else if (font.pixelSize() >= 0) + debug << font.pixelSize() << "px"; + else + Q_UNREACHABLE(); + break; + case QFont::StyleHintResolved: + QFONT_DEBUG_SKIP_DEFAULT(styleHint); + debug.verbosity(1) << font.styleHint(); break; + case QFont::StyleStrategyResolved: + QFONT_DEBUG_SKIP_DEFAULT(styleStrategy); + debug.verbosity(1) << font.styleStrategy(); break; + case QFont::WeightResolved: + debug.verbosity(1) << QFont::Weight(font.weight()); break; + case QFont::StyleResolved: + QFONT_DEBUG_SKIP_DEFAULT(style); + debug.verbosity(0) << font.style(); break; + case QFont::UnderlineResolved: + QFONT_DEBUG_SKIP_DEFAULT(underline); + debug << "underline=" << font.underline(); break; + case QFont::OverlineResolved: + QFONT_DEBUG_SKIP_DEFAULT(overline); + debug << "overline=" << font.overline(); break; + case QFont::StrikeOutResolved: + QFONT_DEBUG_SKIP_DEFAULT(strikeOut); + debug << "strikeOut=" << font.strikeOut(); break; + case QFont::FixedPitchResolved: + QFONT_DEBUG_SKIP_DEFAULT(fixedPitch); + debug << "fixedPitch=" << font.fixedPitch(); break; + case QFont::StretchResolved: + QFONT_DEBUG_SKIP_DEFAULT(stretch); + debug.verbosity(0) << QFont::Stretch(font.stretch()); break; + case QFont::KerningResolved: + QFONT_DEBUG_SKIP_DEFAULT(kerning); + debug << "kerning=" << font.kerning(); break; + case QFont::CapitalizationResolved: + QFONT_DEBUG_SKIP_DEFAULT(capitalization); + debug.verbosity(0) << font.capitalization(); break; + case QFont::LetterSpacingResolved: + QFONT_DEBUG_SKIP_DEFAULT(letterSpacing); + debug << "letterSpacing=" << font.letterSpacing(); + debug.verbosity(0) << " (" << font.letterSpacingType() << ")"; + break; + case QFont::HintingPreferenceResolved: + QFONT_DEBUG_SKIP_DEFAULT(hintingPreference); + debug.verbosity(0) << font.hintingPreference(); break; + case QFont::StyleNameResolved: + QFONT_DEBUG_SKIP_DEFAULT(styleName); + debug << "styleName=" << font.styleName(); break; + default: + continue; + }; + + #undef QFONT_DEBUG_SKIP_DEFAULT + + debug << ", "; + } + + if (stream.verbosity() > QDebug::MinimumVerbosity) + debug.verbosity(0) << "resolveMask=" << QFlags<QFont::ResolveProperties>(font.resolve_mask); + else + fontDescription.chop(2); // Last ', ' + + stream << fontDescription << ')'; + + return stream; } #endif diff --git a/src/gui/text/qfont.h b/src/gui/text/qfont.h index a94586166e..16685ed9e8 100644 --- a/src/gui/text/qfont.h +++ b/src/gui/text/qfont.h @@ -147,6 +147,7 @@ public: Q_ENUM(SpacingType) enum ResolveProperties { + NoPropertiesResolved = 0x0000, FamilyResolved = 0x0001, SizeResolved = 0x0002, StyleHintResolved = 0x0004, @@ -164,13 +165,18 @@ public: WordSpacingResolved = 0x4000, HintingPreferenceResolved = 0x8000, StyleNameResolved = 0x10000, - AllPropertiesResolved = 0x1ffff + FamiliesResolved = 0x20000, + AllPropertiesResolved = 0x3ffff }; + Q_ENUM(ResolveProperties) QFont(); QFont(const QString &family, int pointSize = -1, int weight = -1, bool italic = false); - QFont(const QFont &, QPaintDevice *pd); - QFont(const QFont &); +#if QT_VERSION < QT_VERSION_CHECK(6, 0, 0) + QFont(const QFont &font, QPaintDevice *pd); +#endif + QFont(const QFont &font, const QPaintDevice *pd); + QFont(const QFont &font); ~QFont(); void swap(QFont &other) @@ -179,6 +185,9 @@ public: QString family() const; void setFamily(const QString &); + QStringList families() const; + void setFamilies(const QStringList &); + QString styleName() const; void setStyleName(const QString &); @@ -253,7 +262,7 @@ public: operator QVariant() const; bool isCopyOf(const QFont &) const; #ifdef Q_COMPILER_RVALUE_REFS - inline QFont &operator=(QFont &&other) Q_DECL_NOEXCEPT + inline QFont &operator=(QFont &&other) noexcept { qSwap(d, other.d); qSwap(resolve_mask, other.resolve_mask); return *this; } #endif @@ -328,13 +337,17 @@ private: friend Q_GUI_EXPORT QDataStream &operator>>(QDataStream &, QFont &); #endif +#ifndef QT_NO_DEBUG_STREAM + friend Q_GUI_EXPORT QDebug operator<<(QDebug, const QFont &); +#endif + QExplicitlySharedDataPointer<QFontPrivate> d; uint resolve_mask; }; Q_DECLARE_SHARED(QFont) -Q_GUI_EXPORT uint qHash(const QFont &font, uint seed = 0) Q_DECL_NOTHROW; +Q_GUI_EXPORT uint qHash(const QFont &font, uint seed = 0) noexcept; inline bool QFont::bold() const { return weight() > Medium; } diff --git a/src/gui/text/qfont_p.h b/src/gui/text/qfont_p.h index 350ba7ce3c..db74ab0b65 100644 --- a/src/gui/text/qfont_p.h +++ b/src/gui/text/qfont_p.h @@ -78,6 +78,7 @@ struct QFontDef } QString family; + QStringList families; QString styleName; QStringList fallBackFamilies; @@ -109,6 +110,7 @@ struct QFontDef && styleStrategy == other.styleStrategy && ignorePitch == other.ignorePitch && fixedPitch == other.fixedPitch && family == other.family + && families == other.families && styleName == other.styleName && hintingPreference == other.hintingPreference ; @@ -122,6 +124,7 @@ struct QFontDef if (styleHint != other.styleHint) return styleHint < other.styleHint; if (styleStrategy != other.styleStrategy) return styleStrategy < other.styleStrategy; if (family != other.family) return family < other.family; + if (families != other.families) return families < other.families; if (styleName != other.styleName) return styleName < other.styleName; if (hintingPreference != other.hintingPreference) return hintingPreference < other.hintingPreference; @@ -133,7 +136,7 @@ struct QFontDef } }; -inline uint qHash(const QFontDef &fd, uint seed = 0) Q_DECL_NOTHROW +inline uint qHash(const QFontDef &fd, uint seed = 0) noexcept { return qHash(qRound64(fd.pixelSize*10000)) // use only 4 fractional digits ^ qHash(fd.weight) @@ -144,6 +147,7 @@ inline uint qHash(const QFontDef &fd, uint seed = 0) Q_DECL_NOTHROW ^ qHash(fd.ignorePitch) ^ qHash(fd.fixedPitch) ^ qHash(fd.family, seed) + ^ qHash(fd.families, seed) ^ qHash(fd.styleName) ^ qHash(fd.hintingPreference) ; @@ -161,7 +165,7 @@ public: QFontEngine *engines[QChar::ScriptCount]; private: - Q_DISABLE_COPY(QFontEngineData) + Q_DISABLE_COPY_MOVE(QFontEngineData) }; @@ -210,7 +214,7 @@ private: }; -class Q_AUTOTEST_EXPORT QFontCache : public QObject +class Q_GUI_EXPORT QFontCache : public QObject { public: // note: these static functions work on a per-thread basis @@ -262,7 +266,7 @@ public: // QFontEngine cache struct Engine { - Engine() : data(0), timestamp(0), hits(0) { } + Engine() : data(nullptr), timestamp(0), hits(0) { } Engine(QFontEngine *d) : data(d), timestamp(0), hits(0) { } QFontEngine *data; @@ -270,7 +274,7 @@ public: uint hits; }; - typedef QMap<Key,Engine> EngineCache; + typedef QMultiMap<Key,Engine> EngineCache; EngineCache engineCache; QHash<QFontEngine *, int> engineCacheCount; diff --git a/src/gui/text/qfontdatabase.cpp b/src/gui/text/qfontdatabase.cpp index 196eebb353..82e40510ae 100644 --- a/src/gui/text/qfontdatabase.cpp +++ b/src/gui/text/qfontdatabase.cpp @@ -434,7 +434,7 @@ struct FallbacksCacheKey { QChar::Script script; }; -inline bool operator==(const FallbacksCacheKey &lhs, const FallbacksCacheKey &rhs) Q_DECL_NOTHROW +inline bool operator==(const FallbacksCacheKey &lhs, const FallbacksCacheKey &rhs) noexcept { return lhs.script == rhs.script && lhs.styleHint == rhs.styleHint && @@ -442,12 +442,12 @@ inline bool operator==(const FallbacksCacheKey &lhs, const FallbacksCacheKey &rh lhs.family == rhs.family; } -inline bool operator!=(const FallbacksCacheKey &lhs, const FallbacksCacheKey &rhs) Q_DECL_NOTHROW +inline bool operator!=(const FallbacksCacheKey &lhs, const FallbacksCacheKey &rhs) noexcept { return !operator==(lhs, rhs); } -inline uint qHash(const FallbacksCacheKey &key, uint seed = 0) Q_DECL_NOTHROW +inline uint qHash(const FallbacksCacheKey &key, uint seed = 0) noexcept { QtPrivate::QHashCombine hash; seed = hash(seed, key.family); @@ -696,20 +696,20 @@ static QStringList familyList(const QFontDef &req) { // list of families to try QStringList family_list; - if (req.family.isEmpty()) - return family_list; - const auto list = req.family.splitRef(QLatin1Char(',')); - const int numFamilies = list.size(); - family_list.reserve(numFamilies); - for (int i = 0; i < numFamilies; ++i) { - QStringRef str = list.at(i).trimmed(); - if ((str.startsWith(QLatin1Char('"')) && str.endsWith(QLatin1Char('"'))) - || (str.startsWith(QLatin1Char('\'')) && str.endsWith(QLatin1Char('\'')))) - str = str.mid(1, str.length() - 2); - family_list << str.toString(); + family_list << req.families; + if (!req.family.isEmpty()) { + const auto list = req.family.splitRef(QLatin1Char(',')); + const int numFamilies = list.size(); + family_list.reserve(numFamilies); + for (int i = 0; i < numFamilies; ++i) { + QStringRef str = list.at(i).trimmed(); + if ((str.startsWith(QLatin1Char('"')) && str.endsWith(QLatin1Char('"'))) + || (str.startsWith(QLatin1Char('\'')) && str.endsWith(QLatin1Char('\'')))) + str = str.mid(1, str.length() - 2); + family_list << str.toString(); + } } - // append the substitute list for each family in family_list for (int i = 0, size = family_list.size(); i < size; ++i) family_list += QFont::substitutes(family_list.at(i)); @@ -2688,9 +2688,8 @@ QFontEngine *QFontDatabase::findFont(const QFontDef &request, int script) } QString family_name, foundry_name; - - parseFontName(request.family, foundry_name, family_name); - + const QString requestFamily = request.families.size() > 0 ? request.families.at(0) : request.family; + parseFontName(requestFamily, foundry_name, family_name); QtFontDesc desc; QList<int> blackListed; int index = match(multi ? QChar::Script_Common : script, request, family_name, foundry_name, &desc, blackListed); @@ -2703,8 +2702,8 @@ QFontEngine *QFontDatabase::findFont(const QFontDef &request, int script) // Don't pass empty family names to the platform font database, since it will then invoke its own matching // and we will be out of sync with the matched font. - if (fontDef.family.isEmpty()) - fontDef.family = desc.family->name; + if (fontDef.families.isEmpty() && fontDef.family.isEmpty()) + fontDef.families = QStringList(desc.family->name); engine = loadEngine(script, fontDef, desc.family, desc.foundry, desc.style, desc.size); @@ -2717,13 +2716,13 @@ QFontEngine *QFontDatabase::findFont(const QFontDef &request, int script) } if (!engine) { - if (!request.family.isEmpty()) { + if (!requestFamily.isEmpty()) { QFont::StyleHint styleHint = QFont::StyleHint(request.styleHint); if (styleHint == QFont::AnyStyle && request.fixedPitch) styleHint = QFont::TypeWriter; QStringList fallbacks = request.fallBackFamilies - + fallbacksForFamily(request.family, + + fallbacksForFamily(requestFamily, QFont::Style(request.style), styleHint, QChar::Script(script)); @@ -2741,7 +2740,7 @@ QFontEngine *QFontDatabase::findFont(const QFontDef &request, int script) index = match(multi ? QChar::Script_Common : script, def, def.family, QLatin1String(""), &desc, blackListed); if (index >= 0) { QFontDef loadDef = def; - if (loadDef.family.isEmpty()) + if (loadDef.families.isEmpty() && loadDef.family.isEmpty()) loadDef.family = desc.family->name; engine = loadEngine(script, loadDef, desc.family, desc.foundry, desc.style, desc.size); if (engine) @@ -2782,7 +2781,10 @@ void QFontDatabase::load(const QFontPrivate *d, int script) // look for the requested font in the engine data cache // note: fallBackFamilies are not respected in the EngineData cache key; // join them with the primary selection family to avoid cache misses - req.family = fallBackFamilies.join(QLatin1Char(',')); + if (!d->request.family.isEmpty()) + req.family = fallBackFamilies.join(QLatin1Char(',')); + if (!d->request.families.isEmpty()) + req.families = fallBackFamilies; d->engineData = fontCache->findEngineData(req); if (!d->engineData) { @@ -2803,14 +2805,14 @@ void QFontDatabase::load(const QFontPrivate *d, int script) req.fallBackFamilies = fallBackFamilies; if (!req.fallBackFamilies.isEmpty()) - req.family = req.fallBackFamilies.takeFirst(); + req.families = QStringList(req.fallBackFamilies.takeFirst()); // list of families to try QStringList family_list; - if (!req.family.isEmpty()) { + if (!req.families.isEmpty()) { // Add primary selection - family_list << req.family; + family_list << req.families.at(0); // add the default family QString defaultFamily = QGuiApplication::font().family(); @@ -2824,11 +2826,11 @@ void QFontDatabase::load(const QFontPrivate *d, int script) QStringList::ConstIterator it = family_list.constBegin(), end = family_list.constEnd(); for (; !fe && it != end; ++it) { - req.family = *it; + req.families = QStringList(*it); fe = QFontDatabase::findFont(req, script); if (fe) { - if (fe->type() == QFontEngine::Box && !req.family.isEmpty()) { + if (fe->type() == QFontEngine::Box && !req.families.at(0).isEmpty()) { if (fe->ref.load() == 0) delete fe; fe = 0; diff --git a/src/gui/text/qfontdatabase.h b/src/gui/text/qfontdatabase.h index e6aef493bd..80b092f177 100644 --- a/src/gui/text/qfontdatabase.h +++ b/src/gui/text/qfontdatabase.h @@ -160,8 +160,8 @@ private: static void createDatabase(); static void parseFontName(const QString &name, QString &foundry, QString &family); static QString resolveFontFamilyAlias(const QString &family); - static QFontEngine *findFont(const QFontDef &request, int script); - static void load(const QFontPrivate *d, int script); + static QFontEngine *findFont(const QFontDef &request, int script /* QChar::Script */); + static void load(const QFontPrivate *d, int script /* QChar::Script */); friend struct QFontDef; friend class QFontPrivate; diff --git a/src/gui/text/qfontengine.cpp b/src/gui/text/qfontengine.cpp index 64623c86df..1719855e68 100644 --- a/src/gui/text/qfontengine.cpp +++ b/src/gui/text/qfontengine.cpp @@ -1022,8 +1022,8 @@ void QFontEngine::getUnscaledGlyph(glyph_t glyph, QPainterPath *path, glyph_metr Returns \c true if the font table idetified by \a tag exists in the font; returns \c false otherwise. - If \a buffer is NULL, stores the size of the buffer required for the font table data, - in bytes, in \a length. If \a buffer is not NULL and the capacity + If \a buffer is \nullptr, stores the size of the buffer required for the font table data, + in bytes, in \a length. If \a buffer is not \nullptr and the capacity of the buffer, passed in \a length, is sufficient to store the font table data, also copies the font table data to \a buffer. @@ -1755,7 +1755,7 @@ QImage QFontEngineBox::alphaMapForGlyph(glyph_t) // Multi engine // ------------------------------------------------------------------ -static inline uchar highByte(glyph_t glyph) +uchar QFontEngineMulti::highByte(glyph_t glyph) { return glyph >> 24; } // strip high byte from glyph @@ -1843,13 +1843,14 @@ QFontEngine *QFontEngineMulti::loadEngine(int at) QFontDef request(fontDef); request.styleStrategy |= QFont::NoFontMerging; request.family = fallbackFamilyAt(at - 1); + request.families = QStringList(request.family); // At this point, the main script of the text has already been considered // when fetching the list of fallback families from the database, and the // info about the actual script of the characters may have been discarded, // so we do not check for writing system support, but instead just load // the family indiscriminately. - if (QFontEngine *engine = QFontDatabase::findFont(request, QFontDatabase::Any)) { + if (QFontEngine *engine = QFontDatabase::findFont(request, QChar::Script_Common)) { engine->fontDef.weight = request.weight; if (request.style > QFont::StyleNormal) engine->fontDef.style = request.style; diff --git a/src/gui/text/qfontengine_p.h b/src/gui/text/qfontengine_p.h index a411e9ce4c..b922d50b4c 100644 --- a/src/gui/text/qfontengine_p.h +++ b/src/gui/text/qfontengine_p.h @@ -194,7 +194,7 @@ public: virtual QImage *lockedAlphaMapForGlyph(glyph_t glyph, QFixed subPixelPosition, GlyphFormat neededFormat, const QTransform &t = QTransform(), - QPoint *offset = 0); + QPoint *offset = nullptr); virtual void unlockAlphaMapForGlyph(); virtual bool hasInternalCaching() const { return false; } @@ -224,7 +224,7 @@ public: virtual qreal minLeftBearing() const; virtual qreal minRightBearing() const; - virtual void getGlyphBearings(glyph_t glyph, qreal *leftBearing = 0, qreal *rightBearing = 0); + virtual void getGlyphBearings(glyph_t glyph, qreal *leftBearing = nullptr, qreal *rightBearing = nullptr); inline bool canRender(uint ucs4) const { return glyphIndex(ucs4) != 0; } virtual bool canRender(const QChar *str, int len) const; @@ -234,7 +234,7 @@ public: virtual int glyphCount() const; virtual int glyphMargin(GlyphFormat format) { return format == Format_A32 ? 2 : 0; } - virtual QFontEngine *cloneWithSize(qreal /*pixelSize*/) const { return 0; } + virtual QFontEngine *cloneWithSize(qreal /*pixelSize*/) const { return nullptr; } virtual Qt::HANDLE handle() const; @@ -292,33 +292,33 @@ public: Holder() : ptr(nullptr), destroy_func(nullptr) {} explicit Holder(void *p, qt_destroy_func_t d) : ptr(p), destroy_func(d) {} ~Holder() { if (ptr && destroy_func) destroy_func(ptr); } - Holder(Holder &&other) Q_DECL_NOTHROW + Holder(Holder &&other) noexcept : ptr(other.ptr), destroy_func(other.destroy_func) { other.ptr = nullptr; other.destroy_func = nullptr; } - Holder &operator=(Holder &&other) Q_DECL_NOTHROW + Holder &operator=(Holder &&other) noexcept { swap(other); return *this; } - void swap(Holder &other) Q_DECL_NOTHROW + void swap(Holder &other) noexcept { qSwap(ptr, other.ptr); qSwap(destroy_func, other.destroy_func); } - void *get() const Q_DECL_NOTHROW { return ptr; } - void *release() Q_DECL_NOTHROW { + void *get() const noexcept { return ptr; } + void *release() noexcept { void *result = ptr; ptr = nullptr; destroy_func = nullptr; return result; } - void reset() Q_DECL_NOTHROW { Holder().swap(*this); } - qt_destroy_func_t get_deleter() const Q_DECL_NOTHROW { return destroy_func; } + void reset() noexcept { Holder().swap(*this); } + qt_destroy_func_t get_deleter() const noexcept { return destroy_func; } - bool operator!() const Q_DECL_NOTHROW { return !ptr; } + bool operator!