27 files changed, 8329 insertions, 10563 deletions

diff --git a/Source/ThirdParty/brotli/CMakeLists.txt b/Source/ThirdParty/brotli/CMakeLists.txt
index 22a052d36..3a3ade378 100644
--- a/Source/ThirdParty/brotli/CMakeLists.txt
+++ b/Source/ThirdParty/brotli/CMakeLists.txt
@@ -1,13 +1,15 @@
 set(BROTLI_DIR "${THIRDPARTY_DIR}/brotli")
 
 set(BROTLI_INCLUDE_DIRECTORIES
+  "${BROTLI_DIR}/common"
   "${BROTLI_DIR}/dec"
+  "${BROTLI_DIR}/include"
 )
 
 set(BROTLI_SOURCES
+    ${BROTLI_DIR}/common/dictionary.c
     ${BROTLI_DIR}/dec/bit_reader.c
     ${BROTLI_DIR}/dec/decode.c
-    ${BROTLI_DIR}/dec/dictionary.c
     ${BROTLI_DIR}/dec/huffman.c
     ${BROTLI_DIR}/dec/state.c
 )
diff --git a/Source/ThirdParty/brotli/README.webkit b/Source/ThirdParty/brotli/README.webkit
index 474afa2e4..e9f8bb596 100644
--- a/Source/ThirdParty/brotli/README.webkit
+++ b/Source/ThirdParty/brotli/README.webkit
@@ -14,4 +14,4 @@ The in-tree copy is updated by running
   sh update.sh
 from within the modules/brotli directory.
 
-Current version: [commit 29d31d5921b0a2b323ac24e7f7d0cdc9a3c0dd08].
+Current version: [commit 4f8cd4c0f4443d51a9603790a445b06c073b7a4d].
diff --git a/Source/ThirdParty/brotli/common/constants.h b/Source/ThirdParty/brotli/common/constants.h
new file mode 100644
index 000000000..416ec5596
--- /dev/null
+++ b/Source/ThirdParty/brotli/common/constants.h
@@ -0,0 +1,57 @@
+/* Copyright 2016 Google Inc. All Rights Reserved.
+
+   Distributed under MIT license.
+   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+#ifndef BROTLI_COMMON_CONSTANTS_H_
+#define BROTLI_COMMON_CONSTANTS_H_
+
+/* Specification: 7.3. Encoding of the context map */
+#define BROTLI_CONTEXT_MAP_MAX_RLE 16
+
+/* Specification: 2. Compressed representation overview */
+#define BROTLI_MAX_NUMBER_OF_BLOCK_TYPES 256
+
+/* Specification: 3.3. Alphabet sizes: insert-and-copy length */
+#define BROTLI_NUM_LITERAL_SYMBOLS 256
+#define BROTLI_NUM_COMMAND_SYMBOLS 704
+#define BROTLI_NUM_BLOCK_LEN_SYMBOLS 26
+#define BROTLI_MAX_CONTEXT_MAP_SYMBOLS (BROTLI_MAX_NUMBER_OF_BLOCK_TYPES + \
+                                        BROTLI_CONTEXT_MAP_MAX_RLE)
+#define BROTLI_MAX_BLOCK_TYPE_SYMBOLS (BROTLI_MAX_NUMBER_OF_BLOCK_TYPES + 2)
+
+/* Specification: 3.5. Complex prefix codes */
+#define BROTLI_REPEAT_PREVIOUS_CODE_LENGTH 16
+#define BROTLI_REPEAT_ZERO_CODE_LENGTH 17
+#define BROTLI_CODE_LENGTH_CODES (BROTLI_REPEAT_ZERO_CODE_LENGTH + 1)
+/* "code length of 8 is repeated" */
+#define BROTLI_INITIAL_REPEATED_CODE_LENGTH 8
+
+/* Specification: 4. Encoding of distances */
+#define BROTLI_NUM_DISTANCE_SHORT_CODES 16
+#define BROTLI_MAX_NPOSTFIX 3
+#define BROTLI_MAX_NDIRECT 120
+#define BROTLI_MAX_DISTANCE_BITS 24U
+/* BROTLI_NUM_DISTANCE_SYMBOLS == 520 */
+#define BROTLI_NUM_DISTANCE_SYMBOLS (BROTLI_NUM_DISTANCE_SHORT_CODES + \
+                                     BROTLI_MAX_NDIRECT +              \
+                                     (BROTLI_MAX_DISTANCE_BITS <<      \
+                                      (BROTLI_MAX_NPOSTFIX + 1)))
+/* Distance that is guaranteed to be representable in any stream. */
+#define BROTLI_MAX_DISTANCE 0x3FFFFFC
+
+/* 7.1. Context modes and context ID lookup for literals */
+/* "context IDs for literals are in the range of 0..63" */
+#define BROTLI_LITERAL_CONTEXT_BITS 6
+
+/* 7.2. Context ID for distances */
+#define BROTLI_DISTANCE_CONTEXT_BITS 2
+
+/* 9.1. Format of the Stream Header */
+/* Number of slack bytes for window size. Don't confuse
+   with BROTLI_NUM_DISTANCE_SHORT_CODES. */
+#define BROTLI_WINDOW_GAP 16
+#define BROTLI_MAX_BACKWARD_LIMIT(W) (((size_t)1 << (W)) - BROTLI_WINDOW_GAP)
+
+#endif  /* BROTLI_COMMON_CONSTANTS_H_ */
diff --git a/Source/ThirdParty/brotli/common/dictionary.bin b/Source/ThirdParty/brotli/common/dictionary.bin
new file mode 100755
index 000000000..a585c0e29
--- /dev/null
+++ b/Source/ThirdParty/brotli/common/dictionary.bin
@@ -0,0 +1,432 @@
+timedownlifeleftbackcodedatashowonlysitecityopenjustlikefreeworktextyearoverbodyloveformbookplaylivelinehelphomesidemorewordlongthemviewfindpagedaysfullheadtermeachareafromtruemarkableuponhighdatelandnewsevennextcasebothpostusedmadehandherewhatnameLinkblogsizebaseheldmakemainuser') +holdendswithNewsreadweresigntakehavegameseencallpathwellplusmenufilmpartjointhislistgoodneedwayswestjobsmindalsologorichuseslastteamarmyfoodkingwilleastwardbestfirePageknowaway.pngmovethanloadgiveselfnotemuchfeedmanyrockicononcelookhidediedHomerulehostajaxinfoclublawslesshalfsomesuchzone100%onescareTimeracebluefourweekfacehopegavehardlostwhenparkkeptpassshiproomHTMLplanTypedonesavekeepflaglinksoldfivetookratetownjumpthusdarkcardfilefearstaykillthatfallautoever.comtalkshopvotedeepmoderestturnbornbandfellroseurl(skinrolecomeactsagesmeetgold.jpgitemvaryfeltthensenddropViewcopy1.0"</a>stopelseliestourpack.gifpastcss?graymean&gt;rideshotlatesaidroadvar feeljohnrickportfast'UA-dead</b>poorbilltypeU.S.woodmust2px;Inforankwidewantwalllead[0];paulwavesure$('#waitmassarmsgoesgainlangpaid!-- lockunitrootwalkfirmwifexml"songtest20pxkindrowstoolfontmailsafestarmapscorerainflowbabyspansays4px;6px;artsfootrealwikiheatsteptriporg/lakeweaktoldFormcastfansbankveryrunsjulytask1px;goalgrewslowedgeid="sets5px;.js?40pxif (soonseatnonetubezerosentreedfactintogiftharm18pxcamehillboldzoomvoideasyringfillpeakinitcost3px;jacktagsbitsrolleditknewnear<!--growJSONdutyNamesaleyou lotspainjazzcoldeyesfishwww.risktabsprev10pxrise25pxBlueding300,ballfordearnwildbox.fairlackverspairjunetechif(!pickevil$("#warmlorddoespull,000ideadrawhugespotfundburnhrefcellkeystickhourlossfuel12pxsuitdealRSS"agedgreyGET"easeaimsgirlaids8px;navygridtips#999warsladycars); }php?helltallwhomzh:å*/

+ 100hall.
+
+A7px;pushchat0px;crew*/</hash75pxflatrare && tellcampontolaidmissskiptentfinemalegetsplot400,

+

+coolfeet.php<br>ericmostguidbelldeschairmathatom/img&#82luckcent000;tinygonehtmlselldrugFREEnodenick?id=losenullvastwindRSS wearrelybeensamedukenasacapewishgulfT23:hitsslotgatekickblurthey15px''););">msiewinsbirdsortbetaseekT18:ordstreemall60pxfarm’sboys[0].');"POSTbearkids);}}marytend(UK)quadzh:æ-siz----prop');
liftT19:viceandydebt>RSSpoolneckblowT16:doorevalT17:letsfailoralpollnovacolsgene —softrometillross<h3>pourfadepink<tr>mini)|!(minezh:èbarshear00);milk -->ironfreddiskwentsoilputs/js/holyT22:ISBNT20:adamsees<h2>json', 'contT21: RSSloopasiamoon</p>soulLINEfortcartT14:<h1>80px!--<9px;T04:mike:46ZniceinchYorkricezh:ä'));puremageparatonebond:37Z_of_']);000,zh:çtankyardbowlbush:56ZJava30px
+|}
+%C3%:34ZjeffEXPIcashvisagolfsnowzh:équer.csssickmeatmin.binddellhirepicsrent:36ZHTTP-201fotowolfEND xbox:54ZBODYdick;
+}
+exit:35Zvarsbeat'});diet999;anne}}</[i].Langkm²wiretoysaddssealalex;
+	}echonine.org005)tonyjewssandlegsroof000) 200winegeardogsbootgarycutstyletemption.xmlcockgang$('.50pxPh.Dmiscalanloandeskmileryanunixdisc);}
+dustclip).
+
+70px-200DVDs7]><tapedemoi++)wageeurophiloptsholeFAQsasin-26TlabspetsURL bulkcook;}

+HEAD[0])abbrjuan(198leshtwin</i>sonyguysfuckpipe|-
+!002)ndow[1];[];
+Log salt

+		bangtrimbath){

+00px
+});ko:ìfeesad>
s:// [];tollplug(){
+{

+ .js'200pdualboat.JPG);
+}quot);
+
+');
+

+}
201420152016201720182019202020212022202320242025202620272028202920302031203220332034203520362037201320122011201020092008200720062005200420032002200120001999199819971996199519941993199219911990198919881987198619851984198319821981198019791978197719761975197419731972197119701969196819671966196519641963196219611960195919581957195619551954195319521951195010001024139400009999comomásesteestaperotodohacecadaañobiendíaasívidacasootroforosolootracualdijosidograntipotemadebealgoquéestonadatrespococasabajotodasinoaguapuesunosantediceluisellamayozonaamorpisoobraclicellodioshoracasiзанаомрарутанепоотизнодотожеоних�аеебымыВы�овыво�ообПолиниРФ�еМытыОнимдаЗаДа�уОбтеИзейнуммТыуж�يأنمامعكلأورديا�ىهولملكاولهبسالإنهيأيقدهلثمبهلوليبلايبكشيامأمنتبيلنحبهممشوشfirstvideolightworldmediawhitecloseblackrightsmallbooksplacemusicfieldorderpointvalueleveltableboardhousegroupworksyearsstatetodaywaterstartstyledeathpowerphonenighterrorinputabouttermstitletoolseventlocaltimeslargewordsgamesshortspacefocusclearmodelblockguideradiosharewomenagainmoneyimagenamesyounglineslatercolorgreenfront&amp;watchforcepricerulesbeginaftervisitissueareasbelowindextotalhourslabelprintpressbuiltlinksspeedstudytradefoundsenseundershownformsrangeaddedstillmovedtakenaboveflashfixedoftenotherviewschecklegalriveritemsquickshapehumanexistgoingmoviethirdbasicpeacestagewidthloginideaswrotepagesusersdrivestorebreaksouthvoicesitesmonthwherebuildwhichearthforumthreesportpartyClicklowerlivesclasslayerentrystoryusagesoundcourtyour birthpopuptypesapplyImagebeinguppernoteseveryshowsmeansextramatchtrackknownearlybegansuperpapernorthlearngivennamedendedTermspartsGroupbrandusingwomanfalsereadyaudiotakeswhile.com/livedcasesdailychildgreatjudgethoseunitsneverbroadcoastcoverapplefilescyclesceneplansclickwritequeenpieceemailframeolderphotolimitcachecivilscaleenterthemetheretouchboundroyalaskedwholesincestock namefaithheartemptyofferscopeownedmightalbumthinkbloodarraymajortrustcanonunioncountvalidstoneStyleLoginhappyoccurleft:freshquitefilmsgradeneedsurbanfightbasishoverauto;route.htmlmixedfinalYour slidetopicbrownalonedrawnsplitreachRightdatesmarchquotegoodsLinksdoubtasyncthumballowchiefyouthnovel10px;serveuntilhandsCheckSpacequeryjamesequaltwice0,000Startpanelsongsroundeightshiftworthpostsleadsweeksavoidthesemilesplanesmartalphaplantmarksratesplaysclaimsalestextsstarswrong</h3>thing.org/multiheardPowerstandtokensolid(thisbringshipsstafftriedcallsfullyfactsagentThis //-->adminegyptEvent15px;Emailtrue"crossspentblogsbox">notedleavechinasizesguest</h4>robotheavytrue,sevengrandcrimesignsawaredancephase><!--en_US&#39;200px_namelatinenjoyajax.ationsmithU.S. holdspeterindianav">chainscorecomesdoingpriorShare1990sromanlistsjapanfallstrialowneragree</h2>abusealertopera"-//WcardshillsteamsPhototruthclean.php?saintmetallouismeantproofbriefrow">genretrucklooksValueFrame.net/-->
+<try {
+var makescostsplainadultquesttrainlaborhelpscausemagicmotortheir250pxleaststepsCountcouldglasssidesfundshotelawardmouthmovesparisgivesdutchtexasfruitnull,||[];top">
+<!--POST"ocean<br/>floorspeakdepth sizebankscatchchart20px;aligndealswould50px;url="parksmouseMost ...</amongbrainbody none;basedcarrydraftreferpage_home.meterdelaydreamprovejoint</tr>drugs<!-- aprilidealallenexactforthcodeslogicView seemsblankports (200saved_linkgoalsgrantgreekhomesringsrated30px;whoseparse();" Blocklinuxjonespixel');">);if(-leftdavidhorseFocusraiseboxesTrackement</em>bar">.src=toweralt="cablehenry24px;setupitalysharpminortastewantsthis.resetwheelgirls/css/100%;clubsstuffbiblevotes 1000korea});