() const noexcept { return !ptr; } }; mutable Holder font_; // \ NOTE: Declared before m_glyphCaches, so font_, face_ @@ -390,7 +390,7 @@ inline bool operator ==(const QFontEngine::FaceId &f1, const QFontEngine::FaceId } inline uint qHash(const QFontEngine::FaceId &f, uint seed = 0) - Q_DECL_NOEXCEPT_EXPR(noexcept(qHash(f.filename))) + noexcept(noexcept(qHash(f.filename))) { QtPrivate::QHashCombine hash; seed = hash(seed, f.filename); @@ -458,7 +458,7 @@ public: virtual void recalcAdvances(QGlyphLayout *, ShaperFlags) const override; virtual void doKerning(QGlyphLayout *, ShaperFlags) const override; virtual void addOutlineToPath(qreal, qreal, const QGlyphLayout &, QPainterPath *, QTextItem::RenderFlags flags) override; - virtual void getGlyphBearings(glyph_t glyph, qreal *leftBearing = 0, qreal *rightBearing = 0) override; + virtual void getGlyphBearings(glyph_t glyph, qreal *leftBearing = nullptr, qreal *rightBearing = nullptr) override; virtual QFixed ascent() const override; virtual QFixed capHeight() const override; @@ -485,6 +485,8 @@ public: void setFallbackFamiliesList(const QStringList &fallbackFamilies); + static uchar highByte(glyph_t glyph); // Used for determining engine + inline QFontEngine *engine(int at) const { Q_ASSERT(at < m_engines.size()); return m_engines.at(at); } diff --git a/src/gui/text/qfontmetrics.cpp b/src/gui/text/qfontmetrics.cpp index 407559ad51..c8dc8d676e 100644 --- a/src/gui/text/qfontmetrics.cpp +++ b/src/gui/text/qfontmetrics.cpp @@ -156,6 +156,8 @@ QFontMetrics::QFontMetrics(const QFont &font) } /*! + \since 5.13 + \fn QFontMetrics::QFontMetrics(const QFont &font, const QPaintDevice *paintdevice) Constructs a font metrics object for \a font and \a paintdevice. The font metrics will be compatible with the paintdevice passed. @@ -168,9 +170,21 @@ QFontMetrics::QFontMetrics(const QFont &font) passed in the constructor at the time it is created, and is not updated if the font's attributes are changed later. */ + +#if QT_VERSION < QT_VERSION_CHECK(6, 0, 0) +/*! + \fn QFontMetrics::QFontMetrics(const QFont &font, QPaintDevice *paintdevice) + \obsolete + Identical to QFontMetrics::QFontMetrics(const QFont &font, const QPaintDevice *paintdevice) +*/ + + QFontMetrics::QFontMetrics(const QFont &font, QPaintDevice *paintdevice) +#else +QFontMetrics::QFontMetrics(const QFont &font, const QPaintDevice *paintdevice) +#endif { - int dpi = paintdevice ? paintdevice->logicalDpiY() : qt_defaultDpi(); + const int dpi = paintdevice ? paintdevice->logicalDpiY() : qt_defaultDpi(); const int screen = 0; if (font.d->dpi != dpi || font.d->screen != screen ) { d = new QFontPrivate(*font.d); @@ -1127,6 +1141,8 @@ QFontMetricsF::QFontMetricsF(const QFont &font) } /*! + \fn QFontMetricsF::QFontMetricsF(const QFont &font, const QPaintDevice *paintdevice) + \since 5.13 Constructs a font metrics object for \a font and \a paintdevice. The font metrics will be compatible with the paintdevice passed. @@ -1139,7 +1155,20 @@ QFontMetricsF::QFontMetricsF(const QFont &font) passed in the constructor at the time it is created, and is not updated if the font's attributes are changed later. */ + + +#if QT_VERSION < QT_VERSION_CHECK(6, 0, 0) +/*! + \fn QFontMetricsF::QFontMetricsF(const QFont &font, QPaintDevice *paintdevice) + \obsolete + Identical to QFontMetricsF::QFontMetricsF(const QFont &font, const QPaintDevice *paintdevice) +*/ + + QFontMetricsF::QFontMetricsF(const QFont &font, QPaintDevice *paintdevice) +#else +QFontMetricsF::QFontMetricsF(const QFont &font, const QPaintDevice *paintdevice) +#endif { int dpi = paintdevice ? paintdevice->logicalDpiY() : qt_defaultDpi(); const int screen = 0; diff --git a/src/gui/text/qfontmetrics.h b/src/gui/text/qfontmetrics.h index b6167a1d47..761cadde47 100644 --- a/src/gui/text/qfontmetrics.h +++ b/src/gui/text/qfontmetrics.h @@ -59,17 +59,29 @@ class Q_GUI_EXPORT QFontMetrics { public: explicit QFontMetrics(const QFont &); - QFontMetrics(const QFont &, QPaintDevice *pd); +#if QT_VERSION < QT_VERSION_CHECK(6, 0, 0) + QFontMetrics(const QFont &font, QPaintDevice *pd); +#ifndef Q_QDOC + // the template is necessary to make QFontMetrics(font,nullptr) and QFontMetrics(font,NULL) + // not ambiguous. Implementation detail that should not be documented. + template<char = 0> +#endif + QFontMetrics(const QFont &font, const QPaintDevice *pd) + : QFontMetrics(font, const_cast<QPaintDevice*>(pd)) + {} +#else + QFontMetrics(const QFont &font, const QPaintDevice *pd); +#endif QFontMetrics(const QFontMetrics &); ~QFontMetrics(); QFontMetrics &operator=(const QFontMetrics &); #ifdef Q_COMPILER_RVALUE_REFS - inline QFontMetrics &operator=(QFontMetrics &&other) Q_DECL_NOEXCEPT + inline QFontMetrics &operator=(QFontMetrics &&other) noexcept { qSwap(d, other.d); return *this; } #endif - void swap(QFontMetrics &other) Q_DECL_NOEXCEPT + void swap(QFontMetrics &other) noexcept { qSwap(d, other.d); } int ascent() const; @@ -92,8 +104,11 @@ public: int rightBearing(QChar) const; #if QT_DEPRECATED_SINCE(5, 11) + QT_DEPRECATED_X("Use QFontMetrics::horizontalAdvance") int width(const QString &, int len = -1) const; + QT_DEPRECATED_X("Use QFontMetrics::horizontalAdvance") int width(const QString &, int len, int flags) const; + QT_DEPRECATED_X("Use QFontMetrics::horizontalAdvance") int width(QChar) const; #endif @@ -137,8 +152,20 @@ Q_DECLARE_SHARED(QFontMetrics) class Q_GUI_EXPORT QFontMetricsF { public: - explicit QFontMetricsF(const QFont &); - QFontMetricsF(const QFont &, QPaintDevice *pd); + explicit QFontMetricsF(const QFont &font); +#if QT_VERSION < QT_VERSION_CHECK(6, 0, 0) + QFontMetricsF(const QFont &font, QPaintDevice *pd); +#ifndef Q_QDOC + // the template is necessary to make QFontMetrics(font,nullptr) and QFontMetrics(font,NULL) + // not ambiguous. Implementation detail that should not be documented. + template<char = 0> +#endif + QFontMetricsF(const QFont &font, const QPaintDevice *pd) + : QFontMetricsF(font, const_cast<QPaintDevice*>(pd)) + {} +#else + QFontMetricsF(const QFont &font, const QPaintDevice *pd); +#endif QFontMetricsF(const QFontMetrics &); QFontMetricsF(const QFontMetricsF &); ~QFontMetricsF(); diff --git a/src/gui/text/qfragmentmap_p.h b/src/gui/text/qfragmentmap_p.h index 35f60ac961..1d781352f8 100644 --- a/src/gui/text/qfragmentmap_p.h +++ b/src/gui/text/qfragmentmap_p.h @@ -216,7 +216,7 @@ private: template <class Fragment> QFragmentMapData<Fragment>::QFragmentMapData() - : fragments(0) + : fragments(nullptr) { init(); } diff --git a/src/gui/text/qglyphrun.h b/src/gui/text/qglyphrun.h index 6182c4f749..9bb1d3c820 100644 --- a/src/gui/text/qglyphrun.h +++ b/src/gui/text/qglyphrun.h @@ -67,12 +67,12 @@ public: QGlyphRun(); QGlyphRun(const QGlyphRun &other); #ifdef Q_COMPILER_RVALUE_REFS - QGlyphRun &operator=(QGlyphRun &&other) Q_DECL_NOTHROW { swap(other); return *this; } + QGlyphRun &operator=(QGlyphRun &&other) noexcept { swap(other); return *this; } #endif QGlyphRun &operator=(const QGlyphRun &other); ~QGlyphRun(); - void swap(QGlyphRun &other) Q_DECL_NOTHROW { qSwap(d, other.d); } + void swap(QGlyphRun &other) noexcept { qSwap(d, other.d); } QRawFont rawFont() const; void setRawFont(const QRawFont &rawFont); diff --git a/src/gui/text/qglyphrun_p.h b/src/gui/text/qglyphrun_p.h index 5b6bdad648..465c3c7000 100644 --- a/src/gui/text/qglyphrun_p.h +++ b/src/gui/text/qglyphrun_p.h @@ -65,7 +65,7 @@ class QGlyphRunPrivate: public QSharedData { public: QGlyphRunPrivate() - : flags(0) + : flags(nullptr) , glyphIndexData(glyphIndexes.constData()) , glyphIndexDataSize(0) , glyphPositionData(glyphPositions.constData()) diff --git a/src/gui/text/qharfbuzzng.cpp b/src/gui/text/qharfbuzzng.cpp index 36bd81c76b..2f25aea92b 100644 --- a/src/gui/text/qharfbuzzng.cpp +++ b/src/gui/text/qharfbuzzng.cpp @@ -686,13 +686,11 @@ _hb_qt_font_create(QFontEngine *fe) const int x_ppem = (fe->fontDef.pixelSize * fe->fontDef.stretch) / 100; hb_font_set_funcs(font, hb_qt_get_font_funcs(), (void *)fe, NULL); -#ifdef Q_OS_MAC - hb_font_set_scale(font, QFixed(x_ppem).value(), QFixed(y_ppem).value()); -#else hb_font_set_scale(font, QFixed(x_ppem).value(), -QFixed(y_ppem).value()); -#endif hb_font_set_ppem(font, x_ppem, y_ppem); + hb_font_set_ptem(font, fe->fontDef.pointSize); + return font; } diff --git a/src/gui/text/qrawfont.cpp b/src/gui/text/qrawfont.cpp index b2d8bf01af..a060448924 100644 --- a/src/gui/text/qrawfont.cpp +++ b/src/gui/text/qrawfont.cpp @@ -322,7 +322,7 @@ bool QRawFont::operator==(const QRawFont &other) const \relates QRawFont \since 5.8 */ -uint qHash(const QRawFont &font, uint seed) Q_DECL_NOTHROW +uint qHash(const QRawFont &font, uint seed) noexcept { return qHash(QRawFontPrivate::get(font)->fontEngine, seed); } diff --git a/src/gui/text/qrawfont.h b/src/gui/text/qrawfont.h index 470f2694e4..3b84f642d3 100644 --- a/src/gui/text/qrawfont.h +++ b/src/gui/text/qrawfont.h @@ -80,12 +80,12 @@ public: QFont::HintingPreference hintingPreference = QFont::PreferDefaultHinting); QRawFont(const QRawFont &other); #ifdef Q_COMPILER_RVALUE_REFS - QRawFont &operator=(QRawFont &&other) Q_DECL_NOTHROW { swap(other); return *this; } + QRawFont &operator=(QRawFont &&other) noexcept { swap(other); return *this; } #endif QRawFont &operator=(const QRawFont &other); ~QRawFont(); - void swap(QRawFont &other) Q_DECL_NOTHROW { qSwap(d, other.d); } + void swap(QRawFont &other) noexcept { qSwap(d, other.d); } bool isValid() const; @@ -158,7 +158,7 @@ Q_DECLARE_SHARED(QRawFont) Q_DECLARE_OPERATORS_FOR_FLAGS(QRawFont::LayoutFlags) -Q_GUI_EXPORT uint qHash(const QRawFont &font, uint seed = 0) Q_DECL_NOTHROW; +Q_GUI_EXPORT uint qHash(const QRawFont &font, uint seed = 0) noexcept; inline QVector<QPointF> QRawFont::advancesForGlyphIndexes(const QVector<quint32> &glyphIndexes, QRawFont::LayoutFlags layoutFlags) const { diff --git a/src/gui/text/qrawfont_p.h b/src/gui/text/qrawfont_p.h index 0fc8739bfb..dced165475 100644 --- a/src/gui/text/qrawfont_p.h +++ b/src/gui/text/qrawfont_p.h @@ -67,9 +67,9 @@ class Q_GUI_EXPORT QRawFontPrivate { public: QRawFontPrivate() - : fontEngine(0) + : fontEngine(nullptr) , hintingPreference(QFont::PreferDefaultHinting) - , thread(0) + , thread(nullptr) {} QRawFontPrivate(const QRawFontPrivate &other) @@ -78,9 +78,9 @@ public: , thread(other.thread) { #ifndef QT_NO_DEBUG - Q_ASSERT(fontEngine == 0 || thread == QThread::currentThread()); + Q_ASSERT(fontEngine == nullptr || thread == QThread::currentThread()); #endif - if (fontEngine != 0) + if (fontEngine != nullptr) fontEngine->ref.ref(); } @@ -94,37 +94,37 @@ public: inline void cleanUp() { - setFontEngine(0); + setFontEngine(nullptr); hintingPreference = QFont::PreferDefaultHinting; } inline bool isValid() const { #ifndef QT_NO_DEBUG - Q_ASSERT(fontEngine == 0 || thread == QThread::currentThread()); + Q_ASSERT(fontEngine == nullptr || thread == QThread::currentThread()); #endif - return fontEngine != 0; + return fontEngine != nullptr; } inline void setFontEngine(QFontEngine *engine) { #ifndef QT_NO_DEBUG - Q_ASSERT(fontEngine == 0 || thread == QThread::currentThread()); + Q_ASSERT(fontEngine == nullptr || thread == QThread::currentThread()); #endif if (fontEngine == engine) return; - if (fontEngine != 0) { + if (fontEngine != nullptr) { if (!fontEngine->ref.deref()) delete fontEngine; #ifndef QT_NO_DEBUG - thread = 0; + thread = nullptr; #endif } fontEngine = engine; - if (fontEngine != 0) { + if (fontEngine != nullptr) { fontEngine->ref.ref(); #ifndef QT_NO_DEBUG thread = QThread::currentThread(); diff --git a/src/gui/text/qstatictext.cpp b/src/gui/text/qstatictext.cpp index 0026e3edfb..dd894f4d32 100644 --- a/src/gui/text/qstatictext.cpp +++ b/src/gui/text/qstatictext.cpp @@ -3,7 +3,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the test suite of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/text/qstatictext.h b/src/gui/text/qstatictext.h index e6a196d865..c6a0d158c1 100644 --- a/src/gui/text/qstatictext.h +++ b/src/gui/text/qstatictext.h @@ -3,7 +3,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the test suite of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage @@ -65,12 +65,12 @@ public: explicit QStaticText(const QString &text); QStaticText(const QStaticText &other); #ifdef Q_COMPILER_RVALUE_REFS - QStaticText &operator=(QStaticText &&other) Q_DECL_NOTHROW { swap(other); return *this; } + QStaticText &operator=(QStaticText &&other) noexcept { swap(other); return *this; } #endif QStaticText &operator=(const QStaticText &); ~QStaticText(); - void swap(QStaticText &other) Q_DECL_NOTHROW { qSwap(data, other.data); } + void swap(QStaticText &other) noexcept { qSwap(data, other.data); } void setText(const QString &text); QString text() const; diff --git a/src/gui/text/qstatictext_p.h b/src/gui/text/qstatictext_p.h index c4023488ff..8d6792216d 100644 --- a/src/gui/text/qstatictext_p.h +++ b/src/gui/text/qstatictext_p.h @@ -3,7 +3,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the test suite of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage @@ -80,7 +80,7 @@ class Q_GUI_EXPORT QStaticTextItem public: QStaticTextItem() : useBackendOptimizations(false), userDataNeedsUpdate(0), usesRawFont(0), - m_fontEngine(0), m_userData(0) {} + m_fontEngine(nullptr), m_userData(nullptr) {} void setUserData(QStaticTextUserData *newUserData) { diff --git a/src/gui/text/qsyntaxhighlighter.cpp b/src/gui/text/qsyntaxhighlighter.cpp index fcda17605f..cf584f6980 100644 --- a/src/gui/text/qsyntaxhighlighter.cpp +++ b/src/gui/text/qsyntaxhighlighter.cpp @@ -45,6 +45,7 @@ #include <private/qtextdocument_p.h> #include <qtextlayout.h> #include <qpointer.h> +#include <qscopedvaluerollback.h> #include <qtextobject.h> #include <qtextcursor.h> #include <qdebug.h> @@ -68,14 +69,14 @@ public: void reformatBlocks(int from, int charsRemoved, int charsAdded); void reformatBlock(const QTextBlock &block); - inline void rehighlight(QTextCursor &cursor, QTextCursor::MoveOperation operation) { - inReformatBlocks = true; + inline void rehighlight(QTextCursor &cursor, QTextCursor::MoveOperation operation) + { + QScopedValueRollback<bool> bg(inReformatBlocks, true); cursor.beginEditBlock(); int from = cursor.position(); cursor.movePosition(operation); reformatBlocks(from, 0, cursor.position() - from); cursor.endEditBlock(); - inReformatBlocks = false; } inline void _q_delayedRehighlight() { @@ -157,14 +158,12 @@ void QSyntaxHighlighterPrivate::applyFormatChanges() void QSyntaxHighlighterPrivate::_q_reformatBlocks(int from, int charsRemoved, int charsAdded) { - if (!inReformatBlocks) + if (!inReformatBlocks && !rehighlightPending) reformatBlocks(from, charsRemoved, charsAdded); } void QSyntaxHighlighterPrivate::reformatBlocks(int from, int charsRemoved, int charsAdded) { - rehighlightPending = false; - QTextBlock block = doc->findBlock(from); if (!block.isValid()) return; @@ -299,7 +298,7 @@ void QSyntaxHighlighterPrivate::reformatBlock(const QTextBlock &block) QSyntaxHighlighter::QSyntaxHighlighter(QObject *parent) : QObject(*new QSyntaxHighlighterPrivate, parent) { - if (parent->inherits("QTextEdit")) { + if (parent && parent->inherits("QTextEdit")) { QTextDocument *doc = parent->property("document").value<QTextDocument *>(); if (doc) setDocument(doc); @@ -346,8 +345,10 @@ void QSyntaxHighlighter::setDocument(QTextDocument *doc) if (d->doc) { connect(d->doc, SIGNAL(contentsChange(int,int,int)), this, SLOT(_q_reformatBlocks(int,int,int))); - d->rehighlightPending = true; - QTimer::singleShot(0, this, SLOT(_q_delayedRehighlight())); + if (!d->doc->isEmpty()) { + d->rehighlightPending = true; + QTimer::singleShot(0, this, SLOT(_q_delayedRehighlight())); + } } } @@ -376,6 +377,7 @@ void QSyntaxHighlighter::rehighlight() QTextCursor cursor(d->doc); d->rehighlight(cursor, QTextCursor::End); + d->rehighlightPending = false; // user manually did a full rehighlight } /*! diff --git a/src/gui/text/qtextcursor.cpp b/src/gui/text/qtextcursor.cpp index af8fcf369c..c88497840f 100644 --- a/src/gui/text/qtextcursor.cpp +++ b/src/gui/text/qtextcursor.cpp @@ -1145,6 +1145,15 @@ bool QTextCursor::isNull() const \a pos using a \c MoveMode specified by \a m. The cursor is positioned between characters. + \note The "characters" in this case refer to the string of QChar + objects, i.e. 16-bit Unicode characters, and \a pos is considered + an index into this string. This does not necessarily correspond to + individual graphemes in the writing system, as a single grapheme may + be represented by multiple Unicode characters, such as in the case + of surrogate pairs, linguistic ligatures or diacritics. For a more + generic approach to navigating the document, use movePosition(), + which will respect the actual grapheme boundaries in the text. + \sa position(), movePosition(), anchor() */ void QTextCursor::setPosition(int pos, MoveMode m) @@ -1176,6 +1185,13 @@ void QTextCursor::setPosition(int pos, MoveMode m) Returns the absolute position of the cursor within the document. The cursor is positioned between characters. + \note The "characters" in this case refer to the string of QChar + objects, i.e. 16-bit Unicode characters, and the position is considered + an index into this string. This does not necessarily correspond to + individual graphemes in the writing system, as a single grapheme may + be represented by multiple Unicode characters, such as in the case + of surrogate pairs, linguistic ligatures or diacritics. + \sa setPosition(), movePosition(), anchor(), positionInBlock() */ int QTextCursor::position() const @@ -1192,6 +1208,13 @@ int QTextCursor::position() const This is equivalent to \c{ position() - block().position()}. + \note The "characters" in this case refer to the string of QChar + objects, i.e. 16-bit Unicode characters, and the position is considered + an index into this string. This does not necessarily correspond to + individual graphemes in the writing system, as a single grapheme may + be represented by multiple Unicode characters, such as in the case + of surrogate pairs, linguistic ligatures or diacritics. + \sa position() */ int QTextCursor::positionInBlock() const @@ -2116,7 +2139,7 @@ QTextList *QTextCursor::createList(QTextListFormat::Style style) /*! Returns the current list if the cursor position() is inside a - block that is part of a list; otherwise returns 0. + block that is part of a list; otherwise returns \nullptr. \sa insertList(), createList() */ @@ -2176,7 +2199,7 @@ QTextTable *QTextCursor::insertTable(int rows, int cols, const QTextTableFormat /*! Returns a pointer to the current table if the cursor position() - is inside a block that is part of a table; otherwise returns 0. + is inside a block that is part of a table; otherwise returns \nullptr. \sa insertTable() */ @@ -2213,7 +2236,7 @@ QTextFrame *QTextCursor::insertFrame(const QTextFrameFormat &format) } /*! - Returns a pointer to the current frame. Returns 0 if the cursor is invalid. + Returns a pointer to the current frame. Returns \nullptr if the cursor is invalid. \sa insertFrame() */ diff --git a/src/gui/text/qtextcursor.h b/src/gui/text/qtextcursor.h index 1a00b753ad..4a9c614887 100644 --- a/src/gui/text/qtextcursor.h +++ b/src/gui/text/qtextcursor.h @@ -74,12 +74,12 @@ public: explicit QTextCursor(const QTextBlock &block); QTextCursor(const QTextCursor &cursor); #ifdef Q_COMPILER_RVALUE_REFS - QTextCursor &operator=(QTextCursor &&other) Q_DECL_NOTHROW { swap(other); return *this; } + QTextCursor &operator=(QTextCursor &&other) noexcept { swap(other); return *this; } #endif QTextCursor &operator=(const QTextCursor &other); ~QTextCursor(); - void swap(QTextCursor &other) Q_DECL_NOTHROW { qSwap(d, other.d); } + void swap(QTextCursor &other) noexcept { qSwap(d, other.d); } bool isNull() const; diff --git a/src/gui/text/qtextdocument.cpp b/src/gui/text/qtextdocument.cpp index 5d88530e65..fd3473b32e 100644 --- a/src/gui/text/qtextdocument.cpp +++ b/src/gui/text/qtextdocument.cpp @@ -51,7 +51,9 @@ #include <qregularexpression.h> #endif #include <qvarlengtharray.h> +#if QT_CONFIG(textcodec) #include <qtextcodec.h> +#endif #include <qthread.h> #include <qcoreapplication.h> #include <qmetaobject.h> @@ -153,7 +155,7 @@ bool Qt::mightBeRichText(const QString& text) This function is defined in the \c <QTextDocument> header file. - \sa escape(), mightBeRichText() + \sa QString::toHtmlEscaped(), mightBeRichText() */ QString Qt::convertFromPlainText(const QString &plain, Qt::WhiteSpaceMode mode) { @@ -209,7 +211,7 @@ QString Qt::convertFromPlainText(const QString &plain, Qt::WhiteSpaceMode mode) This function is defined in the \c <QTextDocument> header file. */ -#ifndef QT_NO_TEXTCODEC +#if QT_CONFIG(textcodec) QTextCodec *Qt::codecForHtml(const QByteArray &ba) { return QTextCodec::codecForHtml(ba); @@ -1910,7 +1912,7 @@ static void printPage(int index, QPainter *painter, const QTextDocument *doc, co } /*! - Prints the document to the given \a printer. The QPageablePaintDevice must be + Prints the document to the given \a printer. The QPagedPaintDevice must be set up before being used with this function. This is only a convenience method to print the whole document to the printer. @@ -2661,10 +2663,10 @@ void QTextHtmlExporter::emitFragment(const QTextFragment &fragment) bool closeAnchor = false; if (format.isAnchor()) { - const QString name = format.anchorName(); - if (!name.isEmpty()) { + const auto names = format.anchorNames(); + if (!names.isEmpty()) { html += QLatin1String("<a name=\""); - html += name.toHtmlEscaped(); + html += names.constFirst().toHtmlEscaped(); html += QLatin1String("\"></a>"); } const QString href = format.anchorHref(); diff --git a/src/gui/text/qtextdocument.h b/src/gui/text/qtextdocument.h index 33c0b48683..c9b22e053b 100644 --- a/src/gui/text/qtextdocument.h +++ b/src/gui/text/qtextdocument.h @@ -75,7 +75,7 @@ namespace Qt Q_GUI_EXPORT bool mightBeRichText(const QString&); Q_GUI_EXPORT QString convertFromPlainText(const QString &plain, WhiteSpaceMode mode = WhiteSpacePre); -#if !defined(QT_NO_TEXTCODEC) || defined(Q_CLANG_QDOC) +#if QT_CONFIG(textcodec) || defined(Q_CLANG_QDOC) Q_GUI_EXPORT QTextCodec *codecForHtml(const QByteArray &ba); #endif } diff --git a/src/gui/text/qtextdocument_p.cpp b/src/gui/text/qtextdocument_p.cpp index 66e038122c..0e3c8d0e83 100644 --- a/src/gui/text/qtextdocument_p.cpp +++ b/src/gui/text/qtextdocument_p.cpp @@ -40,6 +40,7 @@ #include <private/qtools_p.h> #include <qdebug.h> +#include <qscopedvaluerollback.h> #include "qtextdocument_p.h" #include "qtextdocument.h" #include <qtextformat.h> @@ -274,9 +275,10 @@ void QTextDocumentPrivate::clear() rtFrame = 0; init(); cursors = oldCursors; - inContentsChange = true; - q->contentsChange(0, len, 0); - inContentsChange = false; + { + QScopedValueRollback<bool> bg(inContentsChange, true); + emit q->contentsChange(0, len, 0); + } if (lout) lout->documentChanged(0, len, 0); } QT_CATCH(...) { @@ -309,9 +311,10 @@ void QTextDocumentPrivate::setLayout(QAbstractTextDocumentLayout *layout) it->free(); emit q->documentLayoutChanged(); - inContentsChange = true; - emit q->contentsChange(0, 0, length()); - inContentsChange = false; + { + QScopedValueRollback<bool> bg(inContentsChange, true); + emit q->contentsChange(0, 0, length()); + } if (lout) lout->documentChanged(0, 0, length()); } @@ -1213,9 +1216,8 @@ void QTextDocumentPrivate::finishEdit() if (lout && docChangeFrom >= 0) { if (!inContentsChange) { - inContentsChange = true; + QScopedValueRollback<bool> bg(inContentsChange, true); emit q->contentsChange(docChangeFrom, docChangeOldLength, docChangeLength); - inContentsChange = false; } lout->documentChanged(docChangeFrom, docChangeOldLength, docChangeLength); } diff --git a/src/gui/text/qtextdocument_p.h b/src/gui/text/qtextdocument_p.h index cad9131fbf..a8e17bfc08 100644 --- a/src/gui/text/qtextdocument_p.h +++ b/src/gui/text/qtextdocument_p.h @@ -101,10 +101,10 @@ class QTextBlockData : public QFragment<3> { public: inline void initialize() - { layout = 0; userData = 0; userState = -1; revision = 0; hidden = 0; } + { layout = nullptr; userData = nullptr; userState = -1; revision = 0; hidden = 0; } void invalidate() const; inline void free() - { delete layout; layout = 0; delete userData; userData = 0; } + { delete layout; layout = nullptr; delete userData; userData = nullptr; } mutable int format; // ##### probably store a QTextEngine * here! @@ -339,6 +339,7 @@ private: int lastBlockCount; public: + bool inContentsChange; QTextOption defaultTextOption; Qt::CursorMoveStyle defaultCursorMoveStyle; #ifndef QT_NO_CSSPARSER @@ -346,7 +347,6 @@ public: #endif int maximumBlockCount; uint needsEnsureMaximumBlockCount : 1; - uint inContentsChange : 1; uint blockCursorAdjustment : 1; QSizeF pageSize; QString title; diff --git a/src/gui/text/qtextdocumentfragment.cpp b/src/gui/text/qtextdocumentfragment.cpp index f0eff2d4f3..aef4ea1522 100644 --- a/src/gui/text/qtextdocumentfragment.cpp +++ b/src/gui/text/qtextdocumentfragment.cpp @@ -43,7 +43,6 @@ #include "qtextlist.h" #include <qdebug.h> -#include <qtextcodec.h> #include <qbytearray.h> #include <qdatastream.h> #include <qdatetime.h> @@ -543,8 +542,10 @@ void QTextHtmlImporter::import() } } - if (currentNode->charFormat.isAnchor() && !currentNode->charFormat.anchorName().isEmpty()) { - namedAnchors.append(currentNode->charFormat.anchorName()); + if (currentNode->charFormat.isAnchor()) { + const auto names = currentNode->charFormat.anchorNames(); + if (!names.isEmpty()) + namedAnchors.append(names.constFirst()); } if (appendNodeText()) @@ -1140,7 +1141,8 @@ QTextHtmlImporter::ProcessNodeResult QTextHtmlImporter::processBlockNode() // #################### // block.setFloatPosition(node->cssFloat); - if (wsm == QTextHtmlParserNode::WhiteSpacePre) { + if (wsm == QTextHtmlParserNode::WhiteSpacePre + || wsm == QTextHtmlParserNode::WhiteSpaceNoWrap) { block.setNonBreakableLines(true); modifiedBlockFormat = true; } diff --git a/src/gui/text/qtextdocumentfragment_p.h b/src/gui/text/qtextdocumentfragment_p.h index 02a6a429fa..67b0c2c600 100644 --- a/src/gui/text/qtextdocumentfragment_p.h +++ b/src/gui/text/qtextdocumentfragment_p.h @@ -109,7 +109,7 @@ public: uint importedFromPlainText : 1; private: - Q_DISABLE_COPY(QTextDocumentFragmentPrivate) + Q_DISABLE_COPY_MOVE(QTextDocumentFragmentPrivate) }; #ifndef QT_NO_TEXTHTMLPARSER @@ -125,7 +125,7 @@ public: QTextHtmlImporter(QTextDocument *_doc, const QString &html, ImportMode mode, - const QTextDocument *resourceProvider = 0); + const QTextDocument *resourceProvider = nullptr); void import(); @@ -163,7 +163,7 @@ private: #endif struct TableCellIterator { - inline TableCellIterator(QTextTable *t = 0) : table(t), row(0), column(0) {} + inline TableCellIterator(QTextTable *t = nullptr) : table(t), row(0), column(0) {} inline TableCellIterator &operator++() { if (atEnd()) @@ -182,7 +182,7 @@ private: return *this; } - inline bool atEnd() const { return table == 0 || row >= table->rows(); } + inline bool atEnd() const { return table == nullptr || row >= table->rows(); } QTextTableCell cell() const { return table->cellAt(row, column); } diff --git a/src/gui/text/qtextdocumentlayout.cpp b/src/gui/text/qtextdocumentlayout.cpp index a9227f0171..2e1a2b5bff 100644 --- a/src/gui/text/qtextdocumentlayout.cpp +++ b/src/gui/text/qtextdocumentlayout.cpp @@ -58,23 +58,17 @@ #include <limits.h> #include <qbasictimer.h> #include "private/qfunctions_p.h" +#include <qloggingcategory.h> #include <algorithm> -// #define LAYOUT_DEBUG - -#ifdef LAYOUT_DEBUG -#define LDEBUG qDebug() -#define INC_INDENT debug_indent += " " -#define DEC_INDENT debug_indent = debug_indent.left(debug_indent.length()-2) -#else -#define LDEBUG if(0) qDebug() -#define INC_INDENT do {} while(0) -#define DEC_INDENT do {} while(0) -#endif - QT_BEGIN_NAMESPACE +Q_LOGGING_CATEGORY(lcDraw, "qt.text.drawing") +Q_LOGGING_CATEGORY(lcHit, "qt.text.hittest") +Q_LOGGING_CATEGORY(lcLayout, "qt.text.layout") +Q_LOGGING_CATEGORY(lcTable, "qt.text.layout.table") + // ################ should probably add frameFormatChange notification! struct QTextLayoutStruct; @@ -155,7 +149,7 @@ struct QTextLayoutStruct { { return pageHeight == 0 ? 0 : (absoluteY() / pageHeight).truncate(); } inline void newPage() - { if (pageHeight == QFIXED_MAX) return; pageBottom += pageHeight; y = pageBottom - pageHeight + pageBottomMargin + pageTopMargin - frameY; } + { if (pageHeight == QFIXED_MAX) return; pageBottom += pageHeight; y = qMax(y, pageBottom - pageHeight + pageBottomMargin + pageTopMargin - frameY); } }; class QTextTableData : public QTextFrameData @@ -583,16 +577,16 @@ QTextDocumentLayoutPrivate::hitTest(QTextFrame *frame, const QFixedPoint &point, QTextFrame *rootFrame = docPrivate->rootFrame(); -// LDEBUG << "checking frame" << frame->firstPosition() << "point=" << point -// << "position" << fd->position << "size" << fd->size; + qCDebug(lcHit) << "checking frame" << frame->firstPosition() << "point=" << point.toPointF() + << "position" << fd->position.toPointF() << "size" << fd->size.toSizeF(); if (frame != rootFrame) { if (relativePoint.y < 0 || relativePoint.x < 0) { *position = frame->firstPosition() - 1; -// LDEBUG << "before pos=" << *position; + qCDebug(lcHit) << "before pos=" << *position; return PointBefore; } else if (relativePoint.y > fd->size.height || relativePoint.x > fd->size.width) { *position = frame->lastPosition() + 1; -// LDEBUG << "after pos=" << *position; + qCDebug(lcHit) << "after pos=" << *position; return PointAfter; } } @@ -666,8 +660,6 @@ QTextDocumentLayoutPrivate::HitPoint QTextDocumentLayoutPrivate::hitTest(QTextFrame::Iterator it, HitPoint hit, const QFixedPoint &p, int *position, QTextLayout **l, Qt::HitTestAccuracy accuracy) const { - INC_INDENT; - for (; !it.atEnd(); ++it) { QTextFrame *c = it.currentFrame(); HitPoint hp; @@ -693,8 +685,7 @@ QTextDocumentLayoutPrivate::hitTest(QTextFrame::Iterator it, HitPoint hit, const } } - DEC_INDENT; -// LDEBUG << "inside=" << hit << " pos=" << *position; + qCDebug(lcHit) << "inside=" << hit << " pos=" << *position; return hit; } @@ -741,15 +732,14 @@ QTextDocumentLayoutPrivate::hitTest(const QTextBlock &bl, const QFixedPoint &poi QTextLayout *tl = bl.layout(); QRectF textrect = tl->boundingRect(); textrect.translate(tl->position()); -// LDEBUG << " checking block" << bl.position() << "point=" << point -// << " tlrect" << textrect; + qCDebug(lcHit) << " checking block" << bl.position() << "point=" << point.toPointF() << " tlrect" << textrect; *position = bl.position(); if (point.y.toReal() < textrect.top()) { -// LDEBUG << " before pos=" << *position; + qCDebug(lcHit) << " before pos=" << *position; return PointBefore; } else if (point.y.toReal() > textrect.bottom()) { *position += bl.length(); -// LDEBUG << " after pos=" << *position; + qCDebug(lcHit) << " after pos=" << *position; return PointAfter; } @@ -781,7 +771,7 @@ QTextDocumentLayoutPrivate::hitTest(const QTextBlock &bl, const QFixedPoint &poi } *position += off; -// LDEBUG << " inside=" << hit << " pos=" << *position; + qCDebug(lcHit) << " inside=" << hit << " pos=" << *position; return hit; } @@ -944,8 +934,7 @@ void QTextDocumentLayoutPrivate::drawFrame(const QPointF &offset, QPainter *pain || off.x() > context.clip.right() || off.x() + fd->size.width.toReal() < context.clip.left())) return; -// LDEBUG << debug_indent << "drawFrame" << frame->firstPosition() << "--" << frame->lastPosition() << "at" << offset; -// INC_INDENT; + qCDebug(lcDraw) << "drawFrame" << frame->firstPosition() << "--" << frame->lastPosition() << "at" << offset; // if the cursor is /on/ a table border we may need to repaint it // afterwards, as we usually draw the decoration first @@ -1076,8 +1065,6 @@ void QTextDocumentLayoutPrivate::drawFrame(const QPointF &offset, QPainter *pain painter->setPen(oldPen); } -// DEC_INDENT; - return; } @@ -1280,7 +1267,7 @@ void QTextDocumentLayoutPrivate::drawBlock(const QPointF &offset, QPainter *pain r.translate(offset + tl->position()); if (!bl.isVisible() || (context.clip.isValid() && (r.bottom() < context.clip.y() || r.top() > context.clip.bottom()))) return; -// LDEBUG << debug_indent << "drawBlock" << bl.position() << "at" << offset << "br" << tl->boundingRect(); + qCDebug(lcDraw) << "drawBlock" << bl.position() << "at" << offset << "br" << tl->boundingRect(); QTextBlockFormat blockFormat = bl.blockFormat(); @@ -1512,7 +1499,7 @@ QTextLayoutStruct QTextDocumentLayoutPrivate::layoutCell(QTextTable *t, const QT int layoutFrom, int layoutTo, QTextTableData *td, QFixed absoluteTableY, bool withPageBreaks) { - LDEBUG << "layoutCell"; + qCDebug(lcTable) << "layoutCell"; QTextLayoutStruct layoutStruct; layoutStruct.frame = t; layoutStruct.minimumWidth = 0; @@ -1587,7 +1574,7 @@ QTextLayoutStruct QTextDocumentLayoutPrivate::layoutCell(QTextTable *t, const QT QRectF QTextDocumentLayoutPrivate::layoutTable(QTextTable *table, int layoutFrom, int layoutTo, QFixed parentY) { - LDEBUG << "layoutTable"; + qCDebug(lcTable) << "layoutTable from" << layoutFrom << "to" << layoutTo << "parentY" << parentY; QTextTableData *td = static_cast<QTextTableData *>(data(table)); Q_ASSERT(td->sizeDirty); const int rows = table->rows(); @@ -1709,6 +1696,7 @@ recalc_minmax_widths: if (length.type() == QTextLength::FixedLength) { td->minWidths[i] = td->widths[i] = qMax(scaleToDevice(QFixed::fromReal(length.rawValue())), td->minWidths.at(i)); remainingWidth -= td->widths.at(i); + qCDebug(lcTable) << "column" << i << "has width constraint" << td->minWidths.at(i) << "px, remaining width now" << remainingWidth; } else if (length.type() == QTextLength::PercentageLength) { totalPercentage += QFixed::fromReal(length.rawValue()); } else if (length.type() == QTextLength::VariableLength) { @@ -1716,6 +1704,7 @@ recalc_minmax_widths: td->widths[i] = td->minWidths.at(i); remainingWidth -= td->minWidths.at(i); + qCDebug(lcTable) << "column" << i << "has variable width, min" << td->minWidths.at(i) << "remaining width now" << remainingWidth; } totalMinWidth += td->minWidths.at(i); } @@ -1735,6 +1724,8 @@ recalc_minmax_widths: } else { td->widths[i] = td->minWidths.at(i); } + qCDebug(lcTable) << "column" << i << "has width constraint" << columnWidthConstraints.at(i).rawValue() + << "%, allocated width" << td->widths[i] << "remaining width now" << remainingWidth; remainingWidth -= td->widths.at(i); } } @@ -1978,9 +1969,12 @@ relayout: td->minimumWidth += rightMargin - td->border; td->maximumWidth = td->columnPositions.at(0); - for (int i = 0; i < columns; ++i) + for (int i = 0; i < columns; ++i) { if (td->maxWidths.at(i) != QFIXED_MAX) td->maximumWidth += td->maxWidths.at(i) + 2 * td->border + cellSpacing; + qCDebug(lcTable) << "column" << i << "has final width" << td->widths.at(i).toReal() + << "min" << td->minWidths.at(i).toReal() << "max" << td->maxWidths.at(i).toReal(); + } td->maximumWidth += rightMargin - td->border; td->updateTableSize(); @@ -2052,9 +2046,8 @@ void QTextDocumentLayoutPrivate::positionFloat(QTextFrame *frame, QTextLine *cur QRectF QTextDocumentLayoutPrivate::layoutFrame(QTextFrame *f, int layoutFrom, int layoutTo, QFixed parentY) { - LDEBUG << "layoutFrame (pre)"; + qCDebug(lcLayout, "layoutFrame (%d--%d), parent=%p", f->firstPosition(), f->lastPosition(), f->parentFrame()); Q_ASSERT(data(f)->sizeDirty); -// qDebug("layouting frame (%d--%d), parent=%p", f->firstPosition(), f->lastPosition(), f->parentFrame()); QTextFrameFormat fformat = f->frameFormat(); @@ -2076,9 +2069,8 @@ QRectF QTextDocumentLayoutPrivate::layoutFrame(QTextFrame *f, int layoutFrom, in QRectF QTextDocumentLayoutPrivate::layoutFrame(QTextFrame *f, int layoutFrom, int layoutTo, QFixed frameWidth, QFixed frameHeight, QFixed parentY) { - LDEBUG << "layoutFrame from=" << layoutFrom << "to=" << layoutTo; + qCDebug(lcLayout, "layoutFrame (%d--%d), parent=%p", f->firstPosition(), f->lastPosition(), f->parentFrame()); Q_ASSERT(data(f)->sizeDirty); -// qDebug("layouting frame (%d--%d), parent=%p", f->firstPosition(), f->lastPosition(), f->parentFrame()); QTextFrameData *fd = data(f); QFixed newContentsWidth; @@ -2165,8 +2157,8 @@ QRectF QTextDocumentLayoutPrivate::layoutFrame(QTextFrame *f, int layoutFrom, in layoutStruct.maximumWidth = QFIXED_MAX; layoutStruct.fullLayout = fullLayout || (fd->oldContentsWidth != newContentsWidth); layoutStruct.updateRect = QRectF(QPointF(0, 0), QSizeF(qreal(INT_MAX), qreal(INT_MAX))); - LDEBUG << "layoutStruct: x_left" << layoutStruct.x_left << "x_right" << layoutStruct.x_right - << "fullLayout" << layoutStruct.fullLayout; + qCDebug(lcLayout) << "layoutStruct: x_left" << layoutStruct.x_left << "x_right" << layoutStruct.x_right + << "fullLayout" << layoutStruct.fullLayout; fd->oldContentsWidth = newContentsWidth; layoutStruct.pageHeight = QFixed::fromReal(document->pageSize().height()); @@ -2220,7 +2212,7 @@ QRectF QTextDocumentLayoutPrivate::layoutFrame(QTextFrame *f, int layoutFrom, in void QTextDocumentLayoutPrivate::layoutFlow(QTextFrame::Iterator it, QTextLayoutStruct *layoutStruct, int layoutFrom, int layoutTo, QFixed width) { - LDEBUG << "layoutFlow from=" << layoutFrom << "to=" << layoutTo; + qCDebug(lcLayout) << "layoutFlow from=" << layoutFrom << "to=" << layoutTo; QTextFrameData *fd = data(layoutStruct->frame); fd->currentLayoutStruct = layoutStruct; @@ -2578,9 +2570,8 @@ void QTextDocumentLayoutPrivate::layoutBlock(const QTextBlock &bl, int blockPosi QTextLayout *tl = bl.layout(); const int blockLength = bl.length(); - LDEBUG << "layoutBlock from=" << layoutFrom << "to=" << layoutTo; - -// qDebug() << "layoutBlock; width" << layoutStruct->x_right - layoutStruct->x_left << "(maxWidth is btw" << tl->maximumWidth() << ')'; + qCDebug(lcLayout) << "layoutBlock from=" << layoutFrom << "to=" << layoutTo + << "; width" << layoutStruct->x_right - layoutStruct->x_left << "(maxWidth is btw" << tl->maximumWidth() << ')'; if (previousBlockFormat) { qreal margin = qMax(blockFormat.topMargin(), previousBlockFormat->bottomMargin()); @@ -2612,7 +2603,7 @@ void QTextDocumentLayoutPrivate::layoutBlock(const QTextBlock &bl, int blockPosi // force relayout if we cross a page boundary || (layoutStruct->pageHeight != QFIXED_MAX && layoutStruct->absoluteY() + QFixed::fromReal(tl->boundingRect().height()) > layoutStruct->pageBottom)) { - LDEBUG << " do layout"; + qCDebug(lcLayout) << "do layout"; QTextOption option = docPrivate->defaultTextOption; option.setTextDirection(dir); option.setTabs( blockFormat.tabPositions() ); @@ -2709,7 +2700,8 @@ void QTextDocumentLayoutPrivate::layoutBlock(const QTextBlock &bl, int blockPosi qreal(q->paintDevice()->logicalDpiY()) / qreal(qt_defaultDpi()) : 1; getLineHeightParams(blockFormat, line, scaling, &lineAdjustment, &lineBreakHeight, &lineHeight, &lineBottom); - if (layoutStruct->pageHeight > 0 && layoutStruct->absoluteY() + lineBreakHeight > layoutStruct->pageBottom) { + while (layoutStruct->pageHeight > 0 && layoutStruct->absoluteY() + lineBreakHeight > layoutStruct->pageBottom && + layoutStruct->pageHeight >= lineBreakHeight) { layoutStruct->newPage(); floatMargins(layoutStruct->y, layoutStruct, &left, &right); @@ -2740,7 +2732,7 @@ void QTextDocumentLayoutPrivate::layoutBlock(const QTextBlock &bl, int blockPosi const int cnt = tl->lineCount(); QFixed bottom; for (int i = 0; i < cnt; ++i) { - LDEBUG << "going to move text line" << i; + qCDebug(lcLayout) << "going to move text line" << i; QTextLine line = tl->lineAt(i); layoutStruct->contentsWidth = qMax(layoutStruct->contentsWidth, QFixed::fromReal(line.x() + tl->lineAt(i).naturalTextWidth()) + totalRightMargin); @@ -3049,18 +3041,12 @@ void QTextDocumentLayout::resizeInlineObject(QTextInlineObject item, int posInDo QSizeF inlineSize = (pos == QTextFrameFormat::InFlow ? intrinsic : QSizeF(0, 0)); item.setWidth(inlineSize.width()); - QFontMetrics m(f.font()); - switch (f.verticalAlignment()) - { - case QTextCharFormat::AlignMiddle: - item.setDescent(inlineSize.height() / 2); - item.setAscent(inlineSize.height() / 2); - break; - case QTextCharFormat::AlignBaseline: - item.setDescent(m.descent()); - item.setAscent(inlineSize.height() - m.descent()); - break; - default: + if (f.verticalAlignment() == QTextCharFormat::AlignMiddle) { + QFontMetrics m(f.font()); + qreal halfX = m.xHeight()/2.; + item.setAscent((inlineSize.height() + halfX) / 2.); + item.setDescent((inlineSize.height() - halfX) / 2.); + } else { item.setDescent(0); item.setAscent(inlineSize.height()); } diff --git a/src/gui/text/qtextdocumentwriter.cpp b/src/gui/text/qtextdocumentwriter.cpp index 731aaf1fcf..42e623153a 100644 --- a/src/gui/text/qtextdocumentwriter.cpp +++ b/src/gui/text/qtextdocumentwriter.cpp @@ -41,7 +41,9 @@ #include <QtCore/qfile.h> #include <QtCore/qbytearray.h> #include <QtCore/qfileinfo.h> +#if QT_CONFIG(textcodec) #include <QtCore/qtextcodec.h> +#endif #include <QtCore/qtextstream.h> #include <QtCore/qdebug.h> #include "qtextdocument.h" @@ -63,7 +65,7 @@ public: QByteArray format; QIODevice *device; bool deleteDevice; -#ifndef QT_NO_TEXTCODEC +#if QT_CONFIG(textcodec) QTextCodec *codec; #endif @@ -104,7 +106,7 @@ public: QTextDocumentWriterPrivate::QTextDocumentWriterPrivate(QTextDocumentWriter *qq) : device(0), deleteDevice(false), -#ifndef QT_NO_TEXTCODEC +#if QT_CONFIG(textcodec) codec(QTextCodec::codecForName("utf-8")), #endif q(qq) @@ -204,8 +206,8 @@ void QTextDocumentWriter::setDevice (QIODevice *device) } /*! - Returns the device currently assigned, or 0 if no device has been - assigned. + Returns the device currently assigned, or \nullptr if no device + has been assigned. */ QIODevice *QTextDocumentWriter::device () const { @@ -258,7 +260,7 @@ bool QTextDocumentWriter::write(const QTextDocument *document) #ifndef QT_NO_TEXTODFWRITER if (format == "odf" || format == "opendocumentformat" || format == "odt") { QTextOdfWriter writer(*document, d->device); -#ifndef QT_NO_TEXTCODEC +#if QT_CONFIG(textcodec) writer.setCodec(d->codec); #endif return writer.writeAll(); @@ -268,11 +270,11 @@ bool QTextDocumentWriter::write(const QTextDocument *document) #ifndef QT_NO_TEXTHTMLPARSER if (format == "html" || format == "htm") { if (!d->device->isWritable() && ! d->device->open(QIODevice::WriteOnly)) { - qWarning("QTextDocumentWriter::write: the device can not be opened for writing"); + qWarning("QTextDocumentWriter::write: the device cannot be opened for writing"); return false; } QTextStream ts(d->device); -#ifndef QT_NO_TEXTCODEC +#if QT_CONFIG(textcodec) ts.setCodec(d->codec); ts << document->toHtml(d->codec->name()); #endif @@ -282,11 +284,11 @@ bool QTextDocumentWriter::write(const QTextDocument *document) #endif if (format == "txt" || format == "plaintext") { if (!d->device->isWritable() && ! d->device->open(QIODevice::WriteOnly)) { - qWarning("QTextDocumentWriter::write: the device can not be opened for writing"); + qWarning("QTextDocumentWriter::write: the device cannot be opened for writing"); return false; } QTextStream ts(d->device); -#ifndef QT_NO_TEXTCODEC +#if QT_CONFIG(textcodec) ts.setCodec(d->codec); #endif ts << document->toPlainText(); @@ -317,7 +319,7 @@ bool QTextDocumentWriter::write(const QTextDocumentFragment &fragment) uses UTF-8. */ -#ifndef QT_NO_TEXTCODEC +#if QT_CONFIG(textcodec) void QTextDocumentWriter::setCodec(QTextCodec *codec) { if (codec == 0) @@ -330,7 +332,7 @@ void QTextDocumentWriter::setCodec(QTextCodec *codec) /*! Returns the codec that is currently assigned to the writer. */ -#ifndef QT_NO_TEXTCODEC +#if QT_CONFIG(textcodec) QTextCodec *QTextDocumentWriter::codec() const { return d->codec; diff --git a/src/gui/text/qtextdocumentwriter.h b/src/gui/text/qtextdocumentwriter.h index 0502bf1a96..4a57b181b4 100644 --- a/src/gui/text/qtextdocumentwriter.h +++ b/src/gui/text/qtextdocumentwriter.h @@ -70,7 +70,7 @@ public: bool write(const QTextDocument *document); bool write(const QTextDocumentFragment &fragment); -#ifndef QT_NO_TEXTCODEC +#if QT_CONFIG(textcodec) void setCodec(QTextCodec *codec); QTextCodec *codec() const; #endif diff --git a/src/gui/text/qtextengine.cpp b/src/gui/text/qtextengine.cpp index 4e9b00f9c9..2616a42022 100644 --- a/src/gui/text/qtextengine.cpp +++ b/src/gui/text/qtextengine.cpp @@ -252,8 +252,6 @@ struct QBidiAlgorithm { void initScriptAnalysisAndIsolatePairs(Vector<IsolatePair> &isolatePairs) { - isolatePairs.append({ -1, length }); // treat the whole string as one isolate - int isolateStack[128]; int isolateLevel = 0; // load directions of string, and determine isolate pairs @@ -304,6 +302,14 @@ struct QBidiAlgorithm { case QChar::DirS: case QChar::DirB: analysis[pos].bidiFlags = QScriptAnalysis::BidiResetToParagraphLevel; + if (uc == QChar::ParagraphSeparator) { + // close all open isolates as we start a new paragraph + while (isolateLevel > 0) { + --isolateLevel; + if (isolateLevel < 128) + isolatePairs[isolateStack[isolateLevel]].end = pos; + } + } break; default: break; @@ -434,21 +440,21 @@ struct QBidiAlgorithm { doEmbed(true, true, false); break; case QChar::DirLRI: - ++isolatePairPosition; Q_ASSERT(isolatePairs.at(isolatePairPosition).start == i); doEmbed(false, false, true); + ++isolatePairPosition; break; case QChar::DirRLI: - ++isolatePairPosition; Q_ASSERT(isolatePairs.at(isolatePairPosition).start == i); doEmbed(true, false, true); + ++isolatePairPosition; break; case QChar::DirFSI: { - ++isolatePairPosition; const auto &pair = isolatePairs.at(isolatePairPosition); Q_ASSERT(pair.start == i); bool isRtl = QStringView(text + pair.start + 1, pair.end - pair.start - 1).isRightToLeft(); doEmbed(isRtl, false, true); + ++isolatePairPosition; break; } @@ -492,16 +498,24 @@ struct QBidiAlgorithm { analysis[i].bidiDirection = (level & 1) ? QChar::DirR : QChar::DirL; break; case QChar::DirB: - // paragraph separator, go down to base direction - appendRun(i - 1); - while (stack.counter > 1) { - // there might be remaining isolates on the stack that are missing a PDI. Those need to get - // a continuation indicating to take the eos from the end of the string (ie. the paragraph level) - const auto &t = stack.top(); - if (t.isIsolate) { - runs[t.runBeforeIsolate].continuation = -2; + // paragraph separator, go down to base direction, reset all state + if (text[i].unicode() == QChar::ParagraphSeparator) { + appendRun(i - 1); + while (stack.counter > 1) { + // there might be remaining isolates on the stack that are missing a PDI. Those need to get + // a continuation indicating to take the eos from the end of the string (ie. the paragraph level) + const auto &t = stack.top(); + if (t.isIsolate) { + runs[t.runBeforeIsolate].continuation = -2; + } + --stack.counter; } - --stack.counter; + continuationFrom = -1; + lastRunWithContent = -1; + validIsolateCount = 0; + overflowIsolateCount = 0; + overflowEmbeddingCount = 0; + level = baseLevel; } break; default: @@ -1094,6 +1108,22 @@ struct QBidiAlgorithm { resolveImplicitLevels(runs); } + BIDI_DEBUG() << "Rule L1:"; + // Rule L1: + bool resetLevel = true; + for (int i = length - 1; i >= 0; --i) { + if (analysis[i].bidiFlags & QScriptAnalysis::BidiResetToParagraphLevel) { + BIDI_DEBUG() << "resetting pos" << i << "to baselevel"; + analysis[i].bidiLevel = baseLevel; + resetLevel = true; + } else if (resetLevel && analysis[i].bidiFlags & QScriptAnalysis::BidiMaybeResetToParagraphLevel) { + BIDI_DEBUG() << "resetting pos" << i << "to baselevel (maybereset flag)"; + analysis[i].bidiLevel = baseLevel; + } else { + resetLevel = false; + } + } + // set directions for BN to the minimum of adjacent chars // This makes is possible to be conformant with the Bidi algorithm even though we don't // remove BN and explicit embedding chars from the stream of characters to reorder @@ -1125,22 +1155,6 @@ struct QBidiAlgorithm { } } - BIDI_DEBUG() << "Rule L1:"; - // Rule L1: - bool resetLevel = true; - for (int i = length - 1; i >= 0; --i) { - if (analysis[i].bidiFlags & QScriptAnalysis::BidiResetToParagraphLevel) { - BIDI_DEBUG() << "resetting pos" << i << "to baselevel"; - analysis[i].bidiLevel = baseLevel; - resetLevel = true; - } else if (resetLevel && analysis[i].bidiFlags & QScriptAnalysis::BidiMaybeResetToParagraphLevel) { - BIDI_DEBUG() << "resetting pos" << i << "to baselevel (maybereset flag)"; - analysis[i].bidiLevel = baseLevel; - } else { - resetLevel = false; - } - } - if (BidiDebugEnabled) { BIDI_DEBUG() << "final resolved levels:"; for (int i = 0; i < length; ++i) @@ -1398,11 +1412,12 @@ void QTextEngine::shapeText(int item) const #ifndef QT_NO_RAWFONT if (useRawFont) { QTextCharFormat f = format(&si); - kerningEnabled = f.fontKerning(); + QFont font = f.font(); + kerningEnabled = font.kerning(); shapingEnabled = QFontEngine::scriptRequiresOpenType(QChar::Script(si.analysis.script)) - || (f.fontStyleStrategy() & QFont::PreferNoShaping) == 0; - wordSpacing = QFixed::fromReal(f.fontWordSpacing()); - letterSpacing = QFixed::fromReal(f.fontLetterSpacing()); + || (font.styleStrategy() & QFont::PreferNoShaping) == 0; + wordSpacing = QFixed::fromReal(font.wordSpacing()); + letterSpacing = QFixed::fromReal(font.letterSpacing()); letterSpacingIsAbsolute = true; } else #endif @@ -1739,7 +1754,7 @@ int QTextEngine::shapeTextWithHarfbuzzNG(const QScriptItem &si, #ifdef Q_OS_DARWIN if (actualFontEngine->type() == QFontEngine::Mac) { - if (actualFontEngine->fontDef.stretch != 100) { + if (actualFontEngine->fontDef.stretch != 100 && actualFontEngine->fontDef.stretch != QFont::AnyStretch) { QFixed stretch = QFixed(int(actualFontEngine->fontDef.stretch)) / QFixed(100); for (uint i = 0; i < num_glyphs; ++i) g.advances[i] *= stretch; @@ -1953,7 +1968,9 @@ const QCharAttributes *QTextEngine::attributes() const QUnicodeTools::initCharAttributes(reinterpret_cast<const ushort *>(layoutData->string.constData()), layoutData->string.length(), scriptItems.data(), scriptItems.size(), - (QCharAttributes *)layoutData->memory); + (QCharAttributes *)layoutData->memory, + QUnicodeTools::CharAttributeOptions(QUnicodeTools::DefaultOptionsCompat + | QUnicodeTools::HangulLineBreakTailoring)); layoutData->haveCharAttributes = true; @@ -1962,19 +1979,28 @@ const QCharAttributes *QTextEngine::attributes() const void QTextEngine::shape(int item) const { - if (layoutData->items.at(item).analysis.flags == QScriptAnalysis::Object) { + auto &li = layoutData->items[item]; + if (li.analysis.flags == QScriptAnalysis::Object) { ensureSpace(1); if (block.docHandle()) { docLayout()->resizeInlineObject(QTextInlineObject(item, const_cast<QTextEngine *>(this)), - layoutData->items[item].position + block.position(), - format(&layoutData->items[item])); + li.position + block.position(), + format(&li)); + } + // fix log clusters to point to the previous glyph, as the object doesn't have a glyph of it's own. + // This is required so that all entries in the array get initialized and are ordered correctly. + if (layoutData->logClustersPtr) { + ushort *lc = logClusters(&li); + *lc = (lc != layoutData->logClustersPtr) ? lc[-1] : 0; } - } else if (layoutData->items.at(item).analysis.flags == QScriptAnalysis::Tab) { + } else if (li.analysis.flags == QScriptAnalysis::Tab) { // set up at least the ascent/descent/leading of the script item for the tab - fontEngine(layoutData->items[item], - &layoutData->items[item].ascent, - &layoutData->items[item].descent, - &layoutData->items[item].leading); + fontEngine(li, &li.ascent, &li.descent, &li.leading); + // see the comment above + if (layoutData->logClustersPtr) { + ushort *lc = logClusters(&li); + *lc = (lc != layoutData->logClustersPtr) ? lc[-1] : 0; + } } else { shapeText(item); } @@ -2063,8 +2089,6 @@ void QTextEngine::itemize() const analysis->flags = QScriptAnalysis::Object; break; case QChar::LineSeparator: - if (analysis->bidiLevel % 2) - --analysis->bidiLevel; analysis->flags = QScriptAnalysis::LineOrParagraphSeparator; if (option.flags() & QTextOption::ShowLineAndParagraphSeparators) { const int offset = uc - string; @@ -3187,6 +3211,16 @@ QString QTextEngine::elidedText(Qt::TextElideMode mode, const QFixed &width, int QChar ellipsisChar(0x2026); + // We only want to use the ellipsis character if it is from the main + // font (not one of the fallbacks), since using a fallback font + // will affect the metrics of the text, potentially causing it to shift + // when it is being elided. + if (engine->type() == QFontEngine::Multi) { + QFontEngineMulti *multiEngine = static_cast<QFontEngineMulti *>(engine); + multiEngine->ensureEngineAt(0); + engine = multiEngine->engine(0); + } + glyph_t glyph = engine->glyphIndex(ellipsisChar.unicode()); QGlyphLayout glyphs; diff --git a/src/gui/text/qtextengine_p.h b/src/gui/text/qtextengine_p.h index e9187ea605..fddda7f2f8 100644 --- a/src/gui/text/qtextengine_p.h +++ b/src/gui/text/qtextengine_p.h @@ -304,8 +304,8 @@ class QTextItemInt : public QTextItem { public: inline QTextItemInt() - : justified(false), underlineStyle(QTextCharFormat::NoUnderline), num_chars(0), chars(0), - logClusters(0), f(0), fontEngine(0) + : justified(false), underlineStyle(QTextCharFormat::NoUnderline), num_chars(0), chars(nullptr), + logClusters(nullptr), f(nullptr), fontEngine(nullptr) {} QTextItemInt(const QScriptItem &si, QFont *font, const QTextCharFormat &format = QTextCharFormat()); QTextItemInt(const QGlyphLayout &g, QFont *font, const QChar *chars, int numChars, QFontEngine *fe, @@ -335,7 +335,7 @@ public: struct QScriptItem { - Q_DECL_CONSTEXPR QScriptItem(int p, QScriptAnalysis a) Q_DECL_NOTHROW + Q_DECL_CONSTEXPR QScriptItem(int p, QScriptAnalysis a) noexcept : position(p), analysis(a), num_glyphs(0), descent(-1), ascent(-1), leading(-1), width(-1), glyph_data_offset(0) {} @@ -348,7 +348,7 @@ struct QScriptItem QFixed leading; QFixed width; int glyph_data_offset; - Q_DECL_CONSTEXPR QFixed height() const Q_DECL_NOTHROW { return ascent + descent; } + Q_DECL_CONSTEXPR QFixed height() const noexcept { return ascent + descent; } private: friend class QVector<QScriptItem>; QScriptItem() {}; // for QVector, don't use @@ -484,7 +484,7 @@ public: return end - si->position; } - QFontEngine *fontEngine(const QScriptItem &si, QFixed *ascent = 0, QFixed *descent = 0, QFixed *leading = 0) const; + QFontEngine *fontEngine(const QScriptItem &si, QFixed *ascent = nullptr, QFixed *descent = nullptr, QFixed *leading = nullptr) const; QFont font(const QScriptItem &si) const; inline QFont font() const { return fnt; } @@ -530,7 +530,7 @@ public: inline QTextFormatCollection *formatCollection() const { if (block.docHandle()) return block.docHandle()->formatCollection(); - return specialData ? specialData->formatCollection.data() : 0; + return specialData ? specialData->formatCollection.data() : nullptr; } QTextCharFormat format(const QScriptItem *si) const; inline QAbstractTextDocumentLayout *docLayout() const { @@ -553,8 +553,8 @@ private: mutable int prevPosition; mutable int prevLength; inline void reset() { - prevFontEngine = 0; - prevScaledFontEngine = 0; + prevFontEngine = nullptr; + prevScaledFontEngine = nullptr; prevScript = -1; prevPosition = -1; prevLength = -1; @@ -684,7 +684,7 @@ Q_DECLARE_TYPEINFO(QTextEngine::ItemDecoration, Q_MOVABLE_TYPE); struct QTextLineItemIterator { QTextLineItemIterator(QTextEngine *eng, int lineNum, const QPointF &pos = QPointF(), - const QTextLayout::FormatRange *_selection = 0); + const QTextLayout::FormatRange *_selection = nullptr); inline bool atEnd() const { return logicalItem >= nItems - 1; } inline bool atBeginning() const { return logicalItem <= 0; } diff --git a/src/gui/text/qtextformat.cpp b/src/gui/text/qtextformat.cpp index 4957da1908..4a2985f74c 100644 --- a/src/gui/text/qtextformat.cpp +++ b/src/gui/text/qtextformat.cpp @@ -361,6 +361,12 @@ void QTextFormatPrivate::recalcFont() const case QTextFormat::FontFamily: f.setFamily(props.at(i).value.toString()); break; + case QTextFormat::FontFamilies: + f.setFamilies(props.at(i).value.toStringList()); + break; + case QTextFormat::FontStyleName: + f.setStyleName(props.at(i).value.toString()); + break; case QTextFormat::FontPointSize: f.setPointSizeF(props.at(i).value.toReal()); break; @@ -562,6 +568,8 @@ Q_GUI_EXPORT QDataStream &operator>>(QDataStream &stream, QTextFormat &fmt) Character properties \value FontFamily + \value FontFamilies + \value FontStyleName \value FontPointSize \value FontPixelSize \value FontSizeAdjustment Specifies the change in size given to the fontsize already set using @@ -645,6 +653,7 @@ Q_GUI_EXPORT QDataStream &operator>>(QDataStream &stream, QTextFormat &fmt) \value ImageName \value ImageWidth \value ImageHeight + \value ImageQuality Selection properties @@ -1390,6 +1399,41 @@ QTextCharFormat::QTextCharFormat(const QTextFormat &fmt) \sa font() */ +/*! + \fn void QTextCharFormat::setFontFamilies(const QStringList &families) + \since 5.13 + + Sets the text format's font \a families. + + \sa setFont() +*/ + +/*! + \fn QStringList QTextCharFormat::fontFamilies() const + \since 5.13 + + Returns the text format's font families. + + \sa font() +*/ + +/*! + \fn void QTextCharFormat::setFontStyleName(const QString &styleName) + \since 5.13 + + Sets the text format's font \a styleName. + + \sa setFont(), QFont::setStyleName() +*/ + +/*! + \fn QStringList QTextCharFormat::fontStyleName() const + \since 5.13 + + Returns the text format's font style name. + + \sa font(), QFont::styleName() +*/ /*! \fn void QTextCharFormat::setFontPointSize(qreal size) @@ -1743,6 +1787,7 @@ void QTextCharFormat::setUnderlineStyle(UnderlineStyle style) */ +#if QT_DEPRECATED_SINCE(5, 13) /*! \fn void QTextCharFormat::setAnchorName(const QString &name) \obsolete @@ -1753,6 +1798,7 @@ void QTextCharFormat::setUnderlineStyle(UnderlineStyle style) hyperlink, the destination must be set with setAnchorHref() and the anchor must be enabled with setAnchor(). */ +#endif /*! \fn void QTextCharFormat::setAnchorNames(const QStringList &names) @@ -1763,6 +1809,7 @@ void QTextCharFormat::setUnderlineStyle(UnderlineStyle style) the anchor must be enabled with setAnchor(). */ +#if QT_DEPRECATED_SINCE(5, 13) /*! \fn QString QTextCharFormat::anchorName() const \obsolete @@ -1782,6 +1829,7 @@ QString QTextCharFormat::anchorName() const return QString(); return prop.toString(); } +#endif /*! \fn QStringList QTextCharFormat::anchorNames() const @@ -1919,6 +1967,11 @@ void QTextCharFormat::setFont(const QFont &font, FontPropertiesInheritanceBehavi if (mask & QFont::FamilyResolved) setFontFamily(font.family()); + if (mask & QFont::FamiliesResolved) + setFontFamilies(font.families()); + if (mask & QFont::StyleNameResolved) + setFontStyleName(font.styleName()); + if (mask & QFont::SizeResolved) { const qreal pointSize = font.pointSizeF(); if (pointSize > 0) { @@ -2251,7 +2304,7 @@ QList<QTextOption::Tab> QTextBlockFormat::tabPositions() const \fn void QTextBlockFormat::setHeadingLevel(int level) \since 5.12 - Sets the paragraph's heading level, where 1 is the highest-level heading + Sets the paragraph's heading \a level, where 1 is the highest-level heading type (usually with the largest possible heading font size), and increasing values are progressively deeper into the document (and usually with smaller font sizes). For example when reading an HTML H1 tag, the heading level is diff --git a/src/gui/text/qtextformat.h b/src/gui/text/qtextformat.h index a8e573d5a4..80d8e82694 100644 --- a/src/gui/text/qtextformat.h +++ b/src/gui/text/qtextformat.h @@ -188,6 +188,8 @@ public: FontStyleStrategy = 0x1FE4, FontKerning = 0x1FE5, FontHintingPreference = 0x1FE6, + FontFamilies = 0x1FE7, + FontStyleName = 0x1FE8, FontFamily = 0x2000, FontPointSize = 0x2001, FontSizeAdjustment = 0x2002, @@ -428,6 +430,16 @@ public: inline QString fontFamily() const { return stringProperty(FontFamily); } + inline void setFontFamilies(const QStringList &families) + { setProperty(FontFamilies, QVariant(families)); } + inline QVariant fontFamilies() const + { return property(FontFamilies); } + + inline void setFontStyleName(const QString &styleName) + { setProperty(FontStyleName, styleName); } + inline QVariant fontStyleName() const + { return property(FontStyleName); } + inline void setFontPointSize(qreal size) { setProperty(FontPointSize, size); } inline qreal fontPointSize() const @@ -540,9 +552,13 @@ public: inline QString anchorHref() const { return stringProperty(AnchorHref); } +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use setAnchorNames() instead") inline void setAnchorName(const QString &name) { setAnchorNames(QStringList(name)); } + QT_DEPRECATED_X("Use anchorNames() instead") QString anchorName() const; +#endif inline void setAnchorNames(const QStringList &names) { setProperty(AnchorName, names); } diff --git a/src/gui/text/qtextformat_p.h b/src/gui/text/qtextformat_p.h index 3557c17a97..001a243e84 100644 --- a/src/gui/text/qtextformat_p.h +++ b/src/gui/text/qtextformat_p.h @@ -104,7 +104,7 @@ public: private: QFont defaultFnt; - Q_DISABLE_COPY(QTextFormatCollection) + Q_DISABLE_COPY_MOVE(QTextFormatCollection) }; QT_END_NAMESPACE diff --git a/src/gui/text/qtexthtmlparser.cpp b/src/gui/text/qtexthtmlparser.cpp index 4be800b251..adc3b138f7 100644 --- a/src/gui/text/qtexthtmlparser.cpp +++ b/src/gui/text/qtexthtmlparser.cpp @@ -40,7 +40,6 @@ #include "qtexthtmlparser_p.h" #include <qbytearray.h> -#include <qtextcodec.h> #include <qstack.h> #include <qdebug.h> #include <qthread.h> @@ -862,7 +861,8 @@ QString QTextHtmlParser::parseWord() ++pos; while (pos < len) { QChar c = txt.at(pos++); - if (c == QLatin1Char('\'')) + // Allow for escaped single quotes as they may be part of the string + if (c == QLatin1Char('\'') && (txt.length() > 1 && txt.at(pos - 2) != QLatin1Char('\\'))) break; else word += c; @@ -1544,7 +1544,7 @@ void QTextHtmlParser::applyAttributes(const QStringList &attributes) if (key == QLatin1String("href")) node->charFormat.setAnchorHref(value); else if (key == QLatin1String("name")) - node->charFormat.setAnchorName(value); + node->charFormat.setAnchorNames({value}); break; case Html_img: if (key == QLatin1String("src") || key == QLatin1String("source")) { @@ -1684,7 +1684,7 @@ void QTextHtmlParser::applyAttributes(const QStringList &attributes) node->charFormat.setToolTip(value); } else if (key == QLatin1String("id")) { node->charFormat.setAnchor(true); - node->charFormat.setAnchorName(value); + node->charFormat.setAnchorNames({value}); } } diff --git a/src/gui/text/qtextimagehandler_p.h b/src/gui/text/qtextimagehandler_p.h index 339ef0af4f..fafd394ad3 100644 --- a/src/gui/text/qtextimagehandler_p.h +++ b/src/gui/text/qtextimagehandler_p.h @@ -65,7 +65,7 @@ class Q_GUI_EXPORT QTextImageHandler : public QObject, Q_OBJECT Q_INTERFACES(QTextObjectInterface) public: - explicit QTextImageHandler(QObject *parent = 0); + explicit QTextImageHandler(QObject *parent = nullptr); virtual QSizeF intrinsicSize(QTextDocument *doc, int posInDocument, const QTextFormat &format) override; virtual void drawObject(QPainter *p, const QRectF &rect, QTextDocument *doc, int posInDocument, const QTextFormat &format) override; diff --git a/src/gui/text/qtextlayout.cpp b/src/gui/text/qtextlayout.cpp index ca6866d836..a3e194f835 100644 --- a/src/gui/text/qtextlayout.cpp +++ b/src/gui/text/qtextlayout.cpp @@ -344,6 +344,8 @@ QTextLayout::QTextLayout(const QString& text) } /*! + \since 5.13 + \fn QTextLayout::QTextLayout(const QString &text, const QFont &font, const QPaintDevice *paintdevice) Constructs a text layout to lay out the given \a text with the specified \a font. @@ -351,11 +353,20 @@ QTextLayout::QTextLayout(const QString& text) the paint device, \a paintdevice. If \a paintdevice is 0 the calculations will be done in screen metrics. */ -QTextLayout::QTextLayout(const QString& text, const QFont &font, QPaintDevice *paintdevice) + +#if QT_VERSION < QT_VERSION_CHECK(6, 0, 0) +/*! + \fn QTextLayout::QTextLayout(const QString &text, const QFont &font, QPaintDevice *paintdevice) + \obsolete + Identical to