+bandsqueue= {};80px;cking{

+		aheadclockirishlike ratiostatsForm"yahoo)[0];Aboutfinds</h1>debugtasksURL =cells})();12px;primetellsturns0x600.jpg"spainbeachtaxesmicroangel--></giftssteve-linkbody.});
+	mount (199FAQ</rogerfrankClass28px;feeds<h1><scotttests22px;drink) || lewisshall#039; for lovedwaste00px;ja:ã‚simon<fontreplymeetsuntercheaptightBrand) != dressclipsroomsonkeymobilmain.Name platefunnytreescom/"1.jpgwmodeparamSTARTleft idden, 201);
+}
+form.viruschairtransworstPagesitionpatch<!--
+o-cacfirmstours,000 asiani++){adobe')[0]id=10both;menu .2.mi.png"kevincoachChildbruce2.jpgURL)+.jpg|suitesliceharry120" sweettr>

+name=diegopage swiss-->
+
+#fff;">Log.com"treatsheet) && 14px;sleepntentfiledja:ãƒid="cName"worseshots-box-delta
+&lt;bears:48Z<data-rural</a> spendbakershops= "";php">ction13px;brianhellosize=o=%2F joinmaybe<img img">, fjsimg" ")[0]MTopBType"newlyDanskczechtrailknows</h5>faq">zh-cn10);
+-1");type=bluestrulydavis.js';>

+<!steel you h2>

+form jesus100% menu.

+	

+walesrisksumentddingb-likteachgif" vegasdanskeestishqipsuomisobredesdeentretodospuedeañosestátienehastaotrospartedondenuevohacerformamismomejormundoaquídíassóloayudafechatodastantomenosdatosotrassitiomuchoahoralugarmayorestoshorastenerantesfotosestaspaísnuevasaludforosmedioquienmesespoderchileserávecesdecirjoséestarventagrupohechoellostengoamigocosasnivelgentemismaairesjuliotemashaciafavorjuniolibrepuntobuenoautorabrilbuenatextomarzosaberlistaluegocómoenerojuegoperúhaberestoynuncamujervalorfueralibrogustaigualvotoscasosguíapuedosomosavisousteddebennochebuscafaltaeurosseriedichocursoclavecasasleónplazolargoobrasvistaapoyojuntotratavistocrearcampohemoscincocargopisosordenhacenáreadiscopedrocercapuedapapelmenorútilclarojorgecalleponertardenadiemarcasigueellassiglocochemotosmadreclaserestoniñoquedapasarbancohijosviajepabloéstevienereinodejarfondocanalnorteletracausatomarmanoslunesautosvillavendopesartipostengamarcollevapadreunidovamoszonasambosbandamariaabusomuchasubirriojavivirgradochicaallíjovendichaestantalessalirsuelopesosfinesllamabuscoéstalleganegroplazahumorpagarjuntadobleislasbolsabañohablalucha�readicenjugarnotasvalleallácargadolorabajoestégustomentemariofirmacostofichaplatahogarartesleyesaquelmuseobasespocosmitadcielochicomiedoganarsantoetapadebesplayaredessietecortecoreadudasdeseoviejodeseaaguas&quot;domaincommonstatuseventsmastersystemactionbannerremovescrollupdateglobalmediumfilternumberchangeresultpublicscreenchoosenormaltravelissuessourcetargetspringmodulemobileswitchphotosborderregionitselfsocialactivecolumnrecordfollowtitle>eitherlengthfamilyfriendlayoutauthorcreatereviewsummerserverplayedplayerexpandpolicyformatdoublepointsseriespersonlivingdesignmonthsforcesuniqueweightpeopleenergynaturesearchfigurehavingcustomoffsetletterwindowsubmitrendergroupsuploadhealthmethodvideosschoolfutureshadowdebatevaluesObjectothersrightsleaguechromesimplenoticesharedendingseasonreportonlinesquarebuttonimagesenablemovinglatestwinterFranceperiodstrongrepeatLondondetailformeddemandsecurepassedtoggleplacesdevicestaticcitiesstreamyellowattackstreetflighthiddeninfo">openedusefulvalleycausesleadersecretseconddamagesportsexceptratingsignedthingseffectfieldsstatesofficevisualeditorvolumeReportmuseummoviesparentaccessmostlymother" id="marketgroundchancesurveybeforesymbolmomentspeechmotioninsidematterCenterobjectexistsmiddleEuropegrowthlegacymannerenoughcareeransweroriginportalclientselectrandomclosedtopicscomingfatheroptionsimplyraisedescapechosenchurchdefinereasoncorneroutputmemoryiframepolicemodelsNumberduringoffersstyleskilledlistedcalledsilvermargindeletebetterbrowselimitsGlobalsinglewidgetcenterbudgetnowrapcreditclaimsenginesafetychoicespirit-stylespreadmakingneededrussiapleaseextentScriptbrokenallowschargedividefactormember-basedtheoryconfigaroundworkedhelpedChurchimpactshouldalwayslogo" bottomlist">){var prefixorangeHeader.push(couplegardenbridgelaunchReviewtakingvisionlittledatingButtonbeautythemesforgotSearchanchoralmostloadedChangereturnstringreloadMobileincomesupplySourceordersviewed&nbsp;courseAbout island<html cookiename="amazonmodernadvicein</a>: The dialoghousesBEGIN MexicostartscentreheightaddingIslandassetsEmpireSchooleffortdirectnearlymanualSelect.
+
+Onejoinedmenu">PhilipawardshandleimportOfficeregardskillsnationSportsdegreeweekly (e.g.behinddoctorloggedunited</b></beginsplantsassistartistissued300px|canadaagencyschemeremainBrazilsamplelogo">beyond-scaleacceptservedmarineFootercamera</h1>
+_form"leavesstress" />

+.gif" onloadloaderOxfordsistersurvivlistenfemaleDesignsize="appealtext">levelsthankshigherforcedanimalanyoneAfricaagreedrecentPeople<br />wonderpricesturned|| {};main">inlinesundaywrap">failedcensusminutebeaconquotes150px|estateremoteemail"linkedright;signalformal1.htmlsignupprincefloat:.png" forum.AccesspaperssoundsextendHeightsliderUTF-8"&amp; Before. WithstudioownersmanageprofitjQueryannualparamsboughtfamousgooglelongeri++) {israelsayingdecidehome">headerensurebranchpiecesblock;statedtop"><racingresize--&gt;pacitysexualbureau.jpg" 10,000obtaintitlesamount, Inc.comedymenu" lyricstoday.indeedcounty_logo.FamilylookedMarketlse ifPlayerturkey);var forestgivingerrorsDomain}else{insertBlog</footerlogin.fasteragents<body 10px 0pragmafridayjuniordollarplacedcoversplugin5,000 page">boston.test(avatartested_countforumsschemaindex,filledsharesreaderalert(appearSubmitline">body">
+* TheThoughseeingjerseyNews</verifyexpertinjurywidth=CookieSTART across_imagethreadnativepocketbox">
+System DavidcancertablesprovedApril reallydriveritem">more">boardscolorscampusfirst || [];media.guitarfinishwidth:showedOther .php" assumelayerswilsonstoresreliefswedenCustomeasily your String
+
+Whiltaylorclear:resortfrenchthough") + "<body>buyingbrandsMembername">oppingsector5px;">vspacepostermajor coffeemartinmaturehappen</nav>kansaslink">Images=falsewhile hspace0&amp; 
+
+In  powerPolski-colorjordanBottomStart -count2.htmlnews">01.jpgOnline-rightmillerseniorISBN 00,000 guidesvalue)ectionrepair.xml"  rights.html-blockregExp:hoverwithinvirginphones</tr>
using 
+	var >');
+	</td>
+</tr>
+bahasabrasilgalegomagyarpolskisrpskiردو中文简体�體信�中国我们一个公�管�论��以�务时间个人产�自己�业查看工作�系没有网站所有评论中心文章用户首页作者技术问题相关下载�索使用软件在线主题资料视频回�注册网络收�内容推�市场消�空间�布什么好�生活图片�展如果手机新闻最新方�北京�供关于更多这个系统知�游�广告其他�表安全第一会员进行点击版�电�世界设计�费教育加入活动他们商��客现在上海如何已�留言详细社区登录本站需�价格支�国际链接国家建设朋�阅读法律�置�济选择这样当�分类排行因为交易最�音��能通过行业科技�能设备�作大家社会研究专业全部项目这里还是开始情况电脑文件�牌帮助文化资�大学学习地��览投资工程�求怎么时候功能主�目�资讯城市方法电影招�声明任何�康数�美国汽车介�但是交�生产所以电�显示一些��人员分�地图旅游工具学生系列网�帖�密�频�控制地区基本全国网上��第二喜欢进入�情这些考试�现培训以上政府�为环境香港�时娱���一定开�作�标准欢迎解决地方一下以�责任或者客户代表积分女人数�销售出现离线应用列表��编辑统计查询��有关机构很多播放组织政策直接能力��時間看到热门关键专区�常英语百度希望美女比较知识规定建议部门��精彩日本�高�言方�基金处���影片银行还有分享物���添加专家这��题起�业务公告记录简介质�男人影�引用报告部分快速咨询时尚注�申请学校应该历��是返回购买�称为了�功说明供应孩�专题程�一般會員�有其它�护而且今天窗�动�状�特别认为必须更新�说我們作为媒体包括那么一样国内是�根�电视学院具有过程由于人�出��过正在明星故事关系标题商务输入一直基础教学了解建筑结果全�通知计划对于艺术相册�生真的建立等级类型�验实现制作�自标签以下原创无法其中個人一切指�关闭集团第三关注因此照片深圳商业广州日期高级最近综�表示专辑行为交通评价觉得精�家庭完�感觉安装得到邮件制度食�虽然转载报价记者方案行政人民用�东西�出酒店然�付款热点以�完全�帖设置领导工业医院看看�典原因平���增加�料新增之��业效果今年论文我国告诉版主修改�与打�快�机械观点存在精神获得利用继续你们这么模�语言能够雅虎�作风格一起科学体育短信�件治疗�动产业会议导航先生�盟�是�題结构作用调查資料自动负责农业访问实施接�讨论那个�馈加强女性范围�務休闲今日客�觀看�加的�一点��图书有效测试移动�能决定股票�断需求�得办法之间采用�销投诉目标爱情摄影有些複製文学机会数字装修购物农�全�精�其实事情水平�示上市谢谢普通教师上传类别歌曲拥有创新�件��时代資訊达到人生订阅�师展示心�贴�網站主題自然级别简�改�那些�说打开代�删除�券节目�点次數多少规划资金找到以�大全主页最佳回答天下�障现代检查投票�时沒有正常甚至代�目录公开�制金�幸�版本形�准备行情回到�想怎样�议认�最好产生按照�装广东动漫采购新手组图���考政治容易天地努力人们�级速度人物调整�行造�文字韩国贸易开展相關表现影视如此美容大�报��款心情许多法规家居书店连接立�举报技巧奥�登入以��论事件自由中�办公妈妈真正�错全文��价值别人监�具体世纪团队创业承担增长有人��商家维修�湾左�股份答案实际电信��生命宣传任务正�特色下��会�能当然�新內容指导�行日志賣家超过土地浙江支付推出站长�州执行制造之一推广现场�述�化传统歌手�险课程医疗�过过去之�收入年度�志美丽最高登陆未�加工�责教程版�身体�庆出售�本形�土豆出價东方邮箱�京求��得��相信页�分钟网页确定图例网�积�错误目的��机关风险授�病毒宠物除了評論疾病�时求购站点儿童�天中央认识�个天津字体��维护本页个性官方常�相机战略应当律师方便校园股市房屋�目员工导致�然�具本网结�档案劳动�外美元引起改�第四会计說明����规范消费共�忘记体系带��字發表开放加盟�到二手大��人数�共享区域女孩原则所在结�通信超级�置当时优秀性感房产�戲出��交就业��程度�数事业整个山东情感特殊分類�尋属于门户财务声音�其财���干部�立利益考虑�都包装用戶比赛文明招商完整真是眼�伙伴�望领域�生优惠論壇公共良好充分符�附件特点��英文资产根本明显密碼公众民�更加享��学�动适�原�问答本文美食绿色稳定终于生物供求��力�严�永远写真有�竞争对象费用�好�对�分促进点评影音优势�少欣�并且有点方�全新信用设施形象资格�破���大于是毕业智能化工完美商城统一出版打造產�概况用于�留因素中國存储贴图最愛长期�价�财基地安排武汉里�创建天空首先完善驱动下���诚信�义阳光英国漂亮军事玩家群众农民���稱家具动画想到注明�学性能考研硬件观看清楚�笑首�黄金适用江�真实主管阶段註冊翻译�利�好似乎通讯施工狀態也许环�培养概念大型机票�解匿�cuandoenviarmadridbuscariniciotiempoporquecuentaestadopuedenjuegoscontraestánnombretienenperfilmaneraamigosciudadcentroaunquepuedesdentroprimerpreciosegúnbuenosvolverpuntossemanahabíaagostonuevosunidoscarlosequiponiñosmuchosalgunacorreoimagenpartirarribamaríahombreempleoverdadcambiomuchasfueronpasadolíneaparecenuevascursosestabaquierolibroscuantoaccesomiguelvarioscuatrotienesgruposseráneuropamediosfrenteacercademásofertacochesmodeloitalialetrasalgúncompracualesexistecuerposiendoprensallegarviajesdineromurciapodrápuestodiariopuebloquieremanuelpropiocrisisciertoseguromuertefuentecerrargrandeefectopartesmedidapropiaofrecetierrae-mailvariasformasfuturoobjetoseguirriesgonormasmismosúnicocaminositiosrazóndebidopruebatoledoteníajesúsesperococinaorigentiendacientocádizhablarseríalatinafuerzaestiloguerraentraréxitolópezagendavídeoevitarpaginametrosjavierpadresfácilcabezaáreassalidaenvíojapónabusosbienestextosllevarpuedanfuertecomúnclaseshumanotenidobilbaounidadestáseditarcreadoдл�чтокакили�тов�еегопритакещеужеКакбезбылониВ�еподЭтотомчемнетлетразонагдемнеДл�Прина�нихтемктогодвоттамСШ�ма�Чтова�вамемуТакдванам�ти�туВамтехпротутнаддн�ВоттринейВа�ним�амтотрубОнимирнееОООлиц�таОнанемдоммойдвеоно�удकेहैकीसेकाकोऔरपरने�ककिभीइसकरतोहोआपहीयहयातकथाjagranआजजोअबदोगईजाग�हमइनवहयेथेथीघरजबदीकईजीवेनईन�हरउसमेकमवोलेसबमईदेओरआमबसभरबनचलमनआगसीलीعلىإلىهذاآخرعددالىهذهصورغيركانولابينعرضذلكهنايومقالعليانالكنحتىقبلوحةاخر�قطعبدركنإذاكمااحدإلا�يهبعضكي�بحثومنوهوأناجدالهاسلمعندليسعبرصلىمنذبهاأنهمثلكنتالاحيثمصرشرححولو�ياذالكلمرةانتال�أبوخاصأنتانهاليعضووقدابنخيربنتلكمشاءوهيابوقصصومارقمأحدنحنعدمرأياحةكتبدونيجبمنهتحتجهةسنةيتمكرةغزةن�سبيتللهلناتلكقلبلماعنهأولشيءنورأما�يكبكلذاترتببأنهمسانكبيع�قدحسنلهمشعرأهلشهرقطرطلبprofileservicedefaulthimselfdetailscontentsupportstartedmessagesuccessfashion<title>countryaccountcreatedstoriesresultsrunningprocesswritingobjectsvisiblewelcomearticleunknownnetworkcompanydynamicbrowserprivacyproblemServicerespectdisplayrequestreservewebsitehistoryfriendsoptionsworkingversionmillionchannelwindow.addressvisitedweathercorrectproductedirectforwardyou canremovedsubjectcontrolarchivecurrentreadinglibrarylimitedmanagerfurthersummarymachineminutesprivatecontextprogramsocietynumberswrittenenabledtriggersourcesloadingelementpartnerfinallyperfectmeaningsystemskeepingculture&quot;,journalprojectsurfaces&quot;expiresreviewsbalanceEnglishContentthroughPlease opinioncontactaverageprimaryvillageSpanishgallerydeclinemeetingmissionpopularqualitymeasuregeneralspeciessessionsectionwriterscounterinitialreportsfiguresmembersholdingdisputeearlierexpressdigitalpictureAnothermarriedtrafficleadingchangedcentralvictoryimages/reasonsstudiesfeaturelistingmust beschoolsVersionusuallyepisodeplayinggrowingobviousoverlaypresentactions</ul>