QTextLayout::QTextLayout(const QString &text, const QFont &font, const QPaintDevice *paintdevice) +*/ + +QTextLayout::QTextLayout(const QString &text, const QFont &font, QPaintDevice *paintdevice) +#else +QTextLayout::QTextLayout(const QString &text, const QFont &font, const QPaintDevice *paintdevice) +#endif { - QFont f(font); - if (paintdevice) - f = QFont(font, paintdevice); + const QFont f(paintdevice ? QFont(font, paintdevice) : font); d = new QTextEngine((text.isNull() ? (const QString&)QString::fromLatin1("") : text), f); } @@ -1127,8 +1138,6 @@ void QTextLayout::draw(QPainter *p, const QPointF &pos, const QVector<FormatRang QPainterPath textDoneRegion; for (int i = 0; i < selections.size(); ++i) { FormatRange selection = selections.at(i); - const QBrush bg = selection.format.background(); - QPainterPath region; region.setFillRule(Qt::WindingFill); @@ -1823,6 +1832,9 @@ void QTextLine::layout_helper(int maxGlyphs) lbh.logClusters = eng->layoutData->logClustersPtr; lbh.previousGlyph = 0; + bool hasInlineObject = false; + QFixed maxInlineObjectHeight = 0; + while (newItem < eng->layoutData->items.size()) { lbh.resetRightBearing(); lbh.softHyphenWidth = 0; @@ -1851,8 +1863,11 @@ void QTextLine::layout_helper(int maxGlyphs) lbh.tmpData.leading = qMax(lbh.tmpData.leading + lbh.tmpData.ascent, current.leading + current.ascent) - qMax(lbh.tmpData.ascent, current.ascent); - lbh.tmpData.ascent = qMax(lbh.tmpData.ascent, current.ascent); - lbh.tmpData.descent = qMax(lbh.tmpData.descent, current.descent); + if (current.analysis.flags != QScriptAnalysis::Object) { + // objects need some special treatment as they can special alignment or be floating + lbh.tmpData.ascent = qMax(lbh.tmpData.ascent, current.ascent); + lbh.tmpData.descent = qMax(lbh.tmpData.descent, current.descent); + } if (current.analysis.flags == QScriptAnalysis::Tab && (alignment & (Qt::AlignLeft | Qt::AlignRight | Qt::AlignCenter | Qt::AlignJustify))) { lbh.whiteSpaceOrObject = true; @@ -1900,9 +1915,18 @@ void QTextLine::layout_helper(int maxGlyphs) if (eng->block.docHandle()) { QTextInlineObject inlineObject(item, eng); - eng->docLayout()->positionInlineObject(inlineObject, eng->block.position() + current.position, inlineObject.format()); + QTextFormat f = inlineObject.format(); + eng->docLayout()->positionInlineObject(inlineObject, eng->block.position() + current.position, f); + QTextCharFormat::VerticalAlignment valign = f.toCharFormat().verticalAlignment(); + if (valign != QTextCharFormat::AlignTop && valign != QTextCharFormat::AlignBottom) { + lbh.tmpData.ascent = qMax(lbh.tmpData.ascent, current.ascent); + lbh.tmpData.descent = qMax(lbh.tmpData.descent, current.descent); + } } + hasInlineObject = true; + maxInlineObjectHeight = qMax(maxInlineObjectHeight, current.ascent + current.descent); + lbh.tmpData.textWidth += current.width; newItem = item + 1; @@ -2038,6 +2062,43 @@ found: line += lbh.tmpData; } + if (hasInlineObject && eng->block.docHandle()) { + // position top/bottom aligned inline objects + if (maxInlineObjectHeight > line.ascent + line.descent) { + // extend line height if required + QFixed toAdd = (maxInlineObjectHeight - line.ascent - line.descent)/2; + line.ascent += toAdd; + line.descent = maxInlineObjectHeight - line.ascent; + } + int startItem = eng->findItem(line.from); + int endItem = eng->findItem(line.from + line.length); + if (endItem < 0) + endItem = eng->layoutData->items.size(); + for (int item = startItem; item < endItem; ++item) { + QScriptItem ¤t = eng->layoutData->items[item]; + if (current.analysis.flags == QScriptAnalysis::Object) { + QTextInlineObject inlineObject(item, eng); + QTextCharFormat::VerticalAlignment align = inlineObject.format().toCharFormat().verticalAlignment(); + QFixed height = current.ascent + current.descent; + switch (align) { + case QTextCharFormat::AlignTop: + current.ascent = line.ascent; + current.descent = height - line.ascent; + break; + case QTextCharFormat::AlignBottom: + current.descent = line.descent; + current.ascent = height - line.descent; + break; + default: + break; + } + Q_ASSERT(line.ascent >= current.ascent); + Q_ASSERT(line.descent >= current.descent); + } + } + } + + LB_DEBUG("line length = %d, ascent=%f, descent=%f, textWidth=%f (spacew=%f)", line.length, line.ascent.toReal(), line.descent.toReal(), line.textWidth.toReal(), lbh.spaceData.width.toReal()); LB_DEBUG(" : '%s'", eng->layoutData->string.mid(line.from, line.length).toUtf8().data()); @@ -2511,6 +2572,8 @@ void QTextLine::draw(QPainter *p, const QPointF &pos, const QTextLayout::FormatR QFixed itemY = y - si.ascent; if (format.verticalAlignment() == QTextCharFormat::AlignTop) { itemY = y - lineBase; + } else if (format.verticalAlignment() == QTextCharFormat::AlignBottom) { + itemY = y + line.descent - si.ascent - si.descent; } QRectF itemRect(iterator.x.toReal(), itemY.toReal(), iterator.itemWidth.toReal(), si.height().toReal()); @@ -2544,6 +2607,7 @@ void QTextLine::draw(QPainter *p, const QPointF &pos, const QTextLayout::FormatR Qt::IntersectClip); else x /= 2; // Centered + p->setFont(f); p->drawText(QPointF(iterator.x.toReal() + x, y.toReal()), visualTab); } @@ -2617,8 +2681,11 @@ void QTextLine::draw(QPainter *p, const QPointF &pos, const QTextLayout::FormatR if (c.style() != Qt::NoBrush) p->setPen(c.color()); QChar visualSpace(si.analysis.flags == QScriptAnalysis::Space ? (ushort)0xb7 : (ushort)0xb0); + QFont oldFont = p->font(); + p->setFont(eng->font(si)); p->drawText(QPointF(iterator.x.toReal(), itemBaseLine.toReal()), visualSpace); p->setPen(pen); + p->setFont(oldFont); } } eng->drawDecorations(p); diff --git a/src/gui/text/qtextlayout.h b/src/gui/text/qtextlayout.h index 67bc75a6b8..a29791534e 100644 --- a/src/gui/text/qtextlayout.h +++ b/src/gui/text/qtextlayout.h @@ -107,7 +107,19 @@ public: // does itemization QTextLayout(); QTextLayout(const QString& text); - QTextLayout(const QString& text, const QFont &font, QPaintDevice *paintdevice = nullptr); +#if QT_VERSION < QT_VERSION_CHECK(6, 0, 0) + QTextLayout(const QString &text, const QFont &font, QPaintDevice *paintdevice = nullptr); +#ifndef Q_QDOC + // the template is necessary to make QTextLayout(font,text,nullptr) and QTextLayout(font,text,NULL) + // not ambiguous. Implementation detail that should not be documented. + template<char = 0> +#endif + QTextLayout(const QString &text, const QFont &font, const QPaintDevice *paintdevice) + : QTextLayout(text, font, const_cast<QPaintDevice*>(paintdevice)) + {} +#else + QTextLayout(const QString &text, const QFont &font, const QPaintDevice *paintdevice = nullptr); +#endif QTextLayout(const QTextBlock &b); ~QTextLayout(); diff --git a/src/gui/text/qtextlist.cpp b/src/gui/text/qtextlist.cpp index bec33d5f4d..5857afa048 100644 --- a/src/gui/text/qtextlist.cpp +++ b/src/gui/text/qtextlist.cpp @@ -100,6 +100,7 @@ public: \sa QTextBlock, QTextListFormat, QTextCursor */ +#if QT_DEPRECATED_SINCE(5, 13) /*! \fn bool QTextList::isEmpty() const \obsolete @@ -111,6 +112,7 @@ public: \sa count() */ +#endif /*! \internal */ diff --git a/src/gui/text/qtextlist.h b/src/gui/text/qtextlist.h index 3967787f03..cfb9f9456f 100644 --- a/src/gui/text/qtextlist.h +++ b/src/gui/text/qtextlist.h @@ -59,8 +59,11 @@ public: int count() const; +#if QT_DEPRECATED_SINCE(5, 13) + QT_DEPRECATED_X("Use count() instead") inline bool isEmpty() const { return count() == 0; } +#endif QTextBlock item(int i) const; diff --git a/src/gui/text/qtextobject.cpp b/src/gui/text/qtextobject.cpp index e2130a09d9..9156ee6af4 100644 --- a/src/gui/text/qtextobject.cpp +++ b/src/gui/text/qtextobject.cpp @@ -678,7 +678,7 @@ QTextFrame::iterator::iterator(QTextFrame *frame, int block, int begin, int end) /*! Copy constructor. Constructs a copy of the \a other iterator. */ -QTextFrame::iterator::iterator(const iterator &other) Q_DECL_NOTHROW +QTextFrame::iterator::iterator(const iterator &other) noexcept { f = other.f; b = other.b; @@ -691,7 +691,7 @@ QTextFrame::iterator::iterator(const iterator &other) Q_DECL_NOTHROW Assigns \a other to this iterator and returns a reference to this iterator. */ -QTextFrame::iterator &QTextFrame::iterator::operator=(const iterator &other) Q_DECL_NOTHROW +QTextFrame::iterator &QTextFrame::iterator::operator=(const iterator &other) noexcept { f = other.f; b = other.b; @@ -704,8 +704,8 @@ QTextFrame::iterator &QTextFrame::iterator::operator=(const iterator &other) Q_D #endif /*! - Returns the current frame pointed to by the iterator, or 0 if the - iterator currently points to a block. + Returns the current frame pointed to by the iterator, or \nullptr + if the iterator currently points to a block. \sa currentBlock() */ @@ -1291,22 +1291,22 @@ QVector<QTextLayout::FormatRange> QTextBlock::textFormats() const } /*! - Returns the text document this text block belongs to, or 0 if the - text block does not belong to any document. + Returns the text document this text block belongs to, or \nullptr + if the text block does not belong to any document. */ const QTextDocument *QTextBlock::document() const { - return p ? p->document() : 0; + return p ? p->document() : nullptr; } /*! If the block represents a list item, returns the list that the item belongs - to; otherwise returns 0. + to; otherwise returns \nullptr. */ QTextList *QTextBlock::textList() const { if (!isValid()) - return 0; + return nullptr; const QTextBlockFormat fmt = blockFormat(); QTextObject *obj = p->document()->objectForFormat(fmt); diff --git a/src/gui/text/qtextobject.h b/src/gui/text/qtextobject.h index 067f8473ea..586a593dd2 100644 --- a/src/gui/text/qtextobject.h +++ b/src/gui/text/qtextobject.h @@ -151,11 +151,11 @@ public: public: iterator(); // ### Qt 6: inline #if QT_VERSION < QT_VERSION_CHECK(6,0,0) - iterator(const iterator &o) Q_DECL_NOTHROW; // = default - iterator &operator=(const iterator &o) Q_DECL_NOTHROW; // = default - iterator(iterator &&other) Q_DECL_NOTHROW // = default + iterator(const iterator &o) noexcept; // = default + iterator &operator=(const iterator &o) noexcept; // = default + iterator(iterator &&other) noexcept // = default { memcpy(static_cast<void *>(this), static_cast<void *>(&other), sizeof(iterator)); } - iterator &operator=(iterator &&other) Q_DECL_NOTHROW // = default + iterator &operator=(iterator &&other) noexcept // = default { memcpy(static_cast<void *>(this), static_cast<void *>(&other), sizeof(iterator)); return *this; } #endif diff --git a/src/gui/text/qtextobject_p.h b/src/gui/text/qtextobject_p.h index 81ab023cc3..87c83868da 100644 --- a/src/gui/text/qtextobject_p.h +++ b/src/gui/text/qtextobject_p.h @@ -93,7 +93,7 @@ class QTextFramePrivate : public QTextObjectPrivate Q_DECLARE_PUBLIC(QTextFrame) public: QTextFramePrivate(QTextDocument *doc) - : QTextObjectPrivate(doc), fragment_start(0), fragment_end(0), parentFrame(0), layoutData(0) + : QTextObjectPrivate(doc), fragment_start(0), fragment_end(0), parentFrame(nullptr), layoutData(nullptr) { } virtual void fragmentAdded(QChar type, uint fragment); diff --git a/src/gui/text/qtextodfwriter.cpp b/src/gui/text/qtextodfwriter.cpp index 5f6a24cc5d..a62e7e425a 100644 --- a/src/gui/text/qtextodfwriter.cpp +++ b/src/gui/text/qtextodfwriter.cpp @@ -496,10 +496,12 @@ void QTextOdfWriter::writeFormats(QXmlStreamWriter &writer, const QSet<int> &for else writeFrameFormat(writer, textFormat.toFrameFormat(), formatIndex); break; +#if QT_DEPRECATED_SINCE(5, 3) case QTextFormat::TableFormat: // this case never happens, because TableFormat is a FrameFormat Q_UNREACHABLE(); break; +#endif } } @@ -886,26 +888,30 @@ void QTextOdfWriter::tableCellStyleElement(QXmlStreamWriter &writer, const int & if (hasBorder) { writer.writeAttribute(foNS, QString::fromLatin1("border"), pixelToPoint(tableFormatTmp.border()) + QLatin1String(" ") - + borderStyleName(tableFormatTmp.borderStyle()) - + QLatin1String(" #000000")); //!! HARD-CODING color black + + borderStyleName(tableFormatTmp.borderStyle()) + QLatin1String(" ") + + tableFormatTmp.borderBrush().color().name(QColor::HexRgb)); } - qreal padding = format.topPadding(); - if (padding > 0 && padding == format.bottomPadding() - && padding == format.leftPadding() && padding == format.rightPadding()) { + qreal topPadding = format.topPadding(); + qreal padding = topPadding + tableFormatTmp.cellPadding(); + if (padding > 0 && topPadding == format.bottomPadding() + && topPadding == format.leftPadding() && topPadding == format.rightPadding()) { writer.writeAttribute(foNS, QString::fromLatin1("padding"), pixelToPoint(padding)); } else { if (padding > 0) writer.writeAttribute(foNS, QString::fromLatin1("padding-top"), pixelToPoint(padding)); - if (format.bottomPadding() > 0) + padding = format.bottomPadding() + tableFormatTmp.cellPadding(); + if (padding > 0) writer.writeAttribute(foNS, QString::fromLatin1("padding-bottom"), - pixelToPoint(format.bottomPadding())); - if (format.leftPadding() > 0) + pixelToPoint(padding)); + padding = format.leftPadding() + tableFormatTmp.cellPadding(); + if (padding > 0) writer.writeAttribute(foNS, QString::fromLatin1("padding-left"), - pixelToPoint(format.leftPadding())); - if (format.rightPadding() > 0) + pixelToPoint(padding)); + padding = format.rightPadding() + tableFormatTmp.cellPadding(); + if (padding > 0) writer.writeAttribute(foNS, QString::fromLatin1("padding-right"), - pixelToPoint(format.rightPadding())); + pixelToPoint(padding)); } if (format.hasProperty(QTextFormat::TextVerticalAlignment)) { @@ -957,11 +963,11 @@ bool QTextOdfWriter::writeAll() m_strategy = new QXmlStreamStrategy(m_device); if (!m_device->isWritable() && ! m_device->open(QIODevice::WriteOnly)) { - qWarning("QTextOdfWriter::writeAll: the device can not be opened for writing"); + qWarning("QTextOdfWriter::writeAll: the device cannot be opened for writing"); return false; } QXmlStreamWriter writer(m_strategy->contentStream); -#ifndef QT_NO_TEXTCODEC +#if QT_CONFIG(textcodec) if (m_codec) writer.setCodec(m_codec); #endif diff --git a/src/gui/text/qtexttable.cpp b/src/gui/text/qtexttable.cpp index 9639c18d2b..39f26d5d42 100644 --- a/src/gui/text/qtexttable.cpp +++ b/src/gui/text/qtexttable.cpp @@ -696,18 +696,22 @@ void QTextTable::insertRows(int pos, int num) int extended = 0; int insert_before = 0; if (pos > 0 && pos < d->nRows) { + int lastCell = -1; for (int i = 0; i < d->nCols; ++i) { int cell = d->grid[pos*d->nCols + i]; if (cell == d->grid[(pos-1)*d->nCols+i]) { // cell spans the insertion place, extend it - QTextDocumentPrivate::FragmentIterator it(&p->fragmentMap(), cell); - QTextCharFormat fmt = c->charFormat(it->format); - fmt.setTableCellRowSpan(fmt.tableCellRowSpan() + num); - p->setCharFormat(it.position(), 1, fmt); + if (cell != lastCell) { + QTextDocumentPrivate::FragmentIterator it(&p->fragmentMap(), cell); + QTextCharFormat fmt = c->charFormat(it->format); + fmt.setTableCellRowSpan(fmt.tableCellRowSpan() + num); + p->setCharFormat(it.position(), 1, fmt); + } extended++; } else if (!insert_before) { insert_before = cell; } + lastCell = cell; } } else { insert_before = (pos == 0 ? d->grid[0] : d->fragment_end); diff --git a/src/gui/text/qtexttable_p.h b/src/gui/text/qtexttable_p.h index c969e1d5bc..5c05611009 100644 --- a/src/gui/text/qtexttable_p.h +++ b/src/gui/text/qtexttable_p.h @@ -61,7 +61,7 @@ class QTextTablePrivate : public QTextFramePrivate { Q_DECLARE_PUBLIC(QTextTable) public: - QTextTablePrivate(QTextDocument *document) : QTextFramePrivate(document), grid(0), nRows(0), nCols(0), dirty(true), blockFragmentUpdates(false) {} + QTextTablePrivate(QTextDocument *document) : QTextFramePrivate(document), grid(nullptr), nRows(0), nCols(0), dirty(true), blockFragmentUpdates(false) {} ~QTextTablePrivate(); static QTextTable *createTable(QTextDocumentPrivate *, int pos, int rows, int cols, const QTextTableFormat &tableFormat); diff --git a/src/gui/text/qzipreader_p.h b/src/gui/text/qzipreader_p.h index eed6ee6a62..6fec8d7719 100644 --- a/src/gui/text/qzipreader_p.h +++ b/src/gui/text/qzipreader_p.h @@ -79,11 +79,11 @@ public: struct FileInfo { - FileInfo() Q_DECL_NOTHROW + FileInfo() noexcept : isDir(false), isFile(false), isSymLink(false), crc(0), size(0) {} - bool isValid() const Q_DECL_NOTHROW { return isDir || isFile || isSymLink; } + bool isValid() const noexcept { return isDir || isFile || isSymLink; } QString filePath; uint isDir : 1; @@ -116,7 +116,7 @@ public: private: QZipReaderPrivate *d; - Q_DISABLE_COPY(QZipReader) + Q_DISABLE_COPY_MOVE(QZipReader) }; Q_DECLARE_TYPEINFO(QZipReader::FileInfo, Q_MOVABLE_TYPE); Q_DECLARE_TYPEINFO(QZipReader::Status, Q_PRIMITIVE_TYPE); diff --git a/src/gui/text/qzipwriter_p.h b/src/gui/text/qzipwriter_p.h index 433bbab31e..b3bb5929cf 100644 --- a/src/gui/text/qzipwriter_p.h +++ b/src/gui/text/qzipwriter_p.h @@ -108,7 +108,7 @@ public: void close(); private: QZipWriterPrivate *d; - Q_DISABLE_COPY(QZipWriter) + Q_DISABLE_COPY_MOVE(QZipWriter) }; QT_END_NAMESPACE diff --git a/src/gui/util/qastchandler.cpp b/src/gui/util/qastchandler.cpp new file mode 100644 index 0000000000..6d163c6701 --- /dev/null +++ b/src/gui/util/qastchandler.cpp @@ -0,0 +1,168 @@ +/**************************************************************************** +** +** Copyright (C) 2019 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#include "qastchandler_p.h" +#include "qtexturefiledata_p.h" + +#include <private/qnumeric_p.h> + +#include <QFile> +#include <QDebug> +#include <QSize> + +QT_BEGIN_NAMESPACE + +struct AstcHeader +{ + quint8 magic[4]; + quint8 blockDimX; + quint8 blockDimY; + quint8 blockDimZ; + quint8 xSize[3]; + quint8 ySize[3]; + quint8 zSize[3]; +}; + +bool QAstcHandler::canRead(const QByteArray &suffix, const QByteArray &block) +{ + Q_UNUSED(suffix) + + return block.startsWith("\x13\xAB\xA1\x5C"); +} + +quint32 QAstcHandler::astcGLFormat(quint8 xBlockDim, quint8 yBlockDim) const +{ + static const quint32 glFormatRGBABase = 0x93B0; // GL_COMPRESSED_RGBA_ASTC_4x4_KHR + static const quint32 glFormatSRGBBase = 0x93D0; // GL_COMPRESSED_SRGB8_ALPHA8_ASTC_4x4_KHR + + static QSize dims[14] = { + { 4, 4 }, // GL_COMPRESSED_xxx_ASTC_4x4_KHR + { 5, 4 }, // GL_COMPRESSED_xxx_ASTC_5x4_KHR + { 5, 5 }, // GL_COMPRESSED_xxx_ASTC_5x5_KHR + { 6, 5 }, // GL_COMPRESSED_xxx_ASTC_6x5_KHR + { 6, 6 }, // GL_COMPRESSED_xxx_ASTC_6x6_KHR + { 8, 5 }, // GL_COMPRESSED_xxx_ASTC_8x5_KHR + { 8, 6 }, // GL_COMPRESSED_xxx_ASTC_8x6_KHR + { 8, 8 }, // GL_COMPRESSED_xxx_ASTC_8x8_KHR + { 10, 5 }, // GL_COMPRESSED_xxx_ASTC_10x5_KHR + { 10, 6 }, // GL_COMPRESSED_xxx_ASTC_10x6_KHR + { 10, 8 }, // GL_COMPRESSED_xxx_ASTC_10x8_KHR + { 10, 10 }, // GL_COMPRESSED_xxx_ASTC_10x10_KHR + { 12, 10 }, // GL_COMPRESSED_xxx_ASTC_12x10_KHR + { 12, 12 } // GL_COMPRESSED_xxx_ASTC_12x12_KHR + }; + + const QSize dim(xBlockDim, yBlockDim); + int index = -1; + for (int i = 0; i < 14; i++) { + if (dim == dims[i]) { + index = i; + break; + } + } + if (index < 0) + return 0; + + bool useSrgb = qEnvironmentVariableIsSet("QT_ASTCHANDLER_USE_SRGB") + || logName().toLower().contains("srgb"); + + return useSrgb ? (glFormatSRGBBase + index) : (glFormatRGBABase + index); +} + +QTextureFileData QAstcHandler::read() +{ + QTextureFileData nullData; + QTextureFileData res; + + if (!device()) + return nullData; + + QByteArray fileData = device()->readAll(); + if (fileData.size() < int(sizeof(AstcHeader)) || !canRead(QByteArray(), fileData)) { + qCDebug(lcQtGuiTextureIO, "Not an ASTC file: %s", logName().constData()); + return nullData; + } + res.setData(fileData); + + const AstcHeader *header = reinterpret_cast<const AstcHeader *>(fileData.constData()); + + int xSz = int(header->xSize[0]) | int(header->xSize[1]) << 8 | int(header->xSize[2]) << 16; + int ySz = int(header->ySize[0]) | int(header->ySize[1]) << 8 | int(header->ySize[2]) << 16; + int zSz = int(header->zSize[0]) | int(header->zSize[1]) << 8 | int(header->zSize[2]) << 16; + + quint32 glFmt = astcGLFormat(header->blockDimX, header->blockDimY); + + if (!xSz || !ySz || !zSz || !glFmt || header->blockDimZ != 1) { + qCDebug(lcQtGuiTextureIO, "Invalid ASTC header data in file %s", logName().constData()); + return nullData; + } + + res.setSize(QSize(xSz, ySz)); + res.setGLFormat(0); // 0 for compressed textures + res.setGLInternalFormat(glFmt); + //? BaseInternalFormat + + int xBlocks = (xSz + header->blockDimX - 1) / header->blockDimX; + int yBlocks = (ySz + header->blockDimY - 1) / header->blockDimY; + int zBlocks = (zSz + header->blockDimZ - 1) / header->blockDimZ; + + int