+wrapperalreadycertainrealitystorageanotherdesktopofferedpatternunusualDigitalcapitalWebsitefailureconnectreducedAndroiddecadesregular &amp; animalsreleaseAutomatgettingmethodsnothingPopularcaptionletterscapturesciencelicensechangesEngland=1&amp;History = new CentralupdatedSpecialNetworkrequirecommentwarningCollegetoolbarremainsbecauseelectedDeutschfinanceworkersquicklybetweenexactlysettingdiseaseSocietyweaponsexhibit&lt;!--Controlclassescoveredoutlineattacksdevices(windowpurposetitle="Mobile killingshowingItaliandroppedheavilyeffects-1']);
+confirmCurrentadvancesharingopeningdrawingbillionorderedGermanyrelated</form>includewhetherdefinedSciencecatalogArticlebuttonslargestuniformjourneysidebarChicagoholidayGeneralpassage,&quot;animatefeelingarrivedpassingnaturalroughly.
+
+The but notdensityBritainChineselack oftributeIreland" data-factorsreceivethat isLibraryhusbandin factaffairsCharlesradicalbroughtfindinglanding:lang="return leadersplannedpremiumpackageAmericaEdition]&quot;Messageneed tovalue="complexlookingstationbelievesmaller-mobilerecordswant tokind ofFirefoxyou aresimilarstudiedmaximumheadingrapidlyclimatekingdomemergedamountsfoundedpioneerformuladynastyhow to SupportrevenueeconomyResultsbrothersoldierlargelycalling.&quot;AccountEdward segmentRobert effortsPacificlearnedup withheight:we haveAngelesnations_searchappliedacquiremassivegranted: falsetreatedbiggestbenefitdrivingStudiesminimumperhapsmorningsellingis usedreversevariant role="missingachievepromotestudentsomeoneextremerestorebottom:evolvedall thesitemapenglishway to  AugustsymbolsCompanymattersmusicalagainstserving})();

+paymenttroubleconceptcompareparentsplayersregionsmonitor ''The winningexploreadaptedGalleryproduceabilityenhancecareers). The collectSearch ancientexistedfooter handlerprintedconsoleEasternexportswindowsChannelillegalneutralsuggest_headersigning.html">settledwesterncausing-webkitclaimedJusticechaptervictimsThomas mozillapromisepartieseditionoutside:false,hundredOlympic_buttonauthorsreachedchronicdemandssecondsprotectadoptedprepareneithergreatlygreateroverallimprovecommandspecialsearch.worshipfundingthoughthighestinsteadutilityquarterCulturetestingclearlyexposedBrowserliberal} catchProjectexamplehide();FloridaanswersallowedEmperordefenseseriousfreedomSeveral-buttonFurtherout of != nulltrainedDenmarkvoid(0)/all.jspreventRequestStephen
+
+When observe</h2>

+Modern provide" alt="borders.
+
+For 
+
+Many artistspoweredperformfictiontype ofmedicalticketsopposedCouncilwitnessjusticeGeorge Belgium...</a>twitternotablywaitingwarfare Other rankingphrasesmentionsurvivescholar</p>

+ Countryignoredloss ofjust asGeorgiastrange<head><stopped1']);

+islandsnotableborder:list ofcarried100,000</h3>
+ severalbecomesselect wedding00.htmlmonarchoff theteacherhighly biologylife ofor evenrise of&raquo;plusonehunting(thoughDouglasjoiningcirclesFor theAncientVietnamvehiclesuch ascrystalvalue =Windowsenjoyeda smallassumed<a id="foreign All rihow theDisplayretiredhoweverhidden;battlesseekingcabinetwas notlook atconductget theJanuaryhappensturninga:hoverOnline French lackingtypicalextractenemieseven ifgeneratdecidedare not/searchbeliefs-image:locatedstatic.login">convertviolententeredfirst">circuitFinlandchemistshe was10px;">as suchdivided</span>will beline ofa greatmystery/index.fallingdue to railwaycollegemonsterdescentit withnuclearJewish protestBritishflowerspredictreformsbutton who waslectureinstantsuicidegenericperiodsmarketsSocial fishingcombinegraphicwinners<br /><by the NaturalPrivacycookiesoutcomeresolveSwedishbrieflyPersianso muchCenturydepictscolumnshousingscriptsnext tobearingmappingrevisedjQuery(-width:title">tooltipSectiondesignsTurkishyounger.match(})();
+
+burningoperatedegreessource=Richardcloselyplasticentries</tr>

+color:#ul id="possessrollingphysicsfailingexecutecontestlink toDefault<br />
+: true,chartertourismclassicproceedexplain</h1>

+online.?xml vehelpingdiamonduse theairlineend -->).attr(readershosting#ffffffrealizeVincentsignals src="/ProductdespitediversetellingPublic held inJoseph theatreaffects<style>a largedoesn'tlater, ElementfaviconcreatorHungaryAirportsee theso thatMichaelSystemsPrograms, and  width=e&quot;tradingleft">
+personsGolden Affairsgrammarformingdestroyidea ofcase ofoldest this is.src = cartoonregistrCommonsMuslimsWhat isin manymarkingrevealsIndeed,equally/show_aoutdoorescape(Austriageneticsystem,In the sittingHe alsoIslandsAcademy
+		<!--Daniel bindingblock">imposedutilizeAbraham(except{width:putting).html(|| [];
+DATA[ *kitchenmountedactual dialectmainly _blank'installexpertsif(typeIt also&copy; ">Termsborn inOptionseasterntalkingconcerngained ongoingjustifycriticsfactoryits ownassaultinvitedlastinghis ownhref="/" rel="developconcertdiagramdollarsclusterphp?id=alcohol);})();using a><span>vesselsrevivalAddressamateurandroidallegedillnesswalkingcentersqualifymatchesunifiedextinctDefensedied in
+	<!-- customslinkingLittle Book ofeveningmin.js?are thekontakttoday's.html" target=wearingAll Rig;
+})();raising Also, crucialabout">declare-->
+<scfirefoxas muchappliesindex, s, but type = 
+

+<!--towardsRecordsPrivateForeignPremierchoicesVirtualreturnsCommentPoweredinline;povertychamberLiving volumesAnthonylogin" RelatedEconomyreachescuttinggravitylife inChapter-shadowNotable</td>

+ returnstadiumwidgetsvaryingtravelsheld bywho arework infacultyangularwho hadairporttown of
+
+Some 'click'chargeskeywordit willcity of(this);Andrew unique checkedor more300px; return;rsion="pluginswithin herselfStationFederalventurepublishsent totensionactresscome tofingersDuke ofpeople,exploitwhat isharmonya major":"httpin his menu">
+monthlyofficercouncilgainingeven inSummarydate ofloyaltyfitnessand wasemperorsupremeSecond hearingRussianlongestAlbertalateralset of small">.appenddo withfederalbank ofbeneathDespiteCapitalgrounds), and percentit fromclosingcontainInsteadfifteenas well.yahoo.respondfighterobscurereflectorganic= Math.editingonline paddinga wholeonerroryear ofend of barrierwhen itheader home ofresumedrenamedstrong>heatingretainscloudfrway of March 1knowingin partBetweenlessonsclosestvirtuallinks">crossedEND -->famous awardedLicenseHealth fairly wealthyminimalAfricancompetelabel">singingfarmersBrasil)discussreplaceGregoryfont copursuedappearsmake uproundedboth ofblockedsaw theofficescoloursif(docuwhen heenforcepush(fuAugust UTF-8">Fantasyin mostinjuredUsuallyfarmingclosureobject defenceuse of Medical<body>
+evidentbe usedkeyCodesixteenIslamic#000000entire widely active (typeofone cancolor =speakerextendsPhysicsterrain<tbody>funeralviewingmiddle cricketprophetshifteddoctorsRussell targetcompactalgebrasocial-bulk ofman and</td>
+ he left).val()false);logicalbankinghome tonaming Arizonacredits);
+});
+founderin turnCollinsbefore But thechargedTitle">CaptainspelledgoddessTag -->Adding:but wasRecent patientback in=false&Lincolnwe knowCounterJudaismscript altered']);
+  has theunclearEvent',both innot all
+
+<!-- placinghard to centersort ofclientsstreetsBernardassertstend tofantasydown inharbourFreedomjewelry/about..searchlegendsis mademodern only ononly toimage" linear painterand notrarely acronymdelivershorter00&amp;as manywidth="/* <![Ctitle =of the lowest picked escapeduses ofpeoples PublicMatthewtacticsdamagedway forlaws ofeasy to windowstrong  simple}catch(seventhinfoboxwent topaintedcitizenI don'tretreat. Some ww.");
+bombingmailto:made in. Many carries||{};wiwork ofsynonymdefeatsfavoredopticalpageTraunless sendingleft"><comScorAll thejQuery.touristClassicfalse" Wilhelmsuburbsgenuinebishops.split(global followsbody ofnominalContactsecularleft tochiefly-hidden-banner</li>
+
+. When in bothdismissExplorealways via thespañolwelfareruling arrangecaptainhis sonrule ofhe tookitself,=0&amp;(calledsamplesto makecom/pagMartin Kennedyacceptsfull ofhandledBesides//--></able totargetsessencehim to its by common.mineralto takeways tos.org/ladvisedpenaltysimple:if theyLettersa shortHerbertstrikes groups.lengthflightsoverlapslowly lesser social </p>
+		it intoranked rate oful>

+  attemptpair ofmake itKontaktAntoniohaving ratings activestreamstrapped").css(hostilelead tolittle groups,Picture-->

+

+ rows=" objectinverse<footerCustomV><\/scrsolvingChamberslaverywoundedwhereas!= 'undfor allpartly -right:Arabianbacked centuryunit ofmobile-Europe,is homerisk ofdesiredClintoncost ofage of become none ofp&quot;Middle ead')[0Criticsstudios>&copy;group">assemblmaking pressedwidget.ps:" ? rebuiltby someFormer editorsdelayedCanonichad thepushingclass="but arepartialBabylonbottom carrierCommandits useAs withcoursesa thirddenotesalso inHouston20px;">accuseddouble goal ofFamous ).bind(priests Onlinein Julyst + "gconsultdecimalhelpfulrevivedis veryr'+'iptlosing femalesis alsostringsdays ofarrivalfuture <objectforcingString(" />
+		here isencoded.  The balloondone by/commonbgcolorlaw of Indianaavoidedbut the2px 3pxjquery.after apolicy.men andfooter-= true;for usescreen.Indian image =family,http:// &nbsp;driverseternalsame asnoticedviewers})();
+ is moreseasonsformer the newis justconsent Searchwas thewhy theshippedbr><br>width: height=made ofcuisineis thata very Admiral fixed;normal MissionPress, ontariocharsettry to invaded="true"spacingis mosta more totallyfall of});

+  immensetime inset outsatisfyto finddown tolot of Playersin Junequantumnot thetime todistantFinnishsrc = (single help ofGerman law andlabeledforestscookingspace">header-well asStanleybridges/globalCroatia About [0];
+  it, andgroupedbeing a){throwhe madelighterethicalFFFFFF"bottom"like a employslive inas seenprintermost ofub-linkrejectsand useimage">succeedfeedingNuclearinformato helpWomen'sNeitherMexicanprotein<table by manyhealthylawsuitdevised.push({sellerssimply Through.cookie Image(older">us.js"> Since universlarger open to!-- endlies in']);