byteCount = 0; + bool oob = mul_overflow(xBlocks, yBlocks, &byteCount) + || mul_overflow(byteCount, zBlocks, &byteCount) + || mul_overflow(byteCount, 16, &byteCount); + + + res.setDataOffset(sizeof(AstcHeader)); + res.setNumLevels(1); + res.setDataLength(byteCount); + + if (oob || !res.isValid()) { + qCDebug(lcQtGuiTextureIO, "Invalid ASTC file %s", logName().constData()); + return nullData; + } + + res.setLogName(logName()); + +#if 0 + qDebug() << "ASTC file handler read" << res << res.dataOffset() << res.dataLength(); +#endif + return res; +} + +QT_END_NAMESPACE diff --git a/src/gui/util/qastchandler_p.h b/src/gui/util/qastchandler_p.h new file mode 100644 index 0000000000..398f1833b6 --- /dev/null +++ b/src/gui/util/qastchandler_p.h @@ -0,0 +1,73 @@ +/**************************************************************************** +** +** Copyright (C) 2019 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QASTCHANDLER_H +#define QASTCHANDLER_H + +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// + +#include "qtexturefilehandler_p.h" + +QT_BEGIN_NAMESPACE + +class QAstcHandler : public QTextureFileHandler +{ +public: + using QTextureFileHandler::QTextureFileHandler; + + static bool canRead(const QByteArray &suffix, const QByteArray &block); + + QTextureFileData read() override; + +private: + quint32 astcGLFormat(quint8 xBlockDim, quint8 yBlockDim) const; +}; + +QT_END_NAMESPACE + +#endif // QASTCHANDLER_H diff --git a/src/gui/util/qdesktopservices.cpp b/src/gui/util/qdesktopservices.cpp index de9d087c21..8c7cf8682c 100644 --- a/src/gui/util/qdesktopservices.cpp +++ b/src/gui/util/qdesktopservices.cpp @@ -187,12 +187,7 @@ void QOpenUrlHandlerRegistry::handlerDestroyed(QObject *handler) \l{https://developer.apple.com/documentation/uikit/uiapplication/1622952-canopenurl}{canOpenURL(_:)}. For example, the following lines enable URLs with the HTTPS scheme: - \code - <key>LSApplicationQueriesSchemes</key> - <array> - <string>https</string> - </array> - \endcode + \snippet code/src_gui_util_qdesktopservices.cpp 3 \sa setUrlHandler() */ @@ -249,20 +244,12 @@ bool QDesktopServices::openUrl(const QUrl &url) The provided method must be implemented as a slot that only accepts a single QUrl argument. + \snippet code/src_gui_util_qdesktopservices.cpp 0 + To use this function for receiving data from other apps on iOS you also need to add the custom scheme to the \c CFBundleURLSchemes list in your Info.plist file: - \code - <key>CFBundleURLTypes</key> - <array> - <dict> - <key>CFBundleURLSchemes</key> - <array> - <string>myapp</string> - </array> - </dict> - </array> - \endcode + \snippet code/src_gui_util_qdesktopservices.cpp 4 For more information, see the Apple Developer Documentation for \l{https://developer.apple.com/documentation/uikit/core_app/allowing_apps_and_websites_to_link_to_your_content/communicating_with_other_apps_using_custom_urls?language=objc}{Communicating with Other Apps Using Custom URLs}. @@ -346,14 +333,9 @@ void QDesktopServices::unsetUrlHandler(const QString &scheme) wasn't called, while in Qt 5 it defaults to the name of the executable. Therefore, if you still need to access the Qt 4 path (for example for data migration to Qt 5), replace - \code - QDesktopServices::storageLocation(QDesktopServices::DataLocation) - \endcode + \snippet code/src_gui_util_qdesktopservices.cpp 5 with - \code - QStandardPaths::writableLocation(QStandardPaths::GenericDataLocation) + - "/data/organization/application" - \endcode + \snippet code/src_gui_util_qdesktopservices.cpp 6 (assuming an organization name and an application name were set). */ diff --git a/src/gui/util/qgridlayoutengine_p.h b/src/gui/util/qgridlayoutengine_p.h index 5f0cc5da73..5f0e84edb1 100644 --- a/src/gui/util/qgridlayoutengine_p.h +++ b/src/gui/util/qgridlayoutengine_p.h @@ -180,7 +180,7 @@ public: t = &q_minimumAscent; break; default: - t = 0; + t = nullptr; break; } return *t; @@ -205,7 +205,7 @@ public: t = &q_minimumAscent; break; default: - t = 0; + t = nullptr; break; } return *t; @@ -276,7 +276,7 @@ class Q_GUI_EXPORT QGridLayoutItem { public: QGridLayoutItem(int row, int column, int rowSpan = 1, int columnSpan = 1, - Qt::Alignment alignment = 0); + Qt::Alignment alignment = nullptr); virtual ~QGridLayoutItem() {} inline int firstRow() const { return q_firstRows[Ver]; } @@ -339,7 +339,7 @@ private: class Q_GUI_EXPORT QGridLayoutEngine { public: - QGridLayoutEngine(Qt::Alignment defaultAlignment = Qt::Alignment(0), bool snapToPixelGrid = false); + QGridLayoutEngine(Qt::Alignment defaultAlignment = Qt::Alignment(nullptr), bool snapToPixelGrid = false); inline ~QGridLayoutEngine() { qDeleteAll(q_items); } int rowCount(Qt::Orientation orientation) const; diff --git a/src/gui/util/qlayoutpolicy.cpp b/src/gui/util/qlayoutpolicy.cpp index b2b18c0c8b..507df44a45 100644 --- a/src/gui/util/qlayoutpolicy.cpp +++ b/src/gui/util/qlayoutpolicy.cpp @@ -3,7 +3,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the Qt Quick Layouts module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/util/qlayoutpolicy_p.h b/src/gui/util/qlayoutpolicy_p.h index a729a57e8b..6457aeb653 100644 --- a/src/gui/util/qlayoutpolicy_p.h +++ b/src/gui/util/qlayoutpolicy_p.h @@ -3,7 +3,7 @@ ** Copyright (C) 2016 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the Qt Quick Layouts module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage @@ -66,6 +66,7 @@ class QVariant; class Q_GUI_EXPORT QLayoutPolicy { + Q_GADGET Q_ENUMS(Policy) public: diff --git a/src/gui/util/qshaderformat.cpp b/src/gui/util/qshaderformat.cpp index 373bfb9e7e..324d84ffe1 100644 --- a/src/gui/util/qshaderformat.cpp +++ b/src/gui/util/qshaderformat.cpp @@ -41,58 +41,58 @@ QT_BEGIN_NAMESPACE -QShaderFormat::QShaderFormat() Q_DECL_NOTHROW +QShaderFormat::QShaderFormat() noexcept : m_api(NoApi) { } -QShaderFormat::Api QShaderFormat::api() const Q_DECL_NOTHROW +QShaderFormat::Api QShaderFormat::api() const noexcept { return m_api; } -void QShaderFormat::setApi(QShaderFormat::Api api) Q_DECL_NOTHROW +void QShaderFormat::setApi(QShaderFormat::Api api) noexcept { m_api = api; } -QVersionNumber QShaderFormat::version() const Q_DECL_NOTHROW +QVersionNumber QShaderFormat::version() const noexcept { return m_version; } -void QShaderFormat::setVersion(const QVersionNumber &version) Q_DECL_NOTHROW +void QShaderFormat::setVersion(const QVersionNumber &version) noexcept { m_version = version; } -QStringList QShaderFormat::extensions() const Q_DECL_NOTHROW +QStringList QShaderFormat::extensions() const noexcept { return m_extensions; } -void QShaderFormat::setExtensions(const QStringList &extensions) Q_DECL_NOTHROW +void QShaderFormat::setExtensions(const QStringList &extensions) noexcept { m_extensions = extensions; m_extensions.sort(); } -QString QShaderFormat::vendor() const Q_DECL_NOTHROW +QString QShaderFormat::vendor() const noexcept { return m_vendor; } -void QShaderFormat::setVendor(const QString &vendor) Q_DECL_NOTHROW +void QShaderFormat::setVendor(const QString &vendor) noexcept { m_vendor = vendor; } -bool QShaderFormat::isValid() const Q_DECL_NOTHROW +bool QShaderFormat::isValid() const noexcept { return m_api != NoApi && m_version.majorVersion() > 0; } -bool QShaderFormat::supports(const QShaderFormat &other) const Q_DECL_NOTHROW +bool QShaderFormat::supports(const QShaderFormat &other) const noexcept { if (!isValid() || !other.isValid()) return false; @@ -119,7 +119,7 @@ bool QShaderFormat::supports(const QShaderFormat &other) const Q_DECL_NOTHROW return true; } -bool operator==(const QShaderFormat &lhs, const QShaderFormat &rhs) Q_DECL_NOTHROW +bool operator==(const QShaderFormat &lhs, const QShaderFormat &rhs) noexcept { return lhs.api() == rhs.api() && lhs.version() == rhs.version() diff --git a/src/gui/util/qshaderformat_p.h b/src/gui/util/qshaderformat_p.h index 064c2364a7..84bf71fdb6 100644 --- a/src/gui/util/qshaderformat_p.h +++ b/src/gui/util/qshaderformat_p.h @@ -69,22 +69,22 @@ public: OpenGLES }; - Q_GUI_EXPORT QShaderFormat() Q_DECL_NOTHROW; + Q_GUI_EXPORT QShaderFormat() noexcept; - Q_GUI_EXPORT Api api() const Q_DECL_NOTHROW; - Q_GUI_EXPORT void setApi(Api api) Q_DECL_NOTHROW; + Q_GUI_EXPORT Api api() const noexcept; + Q_GUI_EXPORT void setApi(Api api) noexcept; - Q_GUI_EXPORT QVersionNumber version() const Q_DECL_NOTHROW; - Q_GUI_EXPORT void setVersion(const QVersionNumber &version) Q_DECL_NOTHROW; + Q_GUI_EXPORT QVersionNumber version() const noexcept; + Q_GUI_EXPORT void setVersion(const QVersionNumber &version) noexcept; - Q_GUI_EXPORT QStringList extensions() const Q_DECL_NOTHROW; - Q_GUI_EXPORT void setExtensions(const QStringList &extensions) Q_DECL_NOTHROW; + Q_GUI_EXPORT QStringList extensions() const noexcept; + Q_GUI_EXPORT void setExtensions(const QStringList &extensions) noexcept; - Q_GUI_EXPORT QString vendor() const Q_DECL_NOTHROW; - Q_GUI_EXPORT void setVendor(const QString &vendor) Q_DECL_NOTHROW; + Q_GUI_EXPORT QString vendor() const noexcept; + Q_GUI_EXPORT void setVendor(const QString &vendor) noexcept; - Q_GUI_EXPORT bool isValid() const Q_DECL_NOTHROW; - Q_GUI_EXPORT bool supports(const QShaderFormat &other) const Q_DECL_NOTHROW; + Q_GUI_EXPORT bool isValid() const noexcept; + Q_GUI_EXPORT bool supports(const QShaderFormat &other) const noexcept; private: Api m_api; @@ -93,9 +93,9 @@ private: QString m_vendor; }; -Q_GUI_EXPORT bool operator==(const QShaderFormat &lhs, const QShaderFormat &rhs) Q_DECL_NOTHROW; +Q_GUI_EXPORT bool operator==(const QShaderFormat &lhs, const QShaderFormat &rhs) noexcept; -inline bool operator!=(const QShaderFormat &lhs, const QShaderFormat &rhs) Q_DECL_NOTHROW +inline bool operator!=(const QShaderFormat &lhs, const QShaderFormat &rhs) noexcept { return !(lhs == rhs); } diff --git a/src/gui/util/qshadergenerator.cpp b/src/gui/util/qshadergenerator.cpp index ae45c03fd1..60cf5a2fc5 100644 --- a/src/gui/util/qshadergenerator.cpp +++ b/src/gui/util/qshadergenerator.cpp @@ -260,21 +260,22 @@ namespace QByteArray replaceParameters(const QByteArray &original, const QShaderNode &node, const QShaderFormat &format) { - auto result = original; + QByteArray result = original; - for (const auto ¶meterName : node.parameterNames()) { - const auto placeholder = QByteArray(QByteArrayLiteral("$") + parameterName.toUtf8()); - const auto parameter = node.parameter(parameterName); + const QStringList parameterNames = node.parameterNames(); + for (const QString ¶meterName : parameterNames) { + const QByteArray placeholder = QByteArray(QByteArrayLiteral("$") + parameterName.toUtf8()); + const QVariant parameter = node.parameter(parameterName); if (parameter.userType() == qMetaTypeId<QShaderLanguage::StorageQualifier>()) { - const auto qualifier = parameter.value<QShaderLanguage::StorageQualifier>(); - const auto value = toGlsl(qualifier, format); + const QShaderLanguage::StorageQualifier qualifier = parameter.value<QShaderLanguage::StorageQualifier>(); + const QByteArray value = toGlsl(qualifier, format); result.replace(placeholder, value); } else if (parameter.userType() == qMetaTypeId<QShaderLanguage::VariableType>()) { - const auto type = parameter.value<QShaderLanguage::VariableType>(); - const auto value = toGlsl(type); + const QShaderLanguage::VariableType type = parameter.value<QShaderLanguage::VariableType>(); + const QByteArray value = toGlsl(type); result.replace(placeholder, value); } else { - const auto value = parameter.toString().toUtf8(); + const QByteArray value = parameter.toString().toUtf8(); result.replace(placeholder, value); } } @@ -288,20 +289,20 @@ QByteArray QShaderGenerator::createShaderCode(const QStringList &enabledLayers) auto code = QByteArrayList(); if (format.isValid()) { - const auto isGLES = format.api() == QShaderFormat::OpenGLES; - const auto major = format.version().majorVersion(); - const auto minor = format.version().minorVersion(); + const bool isGLES = format.api() == QShaderFormat::OpenGLES; + const int major = format.version().majorVersion(); + const int minor = format.version().minorVersion(); - const auto version = major == 2 && isGLES ? 100 - : major == 3 && isGLES ? 300 - : major == 2 ? 100 + 10 * (minor + 1) - : major == 3 && minor <= 2 ? 100 + 10 * (minor + 3) - : major * 100 + minor * 10; + const int version = major == 2 && isGLES ? 100 + : major == 3 && isGLES ? 300 + : major == 2 ? 100 + 10 * (minor + 1) + : major == 3 && minor <= 2 ? 100 + 10 * (minor + 3) + : major * 100 + minor * 10; - const auto profile = isGLES && version > 100 ? QByteArrayLiteral(" es") - : version >= 150 && format.api() == QShaderFormat::OpenGLCoreProfile ? QByteArrayLiteral(" core") - : version >= 150 && format.api() == QShaderFormat::OpenGLCompatibilityProfile ? QByteArrayLiteral(" compatibility") - : QByteArray(); + const QByteArray profile = isGLES && version > 100 ? QByteArrayLiteral(" es") + : version >= 150 && format.api() == QShaderFormat::OpenGLCoreProfile ? QByteArrayLiteral(" core") + : version >= 150 && format.api() == QShaderFormat::OpenGLCompatibilityProfile ? QByteArrayLiteral(" compatibility") + : QByteArray(); code << (QByteArrayLiteral("#version ") + QByteArray::number(version) + profile); code << QByteArray(); @@ -313,9 +314,11 @@ QByteArray QShaderGenerator::createShaderCode(const QStringList &enabledLayers) [enabledLayers] (const QString &s) { return enabledLayers.contains(s); }); }; - for (const auto &node : graph.nodes()) { + const QVector<QShaderNode> nodes = graph.nodes(); + for (const QShaderNode &node : nodes) { if (intersectsEnabledLayers(node.layers())) { - for (const auto &snippet : node.rule(format).headerSnippets) { + const QByteArrayList headerSnippets = node.rule(format).headerSnippets; + for (const QByteArray &snippet : headerSnippets) { code << replaceParameters(snippet, node, format); } } @@ -325,17 +328,18 @@ QByteArray QShaderGenerator::createShaderCode(const QStringList &enabledLayers) code << QByteArrayLiteral("void main()"); code << QByteArrayLiteral("{"); - for (const auto &statement : graph.createStatements(enabledLayers)) { - const auto node = statement.node; - auto line = node.rule(format).substitution; - for (const auto &port : node.ports()) { - const auto portName = port.name; - const auto portDirection = port.direction; - const auto isInput = port.direction == QShaderNodePort::Input; + for (const QShaderGraph::Statement &statement : graph.createStatements(enabledLayers)) { + const QShaderNode node = statement.node; + QByteArray line = node.rule(format).substitution; + const QVector<QShaderNodePort> ports = node.ports(); + for (const QShaderNodePort &port : ports) { + const QString portName = port.name; + const QShaderNodePort::Direction portDirection = port.direction; + const bool isInput = port.direction == QShaderNodePort::Input; - const auto portIndex = statement.portIndex(portDirection, portName); - const auto variableIndex = isInput ? statement.inputs.at(portIndex) - : statement.outputs.at(portIndex); + const int portIndex = statement.portIndex(portDirection, portName); + const int variableIndex = isInput ? statement.inputs.at(portIndex) + : statement.outputs.at(portIndex); if (variableIndex < 0) continue; diff --git a/src/gui/util/qshadergraph.cpp b/src/gui/util/qshadergraph.cpp index 828c709a12..b05b710713 100644 --- a/src/gui/util/qshadergraph.cpp +++ b/src/gui/util/qshadergraph.cpp @@ -82,8 +82,8 @@ namespace auto statement = QShaderGraph::Statement(); statement.node = node; - const auto ports = node.ports(); - for (const auto &port : ports) { + const QVector<QShaderNodePort> ports = node.ports(); + for (const QShaderNodePort &port : ports) { if (port.direction == QShaderNodePort::Input) { statement.inputs.append(-1); } else { @@ -99,35 +99,35 @@ namespace const QUuid &uuid) { auto targetStatement = idHash.value(uuid); - for (const auto &edge : edges) { + for (const QShaderGraph::Edge &edge : edges) { if (edge.targetNodeUuid != uuid) continue; - const auto sourceStatement = idHash.value(edge.sourceNodeUuid); - const auto sourcePortIndex = sourceStatement.portIndex(QShaderNodePort::Output, edge.sourcePortName); - const auto targetPortIndex = targetStatement.portIndex(QShaderNodePort::Input, edge.targetPortName); + const QShaderGraph::Statement sourceStatement = idHash.value(edge.sourceNodeUuid); + const int sourcePortIndex = sourceStatement.portIndex(QShaderNodePort::Output, edge.sourcePortName); + const int targetPortIndex = targetStatement.portIndex(QShaderNodePort::Input, edge.targetPortName); if (sourcePortIndex < 0 || targetPortIndex < 0) continue; - const auto &sourceOutputs = sourceStatement.outputs; - auto &targetInputs = targetStatement.inputs; + const QVector<int> sourceOutputs = sourceStatement.outputs; + QVector<int> &targetInputs = targetStatement.inputs; targetInputs[targetPortIndex] = sourceOutputs[sourcePortIndex]; } return targetStatement; } } -QUuid QShaderGraph::Statement::uuid() const Q_DECL_NOTHROW +QUuid QShaderGraph::Statement::uuid() const noexcept { return node.uuid(); } -int QShaderGraph::Statement::portIndex(QShaderNodePort::Direction direction, const QString &portName) const Q_DECL_NOTHROW +int QShaderGraph::Statement::portIndex(QShaderNodePort::Direction direction, const QString &portName) const noexcept { - const auto ports = node.ports(); + const QVector<QShaderNodePort> ports = node.ports(); int index = 0; - for (const auto &port : ports) { + for (const QShaderNodePort &port : ports) { if (port.name == portName && port.direction == direction) return index; else if (port.direction == direction) @@ -150,7 +150,7 @@ void QShaderGraph::removeNode(const QShaderNode &node) m_nodes.erase(it); } -QVector<QShaderNode> QShaderGraph::nodes() const Q_DECL_NOTHROW +QVector<QShaderNode> QShaderGraph::nodes() const noexcept { return m_nodes; } @@ -167,7 +167,7 @@ void QShaderGraph::removeEdge(const QShaderGraph::Edge &edge) m_edges.removeAll(edge); } -QVector<QShaderGraph::Edge> QShaderGraph::edges() const Q_DECL_NOTHROW +QVector<QShaderGraph::Edge> QShaderGraph::edges() const noexcept { return m_edges; } @@ -180,7 +180,7 @@ QVector<QShaderGraph::Statement> QShaderGraph::createStatements(const QStringLis [enabledLayers] (const QString &s) { return enabledLayers.contains(s); }); }; - const auto enabledNodes = [this, intersectsEnabledLayers] { + const QVector<QShaderNode> enabledNodes = [this, intersectsEnabledLayers] { auto res = QVector<QShaderNode>(); std::copy_if(m_nodes.cbegin(), m_nodes.cend(), std::back_inserter(res), @@ -190,7 +190,7 @@ QVector<QShaderGraph::Statement> QShaderGraph::createStatements(const QStringLis return res; }(); - const auto enabledEdges = [this, intersectsEnabledLayers] { + const QVector<Edge> enabledEdges = [this, intersectsEnabledLayers] { auto res = QVector<Edge>(); std::copy_if(m_edges.cbegin(), m_edges.cend(), std::back_inserter(res), @@ -200,18 +200,18 @@ QVector<QShaderGraph::Statement> QShaderGraph::createStatements(const QStringLis return res; }(); - const auto idHash = [enabledNodes] { + const QHash<QUuid, Statement> idHash = [enabledNodes] { auto nextVarId = 0; auto res = QHash<QUuid, Statement>(); - for (const auto &node : enabledNodes) + for (const QShaderNode &node : enabledNodes) res.insert(node.uuid(), nodeToStatement(node, nextVarId)); return res; }(); auto result = QVector<Statement>(); - auto currentEdges = enabledEdges; - auto currentUuids = [enabledNodes] { - const auto inputs = copyOutputNodes(enabledNodes); + QVector<Edge> currentEdges = enabledEdges; + QVector<QUuid> currentUuids = [enabledNodes] { + const QVector<QShaderNode> inputs = copyOutputNodes(enabledNodes); auto res = QVector<QUuid>(); std::transform(inputs.cbegin(), inputs.cend(), std::back_inserter(res), @@ -226,14 +226,14 @@ QVector<QShaderGraph::Statement> QShaderGraph::createStatements(const QStringLis // because we want to track the dependencies from the output nodes and not the // input nodes while (!currentUuids.isEmpty()) { - const auto uuid = currentUuids.takeFirst(); + const QUuid uuid = currentUuids.takeFirst(); result.append(completeStatement(idHash, enabledEdges, uuid)); - const auto outgoing = outgoingEdges(currentEdges, uuid); - for (const auto &outgoingEdge : outgoing) { + const QVector<QShaderGraph::Edge> outgoing = outgoingEdges(currentEdges, uuid); + for (const QShaderGraph::Edge &outgoingEdge : outgoing) { currentEdges.removeAll(outgoingEdge); const QUuid nextUuid = outgoingEdge.sourceNodeUuid; - const auto incoming = incomingEdges(currentEdges, nextUuid); + const QVector<QShaderGraph::Edge> incoming = incomingEdges(currentEdges, nextUuid); if (incoming.isEmpty()) { currentUuids.append(nextUuid); } @@ -244,7 +244,7 @@ QVector<QShaderGraph::Statement> QShaderGraph::createStatements(const QStringLis return result; } -bool operator==(const QShaderGraph::Edge &lhs, const QShaderGraph::Edge &rhs) Q_DECL_NOTHROW +bool operator==(const QShaderGraph::Edge &lhs, const QShaderGraph::Edge &rhs) noexcept { return lhs.sourceNodeUuid == rhs.sourceNodeUuid && lhs.sourcePortName == rhs.sourcePortName @@ -252,7 +252,7 @@ bool operator==(const QShaderGraph::Edge &lhs, const QShaderGraph::Edge &rhs) Q_ && lhs.targetPortName == rhs.targetPortName; } -bool operator==(const QShaderGraph::Statement &lhs, const QShaderGraph::Statement &rhs) Q_DECL_NOTHROW +bool operator==(const QShaderGraph::Statement &lhs, const QShaderGraph::Statement &rhs) noexcept { return lhs.inputs == rhs.inputs && lhs.outputs == rhs.outputs diff --git a/src/gui/util/qshadergraph_p.h b/src/gui/util/qshadergraph_p.h index 756e1b2da2..9367a3783c 100644 --- a/src/gui/util/qshadergraph_p.h +++ b/src/gui/util/qshadergraph_p.h @@ -73,8 +73,8 @@ public: class Statement { public: - Q_GUI_EXPORT QUuid uuid() const Q_DECL_NOTHROW; - Q_GUI_EXPORT int portIndex(QShaderNodePort::Direction direction, const QString &portName) const Q_DECL_NOTHROW; + Q_GUI_EXPORT QUuid uuid() const noexcept; + Q_GUI_EXPORT int portIndex(QShaderNodePort::Direction direction, const QString &portName) const noexcept; QShaderNode node; QVector<int> inputs; @@ -83,11 +83,11 @@ public: Q_GUI_EXPORT void addNode(const QShaderNode &node); Q_GUI_EXPORT void removeNode(const QShaderNode &node); - Q_GUI_EXPORT QVector<QShaderNode> nodes() const Q_DECL_NOTHROW; + Q_GUI_EXPORT QVector<QShaderNode> nodes() const noexcept; Q_GUI_EXPORT void addEdge(const Edge &edge); Q_GUI_EXPORT void removeEdge(const Edge &edge); - Q_GUI_EXPORT QVector<Edge> edges() const Q_DECL_NOTHROW; + Q_GUI_EXPORT QVector<Edge> edges() const noexcept; Q_GUI_EXPORT QVector<Statement> createStatements(const QStringList &enabledLayers = QStringList()) const; @@ -96,16 +96,16 @@ private: QVector<Edge> m_edges; }; -Q_GUI_EXPORT bool operator==(const QShaderGraph::Edge &lhs, const QShaderGraph::Edge &rhs) Q_DECL_NOTHROW; +Q_GUI_EXPORT bool operator==(const QShaderGraph::Edge &lhs, const QShaderGraph::Edge &rhs) noexcept; -inline bool operator!=(const QShaderGraph::Edge &lhs, const QShaderGraph::Edge &rhs) Q_DECL_NOTHROW +inline bool operator!=(const QShaderGraph::Edge &lhs, const QShaderGraph::Edge &rhs) noexcept { return !(lhs == rhs); } -Q_GUI_EXPORT bool operator==(const QShaderGraph::Statement &lhs, const QShaderGraph::Statement &rhs) Q_DECL_NOTHROW; +Q_GUI_EXPORT bool operator==(const QShaderGraph::Statement &lhs, const QShaderGraph::Statement &rhs) noexcept; -inline bool operator!=(const QShaderGraph::Statement &lhs, const QShaderGraph::Statement &rhs) Q_DECL_NOTHROW +inline bool operator!=(const QShaderGraph::Statement &lhs, const QShaderGraph::Statement &rhs) noexcept { return !(lhs == rhs); } diff --git a/src/gui/util/qshadergraphloader.cpp b/src/gui/util/qshadergraphloader.cpp index 99a9f7869e..a393e876e0 100644 --- a/src/gui/util/qshadergraphloader.cpp +++ b/src/gui/util/qshadergraphloader.cpp @@ -52,29 +52,29 @@ QT_BEGIN_NAMESPACE void qt_register_ShaderLanguage_enums(); -QShaderGraphLoader::QShaderGraphLoader() Q_DECL_NOTHROW +QShaderGraphLoader::QShaderGraphLoader() noexcept : m_status(Null), m_device(nullptr) { qt_register_ShaderLanguage_enums(); } -QShaderGraphLoader::Status QShaderGraphLoader::status() const Q_DECL_NOTHROW +QShaderGraphLoader::Status QShaderGraphLoader::status() const noexcept { return m_status; } -QShaderGraph QShaderGraphLoader::graph() const Q_DECL_NOTHROW +QShaderGraph QShaderGraphLoader::graph() const noexcept { return m_graph; } -QIODevice *QShaderGraphLoader::device() const Q_DECL_NOTHROW +QIODevice *QShaderGraphLoader::device() const noexcept { return m_device; } -void QShaderGraphLoader::setDevice(QIODevice *device) Q_DECL_NOTHROW +void QShaderGraphLoader::setDevice(QIODevice *device) noexcept { m_device = device; m_graph = QShaderGraph(); @@ -83,12 +83,12 @@ void QShaderGraphLoader::setDevice(QIODevice *device) Q_DECL_NOTHROW : Error; } -QHash<QString, QShaderNode> QShaderGraphLoader::prototypes() const Q_DECL_NOTHROW +QHash<QString, QShaderNode> QShaderGraphLoader::prototypes() const noexcept { return m_prototypes; } -void QShaderGraphLoader::setPrototypes(const QHash<QString, QShaderNode> &prototypes) Q_DECL_NOTHROW +void QShaderGraphLoader::setPrototypes(const QHash<QString, QShaderNode> &prototypes) noexcept { m_prototypes = prototypes; } @@ -99,7 +99,7 @@ void QShaderGraphLoader::load() return; auto error = QJsonParseError(); - const auto document = QJsonDocument::fromJson(m_device->readAll(), &error); + const QJsonDocument document = QJsonDocument::fromJson(m_device->readAll(), &error); if (error.error != QJsonParseError::NoError) { qWarning() << "Invalid JSON document:" << error.errorString(); @@ -113,16 +113,16 @@ void QShaderGraphLoader::load() return; } - const auto root = document.object(); + const QJsonObject root = document.object(); - const auto nodesValue = root.value(QStringLiteral("nodes")); + const QJsonValue nodesValue = root.value(QStringLiteral("nodes")); if (!nodesValue.isArray()) { qWarning() << "Invalid nodes property, should be an array"; m_status = Error; return; } - const auto edgesValue = root.value(QStringLiteral("edges")); + const QJsonValue edgesValue = root.value(QStringLiteral("edges")); if (!edgesValue.isArray()) { qWarning() << "Invalid edges property, should be an array"; m_status = Error; @@ -131,7 +131,7 @@ void QShaderGraphLoader::load() bool hasError = false; - const auto prototypesValue = root.value(QStringLiteral("prototypes")); + const QJsonValue prototypesValue = root.value(QStringLiteral("prototypes")); if (!prototypesValue.isUndefined()) { if (prototypesValue.isObject()) { QShaderNodesLoader loader; @@ -144,60 +144,60 @@ void QShaderGraphLoader::load() } } - const auto nodes = nodesValue.toArray(); - for (const auto &nodeValue : nodes) { + const QJsonArray nodes = nodesValue.toArray(); + for (const QJsonValue &nodeValue : nodes) { if (!nodeValue.isObject()) { qWarning() << "Invalid node found"; hasError = true; continue; } - const auto nodeObject = nodeValue.toObject(); + const QJsonObject nodeObject = nodeValue.toObject(); - const auto uuidString = nodeObject.value(QStringLiteral("uuid")).toString(); - const auto uuid = QUuid(uuidString); + const QString uuidString = nodeObject.value(QStringLiteral("uuid")).toString(); + const QUuid uuid = QUuid(uuidString); if (uuid.isNull()) { qWarning() << "Invalid UUID found in node:" << uuidString; hasError = true; continue; } - const auto type = nodeObject.value(QStringLiteral("type")).toString(); + const QString type = nodeObject.value(QStringLiteral("type")).toString(); if (!m_prototypes.contains(type)) { qWarning() << "Unsupported node type found:" << type; hasError = true; continue; } - const auto layersArray = nodeObject.value(QStringLiteral("layers")).toArray(); + const QJsonArray layersArray = nodeObject.value(QStringLiteral("layers")).toArray(); auto layers = QStringList(); - for (const auto &layerValue : layersArray) { + for (const QJsonValue &layerValue : layersArray) { layers.append(layerValue.toString()); } - auto node = m_prototypes.value(type); + QShaderNode node = m_prototypes.value(type); node.setUuid(uuid); node.setLayers(layers); - const auto parametersValue = nodeObject.value(QStringLiteral("parameters")); + const QJsonValue parametersValue = nodeObject.value(QStringLiteral("parameters")); if (parametersValue.isObject()) { - const auto parametersObject = parametersValue.toObject(); - for (const auto ¶meterName : parametersObject.keys()) { - const auto parameterValue = parametersObject.value(parameterName); + const QJsonObject parametersObject = parametersValue.toObject(); + for (const QString ¶meterName : parametersObject.keys()) { + const QJsonValue parameterValue = parametersObject.value(parameterName); if (parameterValue.isObject()) { - const auto parameterObject = parameterValue.toObject(); - const auto type = parameterObject.value(QStringLiteral("type")).toString(); - const auto typeId = QMetaType::type(type.toUtf8()); + const QJsonObject parameterObject = parameterValue.toObject(); + const QString type = parameterObject.value(QStringLiteral("type")).toString(); + const int typeId = QMetaType::type(type.toUtf8()); - const auto value = parameterObject.value(QStringLiteral("value")).toString(); + const QString value = parameterObject.value(QStringLiteral("value")).toString(); auto variant = QVariant(value); if (QMetaType::typeFlags(typeId) & QMetaType::IsEnumeration) { - const auto metaObject = QMetaType::metaObjectForType(typeId); - const auto className = metaObject->className(); - const auto enumName = type.mid(static_cast<int>(qstrlen(className)) + 2).toUtf8(); - const auto metaEnum = metaObject->enumerator(metaObject->indexOfEnumerator(enumName)); - const auto enumValue = metaEnum.keyToValue(value.toUtf8()); + const QMetaObject *metaObject = QMetaType::metaObjectForType(typeId); + const char *className = metaObject->className(); + const QByteArray enumName = type.mid(static_cast<int>(qstrlen(className)) + 2).toUtf8(); + const QMetaEnum metaEnum = metaObject->enumerator(metaObject->indexOfEnumerator(enumName)); + const int enumValue = metaEnum.keyToValue(value.toUtf8()); variant = QVariant(enumValue); variant.convert(typeId); } else { @@ -213,39 +213,39 @@ void QShaderGraphLoader::load() m_graph.addNode(node); } - const auto edges = edgesValue.toArray(); - for (const auto &edgeValue : edges) { + const QJsonArray edges = edgesValue.toArray(); + for (const QJsonValue &edgeValue : edges) { if (!edgeValue.isObject()) { qWarning() << "Invalid edge found"; hasError = true; continue; } - const auto edgeObject = edgeValue.toObject(); + const QJsonObject edgeObject = edgeValue.toObject(); - const auto sourceUuidString = edgeObject.value(QStringLiteral("sourceUuid")).toString(); - const auto sourceUuid = QUuid(sourceUuidString); + const QString sourceUuidString = edgeObject.value(QStringLiteral("sourceUuid")).toString(); + const QUuid sourceUuid = QUuid(sourceUuidString); if (sourceUuid.isNull()) { qWarning() << "Invalid source UUID found in edge:" << sourceUuidString; hasError = true; continue; } - const auto sourcePort = edgeObject.value(QStringLiteral("sourcePort")).toString(); + const QString sourcePort = edgeObject.value(QStringLiteral("sourcePort")).toString(); - const auto targetUuidString = edgeObject.value(QStringLiteral("targetUuid")).toString(); - const auto targetUuid = QUuid(targetUuidString); + const QString targetUuidString = edgeObject.value(QStringLiteral("targetUuid")).toString(); + const QUuid targetUuid = QUuid(targetUuidString); if (targetUuid.isNull()) { qWarning() << "Invalid target UUID found in edge:" << targetUuidString; hasError = true; continue; } - const auto targetPort = edgeObject.value(QStringLiteral("targetPort")).toString(); + const QString targetPort = edgeObject.value(QStringLiteral("targetPort")).toString(); - const auto layersArray = edgeObject.value(QStringLiteral("layers")).toArray(); + const QJsonArray layersArray = edgeObject.value(QStringLiteral("layers")).toArray(); auto layers = QStringList(); - for (const auto &layerValue : layersArray) { + for (const QJsonValue &layerValue : layersArray) { layers.append(layerValue.toString()); } diff --git a/src/gui/util/qshadergraphloader_p.h b/src/gui/util/qshadergraphloader_p.h index 97cbd8d18c..e7aa19fa2d 100644 --- a/src/gui/util/qshadergraphloader_p.h +++ b/src/gui/util/qshadergraphloader_p.h @@ -69,16 +69,16 @@ public: Error }; - Q_GUI_EXPORT QShaderGraphLoader() Q_DECL_NOTHROW; + Q_GUI_EXPORT QShaderGraphLoader() noexcept; - Q_GUI_EXPORT Status status() const Q_DECL_NOTHROW; - Q_GUI_EXPORT QShaderGraph graph() const Q_DECL_NOTHROW; + Q_GUI_EXPORT Status status() const noexcept; + Q_GUI_EXPORT QShaderGraph graph() const noexcept; - Q_GUI_EXPORT QIODevice *device() const Q_DECL_NOTHROW; - Q_GUI_EXPORT void setDevice(QIODevice *device) Q_DECL_NOTHROW; + Q_GUI_EXPORT QIODevice *device() const noexcept; + Q_GUI_EXPORT void setDevice(QIODevice *device) noexcept; - Q_GUI_EXPORT QHash<QString, QShaderNode> prototypes() const Q_DECL_NOTHROW; - Q_GUI_EXPORT void setPrototypes(const QHash<QString, QShaderNode> &prototypes) Q_DECL_NOTHROW; + Q_GUI_EXPORT QHash<QString, QShaderNode> prototypes() const noexcept; + Q_GUI_EXPORT void setPrototypes(const QHash<QString, QShaderNode> &prototypes) noexcept; Q_GUI_EXPORT void load(); diff --git a/src/gui/util/qshaderlanguage.cpp b/src/gui/util/qshaderlanguage.cpp index f9192f5ff3..efd607ba60 100644 --- a/src/gui/util/qshaderlanguage.cpp +++ b/src/gui/util/qshaderlanguage.cpp @@ -3,7 +3,7 @@ ** Copyright (C) 2017 Klaralvdalens Datakonsult AB (KDAB). ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the Qt Quick Layouts module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/util/qshaderlanguage_p.h b/src/gui/util/qshaderlanguage_p.h index e31dcd3a9b..441f7a58d5 100644 --- a/src/gui/util/qshaderlanguage_p.h +++ b/src/gui/util/qshaderlanguage_p.h @@ -3,7 +3,7 @@ ** Copyright (C) 2017 Klaralvdalens Datakonsult AB (KDAB). ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the Qt Quick Layouts module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/util/qshadernode.cpp b/src/gui/util/qshadernode.cpp index 676667ddcf..547e5c51a8 100644 --- a/src/gui/util/qshadernode.cpp +++ b/src/gui/util/qshadernode.cpp @@ -3,7 +3,7 @@ ** Copyright (C) 2017 Klaralvdalens Datakonsult AB (KDAB). ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the Qt Quick Layouts module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage @@ -41,7 +41,7 @@ QT_BEGIN_NAMESPACE -QShaderNode::Type QShaderNode::type() const Q_DECL_NOTHROW +QShaderNode::Type QShaderNode::type() const noexcept { int inputCount = 0; int outputCount = 0; @@ -62,27 +62,27 @@ QShaderNode::Type QShaderNode::type() const Q_DECL_NOTHROW : Function; } -QUuid QShaderNode::uuid() const Q_DECL_NOTHROW +QUuid QShaderNode::uuid() const noexcept { return m_uuid; } -void QShaderNode::setUuid(const QUuid &uuid) Q_DECL_NOTHROW +void QShaderNode::setUuid(const QUuid &uuid) noexcept { m_uuid = uuid; } -QStringList QShaderNode::layers() const Q_DECL_NOTHROW +QStringList QShaderNode::layers() const noexcept { return m_layers; } -void QShaderNode::setLayers(const QStringList &layers) Q_DECL_NOTHROW +void QShaderNode::setLayers(const QStringList &layers) noexcept { m_layers = layers; } -QVector<QShaderNodePort> QShaderNode::ports() const Q_DECL_NOTHROW +QVector<QShaderNodePort> QShaderNode::ports() const noexcept { return m_ports; } @@ -157,13 +157,13 @@ QShaderNode::Rule QShaderNode::rule(const QShaderFormat &format) const return it != m_rules.crend() ? it->second : Rule(); } -QShaderNode::Rule::Rule(const QByteArray &subs, const QByteArrayList &snippets) Q_DECL_NOTHROW +QShaderNode::Rule::Rule(const QByteArray &subs, const QByteArrayList &snippets) noexcept : substitution(subs), headerSnippets(snippets) { } -bool operator==(const QShaderNode::Rule &lhs, const QShaderNode::Rule &rhs) Q_DECL_NOTHROW +bool operator==(const QShaderNode::Rule &lhs, const QShaderNode::Rule &rhs) noexcept { return lhs.substitution == rhs.substitution && lhs.headerSnippets == rhs.headerSnippets; diff --git a/src/gui/util/qshadernode_p.h b/src/gui/util/qshadernode_p.h index 494c87bc18..c3d149d8a5 100644 --- a/src/gui/util/qshadernode_p.h +++ b/src/gui/util/qshadernode_p.h @@ -3,7 +3,7 @@ ** Copyright (C) 2017 Klaralvdalens Datakonsult AB (KDAB). ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the Qt Quick Layouts module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage @@ -73,21 +73,21 @@ public: class Rule { public: - Q_GUI_EXPORT Rule(const QByteArray &substitution = QByteArray(), const QByteArrayList &headerSnippets = QByteArrayList()) Q_DECL_NOTHROW; + Q_GUI_EXPORT Rule(const QByteArray &substitution = QByteArray(), const QByteArrayList &headerSnippets = QByteArrayList()) noexcept; QByteArray substitution; QByteArrayList headerSnippets; }; - Q_GUI_EXPORT Type type() const Q_DECL_NOTHROW; + Q_GUI_EXPORT Type type() const noexcept; - Q_GUI_EXPORT QUuid uuid() const Q_DECL_NOTHROW; - Q_GUI_EXPORT void setUuid(const QUuid &uuid) Q_DECL_NOTHROW; + Q_GUI_EXPORT QUuid uuid() const noexcept; + Q_GUI_EXPORT void setUuid(const QUuid &uuid) noexcept; - Q_GUI_EXPORT QStringList layers() const Q_DECL_NOTHROW; - Q_GUI_EXPORT void setLayers(const QStringList &layers) Q_DECL_NOTHROW; + Q_GUI_EXPORT QStringList layers() const noexcept; + Q_GUI_EXPORT void setLayers(const QStringList &layers) noexcept; - Q_GUI_EXPORT QVector<QShaderNodePort> ports() const Q_DECL_NOTHROW; + Q_GUI_EXPORT QVector<QShaderNodePort> ports() const noexcept; Q_GUI_EXPORT void addPort(const QShaderNodePort &port); Q_GUI_EXPORT void removePort(const QShaderNodePort &port); @@ -110,9 +110,9 @@ private: QVector<QPair<QShaderFormat, QShaderNode::Rule>> m_rules; }; -Q_GUI_EXPORT bool operator==(const QShaderNode::Rule &lhs, const QShaderNode::Rule &rhs) Q_DECL_NOTHROW; +Q_GUI_EXPORT bool operator==(const QShaderNode::Rule &lhs, const QShaderNode::Rule &rhs) noexcept; -inline bool operator!=(const QShaderNode::Rule &lhs, const QShaderNode::Rule &rhs) Q_DECL_NOTHROW +inline bool operator!=(const QShaderNode::Rule &lhs, const QShaderNode::Rule &rhs) noexcept { return !(lhs == rhs); } diff --git a/src/gui/util/qshadernodeport.cpp b/src/gui/util/qshadernodeport.cpp index 03646a9467..15dbc4160e 100644 --- a/src/gui/util/qshadernodeport.cpp +++ b/src/gui/util/qshadernodeport.cpp @@ -41,12 +41,12 @@ QT_BEGIN_NAMESPACE -QShaderNodePort::QShaderNodePort() Q_DECL_NOTHROW +QShaderNodePort::QShaderNodePort() noexcept : direction(Output) { } -bool operator==(const QShaderNodePort &lhs, const QShaderNodePort &rhs) Q_DECL_NOTHROW +bool operator==(const QShaderNodePort &lhs, const QShaderNodePort &rhs) noexcept { return lhs.direction == rhs.direction && lhs.name == rhs.name; diff --git a/src/gui/util/qshadernodeport_p.h b/src/gui/util/qshadernodeport_p.h index cfdaf05017..c69ba23a3f 100644 --- a/src/gui/util/qshadernodeport_p.h +++ b/src/gui/util/qshadernodeport_p.h @@ -66,15 +66,15 @@ public: Output }; - Q_GUI_EXPORT QShaderNodePort() Q_DECL_NOTHROW; + Q_GUI_EXPORT QShaderNodePort() noexcept; QShaderNodePort::Direction direction; QString name; }; -Q_GUI_EXPORT bool operator==(const QShaderNodePort &lhs, const QShaderNodePort &rhs) Q_DECL_NOTHROW; +Q_GUI_EXPORT bool operator==(const QShaderNodePort &lhs, const QShaderNodePort &rhs) noexcept; -inline bool operator!=(const QShaderNodePort &lhs, const QShaderNodePort &rhs) Q_DECL_NOTHROW +inline bool operator!=(const QShaderNodePort &lhs, const QShaderNodePort &rhs) noexcept { return !