+  marketwho is ("DOMComanagedone fortypeof Kingdomprofitsproposeto showcenter;made itdressedwere inmixtureprecisearisingsrc = 'make a securedBaptistvoting 
+		var March 2grew upClimate.removeskilledway the</head>face ofacting right">to workreduceshas haderectedshow();action=book ofan area== "htt<header
+<html>conformfacing cookie.rely onhosted .customhe wentbut forspread Family a meansout theforums.footage">MobilClements" id="as highintense--><!--female is seenimpliedset thea stateand hisfastestbesidesbutton_bounded"><img Infoboxevents,a youngand areNative cheaperTimeoutand hasengineswon the(mostlyright: find a -bottomPrince area ofmore ofsearch_nature,legallyperiod,land ofor withinducedprovingmissilelocallyAgainstthe wayk&quot;px;">

+pushed abandonnumeralCertainIn thismore inor somename isand, incrownedISBN 0-createsOctobermay notcenter late inDefenceenactedwish tobroadlycoolingonload=it. TherecoverMembersheight assumes<html>
+people.in one =windowfooter_a good reklamaothers,to this_cookiepanel">London,definescrushedbaptismcoastalstatus title" move tolost inbetter impliesrivalryservers SystemPerhapses and contendflowinglasted rise inGenesisview ofrising seem tobut in backinghe willgiven agiving cities.flow of Later all butHighwayonly bysign ofhe doesdiffersbattery&amp;lasinglesthreatsintegertake onrefusedcalled =US&ampSee thenativesby thissystem.head of:hover,lesbiansurnameand allcommon/header__paramsHarvard/pixel.removalso longrole ofjointlyskyscraUnicodebr />

+AtlantanucleusCounty,purely count">easily build aonclicka givenpointerh&quot;events else {
+ditionsnow the, with man whoorg/Webone andcavalryHe diedseattle00,000 {windowhave toif(windand itssolely m&quot;renewedDetroitamongsteither them inSenatorUs</a><King ofFrancis-produche usedart andhim andused byscoringat hometo haverelatesibilityfactionBuffalolink"><what hefree toCity ofcome insectorscountedone daynervoussquare };if(goin whatimg" alis onlysearch/tuesdaylooselySolomonsexual - <a hrmedium"DO NOT France,with a war andsecond take a >

+

+

+market.highwaydone inctivity"last">obligedrise to"undefimade to Early praisedin its for hisathleteJupiterYahoo! termed so manyreally s. The a woman?value=direct right" bicycleacing="day andstatingRather,higher Office are nowtimes, when a pay foron this-link">;borderaround annual the Newput the.com" takin toa brief(in thegroups.; widthenzymessimple in late{returntherapya pointbanninginks">
+();" rea place\u003Caabout atr>

+		ccount gives a<SCRIPTRailwaythemes/toolboxById("xhumans,watchesin some if (wicoming formats Under but hashanded made bythan infear ofdenoted/iframeleft involtagein eacha&quot;base ofIn manyundergoregimesaction </p>

+<ustomVa;&gt;</importsor thatmostly &amp;re size="</a></ha classpassiveHost = WhetherfertileVarious=[];(fucameras/></td>acts asIn some>

+

+<!organis <br />Beijingcatalàdeutscheuropeueuskaragaeilgesvenskaespañamensajeusuariotrabajoméxicopáginasiempresistemaoctubreduranteañadirempresamomentonuestroprimeratravésgraciasnuestraprocesoestadoscalidadpersonanúmeroacuerdomúsicamiembroofertasalgunospaísesejemploderechoademásprivadoagregarenlacesposiblehotelessevillaprimeroúltimoeventosarchivoculturamujeresentradaanuncioembargomercadograndesestudiomejoresfebrerodiseñoturismocódigoportadaespaciofamiliaantoniopermiteguardaralgunaspreciosalguiensentidovisitastítuloconocersegundoconsejofranciaminutossegundatenemosefectosmálagasesiónrevistagranadacompraringresogarcíaacciónecuadorquienesinclusodeberámateriahombresmuestrapodríamañanaúltimaestamosoficialtambienningúnsaludospodemosmejorarpositionbusinesshomepagesecuritylanguagestandardcampaignfeaturescategoryexternalchildrenreservedresearchexchangefavoritetemplatemilitaryindustryservicesmaterialproductsz-index:commentssoftwarecompletecalendarplatformarticlesrequiredmovementquestionbuildingpoliticspossiblereligionphysicalfeedbackregisterpicturesdisabledprotocolaudiencesettingsactivityelementslearninganythingabstractprogressoverviewmagazineeconomictrainingpressurevarious <strong>propertyshoppingtogetheradvancedbehaviordownloadfeaturedfootballselectedLanguagedistanceremembertrackingpasswordmodifiedstudentsdirectlyfightingnortherndatabasefestivalbreakinglocationinternetdropdownpracticeevidencefunctionmarriageresponseproblemsnegativeprogramsanalysisreleasedbanner">purchasepoliciesregionalcreativeargumentbookmarkreferrerchemicaldivisioncallbackseparateprojectsconflicthardwareinterestdeliverymountainobtained= false;for(var acceptedcapacitycomputeridentityaircraftemployedproposeddomesticincludesprovidedhospitalverticalcollapseapproachpartnerslogo"><adaughterauthor" culturalfamilies/images/assemblypowerfulteachingfinisheddistrictcriticalcgi-bin/purposesrequireselectionbecomingprovidesacademicexerciseactuallymedicineconstantaccidentMagazinedocumentstartingbottom">observed: &quot;extendedpreviousSoftwarecustomerdecisionstrengthdetailedslightlyplanningtextareacurrencyeveryonestraighttransferpositiveproducedheritageshippingabsolutereceivedrelevantbutton" violenceanywherebenefitslaunchedrecentlyalliancefollowedmultiplebulletinincludedoccurredinternal$(this).republic><tr><tdcongressrecordedultimatesolution<ul id="discoverHome</a>websitesnetworksalthoughentirelymemorialmessagescontinueactive">somewhatvictoriaWestern  title="LocationcontractvisitorsDownloadwithout right">
+measureswidth = variableinvolvedvirginianormallyhappenedaccountsstandingnationalRegisterpreparedcontrolsaccuratebirthdaystrategyofficialgraphicscriminalpossiblyconsumerPersonalspeakingvalidateachieved.jpg" />machines</h2>
+  keywordsfriendlybrotherscombinedoriginalcomposedexpectedadequatepakistanfollow" valuable</label>relativebringingincreasegovernorplugins/List of Header">" name=" (&quot;graduate</head>
+commercemalaysiadirectormaintain;height:schedulechangingback to catholicpatternscolor: #greatestsuppliesreliable</ul>
+		<select citizensclothingwatching<li id="specificcarryingsentence<center>contrastthinkingcatch(e)southernMichael merchantcarouselpadding:interior.split("lizationOctober ){returnimproved--&gt;
+
+coveragechairman.png" />subjectsRichard whateverprobablyrecoverybaseballjudgmentconnect..css" /> websitereporteddefault"/></a>