(lhs == rhs); } diff --git a/src/gui/util/qshadernodesloader.cpp b/src/gui/util/qshadernodesloader.cpp index 692653ee44..af565c906d 100644 --- a/src/gui/util/qshadernodesloader.cpp +++ b/src/gui/util/qshadernodesloader.cpp @@ -48,28 +48,28 @@ QT_BEGIN_NAMESPACE -QShaderNodesLoader::QShaderNodesLoader() Q_DECL_NOTHROW +QShaderNodesLoader::QShaderNodesLoader() noexcept : m_status(Null), m_device(nullptr) { } -QShaderNodesLoader::Status QShaderNodesLoader::status() const Q_DECL_NOTHROW +QShaderNodesLoader::Status QShaderNodesLoader::status() const noexcept { return m_status; } -QHash<QString, QShaderNode> QShaderNodesLoader::nodes() const Q_DECL_NOTHROW +QHash<QString, QShaderNode> QShaderNodesLoader::nodes() const noexcept { return m_nodes; } -QIODevice *QShaderNodesLoader::device() const Q_DECL_NOTHROW +QIODevice *QShaderNodesLoader::device() const noexcept { return m_device; } -void QShaderNodesLoader::setDevice(QIODevice *device) Q_DECL_NOTHROW +void QShaderNodesLoader::setDevice(QIODevice *device) noexcept { m_device = device; m_nodes.clear(); @@ -84,7 +84,7 @@ void QShaderNodesLoader::load() return; auto error = QJsonParseError(); - const auto document = QJsonDocument::fromJson(m_device->readAll(), &error); + const QJsonDocument document = QJsonDocument::fromJson(m_device->readAll(), &error); if (error.error != QJsonParseError::NoError) { qWarning() << "Invalid JSON document:" << error.errorString(); @@ -98,7 +98,7 @@ void QShaderNodesLoader::load() return; } - const auto root = document.object(); + const QJsonObject root = document.object(); load(root); } @@ -106,22 +106,22 @@ void QShaderNodesLoader::load(const QJsonObject &prototypesObject) { bool hasError = false; - for (const auto &property : prototypesObject.keys()) { - const auto nodeValue = prototypesObject.value(property); + for (const QString &property : prototypesObject.keys()) { + const QJsonValue nodeValue = prototypesObject.value(property); if (!nodeValue.isObject()) { qWarning() << "Invalid node found"; hasError = true; break; } - const auto nodeObject = nodeValue.toObject(); + const QJsonObject nodeObject = nodeValue.toObject(); auto node = QShaderNode(); - const auto inputsValue = nodeObject.value(QStringLiteral("inputs")); + const QJsonValue inputsValue = nodeObject.value(QStringLiteral("inputs")); if (inputsValue.isArray()) { - const auto inputsArray = inputsValue.toArray(); - for (const auto &inputValue : inputsArray) { + const QJsonArray inputsArray = inputsValue.toArray(); + for (const QJsonValue &inputValue : inputsArray) { if (!inputValue.isString()) { qWarning() << "Non-string value in inputs"; hasError = true; @@ -135,10 +135,10 @@ void QShaderNodesLoader::load(const QJsonObject &prototypesObject) } } - const auto outputsValue = nodeObject.value(QStringLiteral("outputs")); + const QJsonValue outputsValue = nodeObject.value(QStringLiteral("outputs")); if (outputsValue.isArray()) { - const auto outputsArray = outputsValue.toArray(); - for (const auto &outputValue : outputsArray) { + const QJsonArray outputsArray = outputsValue.toArray(); + for (const QJsonValue &outputValue : outputsArray) { if (!outputValue.isString()) { qWarning() << "Non-string value in outputs"; hasError = true; @@ -152,25 +152,25 @@ void QShaderNodesLoader::load(const QJsonObject &prototypesObject) } } - const auto parametersValue = nodeObject.value(QStringLiteral("parameters")); + const QJsonValue parametersValue = nodeObject.value(QStringLiteral("parameters")); if (parametersValue.isObject()) { - const auto parametersObject = parametersValue.toObject(); - for (const auto ¶meterName : parametersObject.keys()) { - const auto parameterValue = parametersObject.value(parameterName); + const QJsonObject parametersObject = parametersValue.toObject(); + for (const QString ¶meterName : parametersObject.keys()) { + const QJsonValue parameterValue = parametersObject.value(parameterName); if (parameterValue.isObject()) { - const auto parameterObject = parameterValue.toObject(); - const auto type = parameterObject.value(QStringLiteral("type")).toString(); - const auto typeId = QMetaType::type(type.toUtf8()); + const QJsonObject parameterObject = parameterValue.toObject(); + const QString type = parameterObject.value(QStringLiteral("type")).toString(); + const int typeId = QMetaType::type(type.toUtf8()); - const auto value = parameterObject.value(QStringLiteral("value")).toString(); + const QString value = parameterObject.value(QStringLiteral("value")).toString(); auto variant = QVariant(value); if (QMetaType::typeFlags(typeId) & QMetaType::IsEnumeration) { - const auto metaObject = QMetaType::metaObjectForType(typeId); - const auto className = metaObject->className(); - const auto enumName = type.mid(static_cast<int>(qstrlen(className)) + 2).toUtf8(); - const auto metaEnum = metaObject->enumerator(metaObject->indexOfEnumerator(enumName)); - const auto enumValue = metaEnum.keyToValue(value.toUtf8()); + const QMetaObject *metaObject = QMetaType::metaObjectForType(typeId); + const char *className = metaObject->className(); + const QByteArray enumName = type.mid(static_cast<int>(qstrlen(className)) + 2).toUtf8(); + const QMetaEnum metaEnum = metaObject->enumerator(metaObject->indexOfEnumerator(enumName)); + const int enumValue = metaEnum.keyToValue(value.toUtf8()); variant = QVariant(enumValue); variant.convert(typeId); } else { @@ -183,36 +183,36 @@ void QShaderNodesLoader::load(const QJsonObject &prototypesObject) } } - const auto rulesValue = nodeObject.value(QStringLiteral("rules")); + const QJsonValue rulesValue = nodeObject.value(QStringLiteral("rules")); if (rulesValue.isArray()) { - const auto rulesArray = rulesValue.toArray(); - for (const auto &ruleValue : rulesArray) { + const QJsonArray rulesArray = rulesValue.toArray(); + for (const QJsonValue &ruleValue : rulesArray) { if (!ruleValue.isObject()) { qWarning() << "Rules should be objects"; hasError = true; break; } - const auto ruleObject = ruleValue.toObject(); + const QJsonObject ruleObject = ruleValue.toObject(); - const auto formatValue = ruleObject.value(QStringLiteral("format")); + const QJsonValue formatValue = ruleObject.value(QStringLiteral("format")); if (!formatValue.isObject()) { qWarning() << "Format is mandatory in rules and should be an object"; hasError = true; break; } - const auto formatObject = formatValue.toObject(); + const QJsonObject formatObject = formatValue.toObject(); auto format = QShaderFormat(); - const auto apiValue = formatObject.value(QStringLiteral("api")); + const QJsonValue apiValue = formatObject.value(QStringLiteral("api")); if (!apiValue.isString()) { qWarning() << "Format API must be a string"; hasError = true; break; } - const auto api = apiValue.toString(); + const QString api = apiValue.toString(); format.setApi(api == QStringLiteral("OpenGLES") ? QShaderFormat::OpenGLES : api == QStringLiteral("OpenGLNoProfile") ? QShaderFormat::OpenGLNoProfile : api == QStringLiteral("OpenGLCoreProfile") ? QShaderFormat::OpenGLCoreProfile @@ -224,8 +224,8 @@ void QShaderNodesLoader::load(const QJsonObject &prototypesObject) break; } - const auto majorValue = formatObject.value(QStringLiteral("major")); - const auto minorValue = formatObject.value(QStringLiteral("minor")); + const QJsonValue majorValue = formatObject.value(QStringLiteral("major")); + const QJsonValue minorValue = formatObject.value(QStringLiteral("minor")); if (!majorValue.isDouble() || !minorValue.isDouble()) { qWarning() << "Format major and minor version must be values"; hasError = true; @@ -233,28 +233,28 @@ void QShaderNodesLoader::load(const QJsonObject &prototypesObject) } format.setVersion(QVersionNumber(majorValue.toInt(), minorValue.toInt())); - const auto extensionsValue = formatObject.value(QStringLiteral("extensions")); - const auto extensionsArray = extensionsValue.toArray(); + const QJsonValue extensionsValue = formatObject.value(QStringLiteral("extensions")); + const QJsonArray extensionsArray = extensionsValue.toArray(); auto extensions = QStringList(); std::transform(extensionsArray.constBegin(), extensionsArray.constEnd(), std::back_inserter(extensions), [] (const QJsonValue &extensionValue) { return extensionValue.toString(); }); format.setExtensions(extensions); - const auto vendor = formatObject.value(QStringLiteral("vendor")).toString(); + const QString vendor = formatObject.value(QStringLiteral("vendor")).toString(); format.setVendor(vendor); - const auto substitutionValue = ruleObject.value(QStringLiteral("substitution")); + const QJsonValue substitutionValue = ruleObject.value(QStringLiteral("substitution")); if (!substitutionValue.isString()) { qWarning() << "Substitution needs to be a string"; hasError = true; break; } - const auto substitution = substitutionValue.toString().toUtf8(); + const QByteArray substitution = substitutionValue.toString().toUtf8(); - const auto snippetsValue = ruleObject.value(QStringLiteral("headerSnippets")); - const auto snippetsArray = snippetsValue.toArray(); + const QJsonValue snippetsValue = ruleObject.value(QStringLiteral("headerSnippets")); + const QJsonArray snippetsArray = snippetsValue.toArray(); auto snippets = QByteArrayList(); std::transform(snippetsArray.constBegin(), snippetsArray.constEnd(), std::back_inserter(snippets), diff --git a/src/gui/util/qshadernodesloader_p.h b/src/gui/util/qshadernodesloader_p.h index 0bec871857..432d7d4494 100644 --- a/src/gui/util/qshadernodesloader_p.h +++ b/src/gui/util/qshadernodesloader_p.h @@ -69,13 +69,13 @@ public: Error }; - Q_GUI_EXPORT QShaderNodesLoader() Q_DECL_NOTHROW; + Q_GUI_EXPORT QShaderNodesLoader() noexcept; - Q_GUI_EXPORT Status status() const Q_DECL_NOTHROW; - Q_GUI_EXPORT QHash<QString, QShaderNode> nodes() const Q_DECL_NOTHROW; + Q_GUI_EXPORT Status status() const noexcept; + Q_GUI_EXPORT QHash<QString, QShaderNode> nodes() const noexcept; - Q_GUI_EXPORT QIODevice *device() const Q_DECL_NOTHROW; - Q_GUI_EXPORT void setDevice(QIODevice *device) Q_DECL_NOTHROW; + Q_GUI_EXPORT QIODevice *device() const noexcept; + Q_GUI_EXPORT void setDevice(QIODevice *device) noexcept; Q_GUI_EXPORT void load(); Q_GUI_EXPORT void load(const QJsonObject &prototypesObject); diff --git a/src/gui/util/qtexturefilehandler_p.h b/src/gui/util/qtexturefilehandler_p.h index b808d3e7db..3d4f42526f 100644 --- a/src/gui/util/qtexturefilehandler_p.h +++ b/src/gui/util/qtexturefilehandler_p.h @@ -3,7 +3,7 @@ ** Copyright (C) 2017 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtQuick module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage diff --git a/src/gui/util/qtexturefilereader.cpp b/src/gui/util/qtexturefilereader.cpp index 5d4bd600e0..fefb957323 100644 --- a/src/gui/util/qtexturefilereader.cpp +++ b/src/gui/util/qtexturefilereader.cpp @@ -41,6 +41,7 @@ #include "qpkmhandler_p.h" #include "qktxhandler_p.h" +#include "qastchandler_p.h" #include <QFileInfo> @@ -80,6 +81,8 @@ bool QTextureFileReader::canRead() m_handler = new QPkmHandler(m_device, logName); } else if (QKtxHandler::canRead(suffix, headerBlock)) { m_handler = new QKtxHandler(m_device, logName); + } else if (QAstcHandler::canRead(suffix, headerBlock)) { + m_handler = new QAstcHandler(m_device, logName); } // else if OtherHandler::canRead() ...etc. } @@ -89,7 +92,7 @@ bool QTextureFileReader::canRead() QList<QByteArray> QTextureFileReader::supportedFileFormats() { // Hardcoded for now - return {QByteArrayLiteral("pkm"), QByteArrayLiteral("ktx")}; + return {QByteArrayLiteral("pkm"), QByteArrayLiteral("ktx"), QByteArrayLiteral("astc")}; } bool QTextureFileReader::init() diff --git a/src/gui/util/qvalidator.h b/src/gui/util/qvalidator.h index cc7cbcb559..f0e72e3814 100644 --- a/src/gui/util/qvalidator.h +++ b/src/gui/util/qvalidator.h @@ -69,6 +69,7 @@ public: Intermediate, Acceptable }; + Q_ENUM(State) void setLocale(const QLocale &locale); QLocale locale() const; diff --git a/src/gui/util/util.pri b/src/gui/util/util.pri index 6324642505..e5e711b1a0 100644 --- a/src/gui/util/util.pri +++ b/src/gui/util/util.pri @@ -19,7 +19,8 @@ HEADERS += \ util/qtexturefilereader_p.h \ util/qtexturefilehandler_p.h \ util/qpkmhandler_p.h \ - util/qktxhandler_p.h + util/qktxhandler_p.h \ + util/qastchandler_p.h SOURCES += \ util/qdesktopservices.cpp \ @@ -38,4 +39,5 @@ SOURCES += \ util/qtexturefiledata.cpp \ util/qtexturefilereader.cpp \ util/qpkmhandler.cpp \ - util/qktxhandler.cpp + util/qktxhandler.cpp \ + util/qastchandler.cpp diff --git a/src/gui/vulkan/qvulkanfunctions.cpp b/src/gui/vulkan/qvulkanfunctions.cpp index c5f9616d20..73dbeb9ab6 100644 --- a/src/gui/vulkan/qvulkanfunctions.cpp +++ b/src/gui/vulkan/qvulkanfunctions.cpp @@ -66,16 +66,7 @@ QT_BEGIN_NAMESPACE The typical usage is the following: - \code - void Window::render() - { - QVulkanInstance *inst = vulkanInstance(); - QVulkanFunctions *f = inst->functions(); - ... - VkResult err = f->vkAllocateCommandBuffers(device, &cmdBufInfo, &cmdBuf); - ... - } - \endcode + \snippet code/src_gui_vulkan_qvulkanfunctions.cpp 0 \note Windowing system interface (WSI) specifics and extensions are excluded. This class only covers core Vulkan commands, with the exception @@ -118,15 +109,7 @@ QT_BEGIN_NAMESPACE The typical usage is the following: - \code - void Window::render() - { - QVulkanInstance *inst = vulkanInstance(); - QVulkanDeviceFunctions *df = inst->deviceFunctions(device); - VkResult err = df->vkAllocateCommandBuffers(device, &cmdBufInfo, &cmdBuf); - ... - } - \endcode + \snippet code/src_gui_vulkan_qvulkanfunctions.cpp 1 The QVulkanDeviceFunctions object specific to the provided VkDevice is created when QVulkanInstance::deviceFunctions() is first called with the diff --git a/src/gui/vulkan/qvulkaninstance.cpp b/src/gui/vulkan/qvulkaninstance.cpp index 8236d9625a..9895fec2ca 100644 --- a/src/gui/vulkan/qvulkaninstance.cpp +++ b/src/gui/vulkan/qvulkaninstance.cpp @@ -97,22 +97,7 @@ QT_BEGIN_NAMESPACE calling QWindow::setVulkanInstance(). Thus a typical application pattern is the following: - \code - int main(int argc, char **argv) - { - QGuiApplication app(argc, argv); - - QVulkanInstance inst; - if (!inst.create()) - return 1; - - ... - window->setVulkanInstance(&inst); - window->show(); - - return app.exec(); - } - \endcode + \snippet code/src_gui_vulkan_qvulkaninstance.cpp 0 \section1 Configuration @@ -138,31 +123,12 @@ QT_BEGIN_NAMESPACE For example, to enable the standard validation layers, one could do the following: - \code - QVulkanInstance inst; - - // Enable validation layer, if supported. Messages go to qDebug by default. - inst.setLayers(QByteArrayList() << "VK_LAYER_LUNARG_standard_validation"); - - bool ok = inst.create(); - if (!ok) - ... // Vulkan not available - if (!inst.layers().contains("VK_LAYER_LUNARG_standard_validation")) - ... // validation layer not available - \endcode + \snippet code/src_gui_vulkan_qvulkaninstance.cpp 1 Or, alternatively, to make decisions before attempting to create a Vulkan instance: - \code - QVulkanInstance inst; - - if (inst.supportedLayers().contains("VK_LAYER_LUNARG_standard_validation")) - ... - - bool ok = inst.create(); - ... - \endcode + \snippet code/src_gui_vulkan_qvulkaninstance.cpp 2 \section1 Adopting an Existing Instance @@ -229,62 +195,7 @@ QT_BEGIN_NAMESPACE The following is the basic outline of creating a Vulkan-capable QWindow: - \code - class VulkanWindow : public QWindow - { - public: - VulkanWindow() { - setSurfaceType(VulkanSurface); - } - - void exposeEvent(QExposeEvent *) { - if (isExposed()) { - if (!m_initialized) { - m_initialized = true; - // initialize device, swapchain, etc. - QVulkanInstance *inst = vulkanInstance(); - QVulkanFunctions *f = inst->functions(); - uint32_t devCount = 0; - f->vkEnumeratePhysicalDevices(inst->vkInstance(), &devCount, nullptr); - ... - // build the first frame - render(); - } - } - } - - bool event(QEvent *e) { - if (e->type == QEvent::UpdateRequest) - render(); - return QWindow::event(e); - } - - void render() { - ... - requestUpdate(); // render continuously - } - - private: - bool m_initialized = false; - }; - - int main(int argc, char **argv) - { - QGuiApplication app(argc, argv); - - QVulkanInstance inst; - if (!inst.create()) { - qWarning("Vulkan not available"); - return 1; - } - - VulkanWindow window; - window.showMaximized(); - - return app.exec(); - - } - \endcode + \snippet code/src_gui_vulkan_qvulkaninstance.cpp 3 \note In addition to expose, a well-behaving window implementation will also have to take care of additional events like resize and @@ -395,7 +306,7 @@ QVulkanInstance::QVulkanInstance() /*! Destructor. - \note current() will return \c nullptr once the instance is destroyed. + \note current() will return \nullptr once the instance is destroyed. */ QVulkanInstance::~QVulkanInstance() { diff --git a/src/gui/vulkan/qvulkaninstance.h b/src/gui/vulkan/qvulkaninstance.h index 57459e458c..f28975f911 100644 --- a/src/gui/vulkan/qvulkaninstance.h +++ b/src/gui/vulkan/qvulkaninstance.h @@ -84,14 +84,14 @@ struct QVulkanLayer }; Q_DECLARE_TYPEINFO(QVulkanLayer, Q_MOVABLE_TYPE); -inline bool operator==(const QVulkanLayer &lhs, const QVulkanLayer &rhs) Q_DECL_NOTHROW +inline bool operator==(const QVulkanLayer &lhs, const QVulkanLayer &rhs) noexcept { return lhs.name == rhs.name && lhs.version == rhs.version && lhs.specVersion == rhs.specVersion; } -inline bool operator!=(const QVulkanLayer &lhs, const QVulkanLayer &rhs) Q_DECL_NOTHROW +inline bool operator!=(const QVulkanLayer &lhs, const QVulkanLayer &rhs) noexcept { return !(lhs == rhs); } -inline uint qHash(const QVulkanLayer &key, uint seed = 0) Q_DECL_NOTHROW +inline uint qHash(const QVulkanLayer &key, uint seed = 0) noexcept { QtPrivate::QHashCombine hash; seed = hash(seed, key.name); @@ -107,14 +107,14 @@ struct QVulkanExtension }; Q_DECLARE_TYPEINFO(QVulkanExtension, Q_MOVABLE_TYPE); -inline bool operator==(const QVulkanExtension &lhs, const QVulkanExtension &rhs) Q_DECL_NOTHROW +inline bool operator==(const QVulkanExtension &lhs, const QVulkanExtension &rhs) noexcept { return lhs.name == rhs.name && lhs.version == rhs.version; } -inline bool operator!=(const QVulkanExtension &lhs, const QVulkanExtension &rhs) Q_DECL_NOTHROW +inline bool operator!=(const QVulkanExtension &lhs, const QVulkanExtension &rhs) noexcept { return !(lhs == rhs); } -inline uint qHash(const QVulkanExtension &key, uint seed = 0) Q_DECL_NOTHROW +inline uint qHash(const QVulkanExtension &key, uint seed = 0) noexcept { QtPrivate::QHashCombine hash; seed = hash(seed, key.name); diff --git a/src/gui/vulkan/qvulkanwindow.cpp b/src/gui/vulkan/qvulkanwindow.cpp index 2e65ab49c5..6d12377a60 100644 --- a/src/gui/vulkan/qvulkanwindow.cpp +++ b/src/gui/vulkan/qvulkanwindow.cpp @@ -74,60 +74,7 @@ Q_LOGGING_CATEGORY(lcGuiVk, "qt.vulkan") A typical application using QVulkanWindow may look like the following: - \code - class VulkanRenderer : public QVulkanWindowRenderer - { - public: - VulkanRenderer(QVulkanWindow *w) : m_window(w) { } - - void initResources() override - { - m_devFuncs = m_window->vulkanInstance()->deviceFunctions(m_window->device()); - ... - } - void initSwapChainResources() override { ... } - void releaseSwapChainResources() override { ... } - void releaseResources() override { ... } - - void startNextFrame() override - { - VkCommandBuffer cmdBuf = m_window->currentCommandBuffer(); - ... - m_devFuncs->vkCmdBeginRenderPass(...); - ... - m_window->frameReady(); - } - - private: - QVulkanWindow *m_window; - QVulkanDeviceFunctions *m_devFuncs; - }; - - class VulkanWindow : public QVulkanWindow - { - public: - QVulkanWindowRenderer *createRenderer() override { - return new VulkanRenderer(this); - } - }; - - int main(int argc, char *argv[]) - { - QGuiApplication app(argc, argv); - - QVulkanInstance inst; - // enable the standard validation layers, when available - inst.setLayers(QByteArrayList() << "VK_LAYER_LUNARG_standard_validation"); - if (!inst.create()) - qFatal("Failed to create Vulkan instance: %d", inst.errorCode()); - - VulkanWindow w; - w.setVulkanInstance(&inst); - w.showMaximized(); - - return app.exec(); - } - \endcode + \snippet code/src_gui_vulkan_qvulkanwindow.cpp 0 As it can be seen in the example, the main patterns in QVulkanWindow usage are: @@ -2439,18 +2386,7 @@ VkFramebuffer QVulkanWindow::currentFramebuffer() const concurrentFrameCount(). Such arrays can then be indexed by the value returned from this function. - \code - class Renderer { - ... - VkDescriptorBufferInfo m_uniformBufInfo[QVulkanWindow::MAX_CONCURRENT_FRAME_COUNT]; - }; - - void Renderer::startNextFrame() - { - VkDescriptorBufferInfo &uniformBufInfo(m_uniformBufInfo[m_window->currentFrame()]); - ... - } - \endcode + \snippet code/src_gui_vulkan_qvulkanwindow.cpp 1 \note This function must only be called from within startNextFrame() and, in case of asynchronous command generation, up until the call to frameReady(). @@ -2477,20 +2413,7 @@ int QVulkanWindow::currentFrame() const \note The value is constant for the entire lifetime of the QVulkanWindow. - \code - class Renderer { - ... - VkDescriptorBufferInfo m_uniformBufInfo[QVulkanWindow::MAX_CONCURRENT_FRAME_COUNT]; - }; - - void Renderer::startNextFrame() - { - const int count = m_window->concurrentFrameCount(); - for (int i = 0; i < count; ++i) - m_uniformBufInfo[i] = ... - ... - } - \endcode + \snippet code/src_gui_vulkan_qvulkanwindow.cpp 2 \sa currentFrame() */ diff --git a/src/gui/vulkan/qvulkanwindow_p.h b/src/gui/vulkan/qvulkanwindow_p.h index c6a772bc31..fb374a5564 100644 --- a/src/gui/vulkan/qvulkanwindow_p.h +++ b/src/gui/vulkan/qvulkanwindow_p.h @@ -97,7 +97,7 @@ public: int physDevIndex = 0; QVector<VkPhysicalDevice> physDevs; QVector<VkPhysicalDeviceProperties> physDevProps; - QVulkanWindow::Flags flags = 0; + QVulkanWindow::Flags flags = nullptr; QByteArrayList requestedDevExtensions; QHash<VkPhysicalDevice, QVulkanInfoVector<QVulkanExtension> > supportedDevExtensions; QVector<VkFormat> requestedColorFormats; |