+electricscotlandcreationquantity. ISBN 0did not instance-search-" lang="speakersComputercontainsarchivesministerreactiondiscountItalianocriteriastrongly: 'http:'script'coveringofferingappearedBritish identifyFacebooknumerousvehiclesconcernsAmericanhandlingdiv id="William provider_contentaccuracysection andersonflexibleCategorylawrence<script>layout="approved maximumheader"></table>Serviceshamiltoncurrent canadianchannels/themes//articleoptionalportugalvalue=""intervalwirelessentitledagenciesSearch" measuredthousandspending&hellip;new Date" size="pageNamemiddle" " /></a>hidden">sequencepersonaloverflowopinionsillinoislinks">
+	<title>versionssaturdayterminalitempropengineersectionsdesignerproposal="false"Españolreleasessubmit" er&quot;additionsymptomsorientedresourceright"><pleasurestationshistory.leaving  border=contentscenter">.
+
+Some directedsuitablebulgaria.show();designedGeneral conceptsExampleswilliamsOriginal"><span>search">operatorrequestsa &quot;allowingDocumentrevision. 
+
+The yourselfContact michiganEnglish columbiapriorityprintingdrinkingfacilityreturnedContent officersRussian generate-8859-1"indicatefamiliar qualitymargin:0 contentviewportcontacts-title">portable.length eligibleinvolvesatlanticonload="default.suppliedpaymentsglossary
+
+After guidance</td><tdencodingmiddle">came to displaysscottishjonathanmajoritywidgets.clinicalthailandteachers<head>
+	affectedsupportspointer;toString</small>oklahomawill be investor0" alt="holidaysResourcelicensed (which . After considervisitingexplorerprimary search" android"quickly meetingsestimate;return ;color:# height=approval, &quot; checked.min.js"magnetic></a></hforecast. While thursdaydvertise&eacute;hasClassevaluateorderingexistingpatients Online coloradoOptions"campbell<!-- end</span><<br />

+_popups|sciences,&quot; quality Windows assignedheight: <b classle&quot; value=" Companyexamples<iframe believespresentsmarshallpart of properly).
+
+The taxonomymuch of </span>
+" data-srtuguêsscrollTo project<head>

+attorneyemphasissponsorsfancyboxworld's wildlifechecked=sessionsprogrammpx;font- Projectjournalsbelievedvacationthompsonlightingand the special border=0checking</tbody><button Completeclearfix
+<head>
+article <sectionfindingsrole in popular  Octoberwebsite exposureused to  changesoperatedclickingenteringcommandsinformed numbers  </div>creatingonSubmitmarylandcollegesanalyticlistingscontact.loggedInadvisorysiblingscontent"s&quot;)s. This packagescheckboxsuggestspregnanttomorrowspacing=icon.pngjapanesecodebasebutton">gamblingsuch as , while </span> missourisportingtop:1px .</span>tensionswidth="2lazyloadnovemberused in height="cript">
+&nbsp;</<tr><td height:2/productcountry include footer" &lt;!-- title"></jquery.</form>
+(简体)(�體)hrvatskiitalianoromânătürkçeاردوtambiénnoticiasmensajespersonasderechosnacionalserviciocontactousuariosprogramagobiernoempresasanunciosvalenciacolombiadespuésdeportesproyectoproductopúbliconosotroshistoriapresentemillonesmediantepreguntaanteriorrecursosproblemasantiagonuestrosopiniónimprimirmientrasaméricavendedorsociedadrespectorealizarregistropalabrasinterésentoncesespecialmiembrosrealidadcórdobazaragozapáginassocialesbloqueargestiónalquilersistemascienciascompletoversióncompletaestudiospúblicaobjetivoalicantebuscadorcantidadentradasaccionesarchivossuperiormayoríaalemaniafunciónúltimoshaciendoaquellosediciónfernandoambientefacebooknuestrasclientesprocesosbastantepresentareportarcongresopublicarcomerciocontratojóvenesdistritotécnicaconjuntoenergíatrabajarasturiasrecienteutilizarboletínsalvadorcorrectatrabajosprimerosnegocioslibertaddetallespantallapróximoalmeríaanimalesquiénescorazónsecciónbuscandoopcionesexteriorconceptotodavíagaleríaescribirmedicinalicenciaconsultaaspectoscríticadólaresjusticiadeberánperíodonecesitamantenerpequeñorecibidatribunaltenerifecancióncanariasdescargadiversosmallorcarequieretécnicodeberíaviviendafinanzasadelantefuncionaconsejosdifícilciudadesantiguasavanzadatérminounidadessánchezcampañasoftonicrevistascontienesectoresmomentosfacultadcréditodiversassupuestofactoressegundospequeñaгодае�лие�тьбылобыть�томЕ�литогомен�в�ех�тойдажебылигодудень�тотбыла�еб�один�ебенадо�айтфотонего�вои�войигрытожев�ем�воюлишь�тихпокаднейдомамиралиботемухот�двух�етилюдиделомиретеб��воевидечего�тим�четтемыцены�талведьтемеводытебевышенамитипатомуправлицаоднагодызнаюмогудругв�ейидеткиноодноделаделе�рокиюн�ве�ьЕ�тьразанашиاللهالتيجميعخاصةالذيعليهجديدالآنالردتحكمص�حةكانتاللييكونشبكة�يهابناتحواءأكثرخلالالحبدليلدروساضغطتكونهناكساحةناديالطبعليكشكرايمكنمنهاشركةرئيسنشيطماذاال�نشبابتعبررحمةكا�ةيقولمركزكلمةأحمدقلبييعنيصورةطريقشاركجوالأخرىمعناابحثعروضبشكلمسجلبنانخالدكتابكليةبدونأيضايوجد�ريقكتبتأ�ضلمطبخاكثرباركا�ضلاحلىن�سهأيامردودأنهاديناالانمعرضتعلمداخلممكن
+


+	ÿÿÿÿ
+statementattentionBiography} else {
+solutionswhen the Analyticstemplatesdangeroussatellitedocumentspublisherimportantprototypeinfluence&raquo;</effectivegenerallytransformbeautifultransportorganizedpublishedprominentuntil thethumbnailNational .focus();over the migrationannouncedfooter">
+exceptionless thanexpensiveformationframeworkterritoryndicationcurrentlyclassNamecriticismtraditionelsewhereAlexanderappointedmaterialsbroadcastmentionedaffiliate</option>treatmentdifferent/default.Presidentonclick="biographyotherwisepermanentFrançaisHollywoodexpansionstandards</style>
+reductionDecember preferredCambridgeopponentsBusiness confusion>
+<title>presentedexplaineddoes not worldwideinterfacepositionsnewspaper</table>
+mountainslike the essentialfinancialselectionaction="/abandonedEducationparseInt(stabilityunable to</title>
+relationsNote thatefficientperformedtwo yearsSince thethereforewrapper">alternateincreasedBattle ofperceivedtrying tonecessaryportrayedelectionsElizabeth</iframe>discoveryinsurances.length;legendaryGeographycandidatecorporatesometimesservices.inherited</strong>CommunityreligiouslocationsCommitteebuildingsthe worldno longerbeginningreferencecannot befrequencytypicallyinto the relative;recordingpresidentinitiallytechniquethe otherit can beexistenceunderlinethis timetelephoneitemscopepracticesadvantage);return For otherprovidingdemocracyboth the extensivesufferingsupportedcomputers functionpracticalsaid thatit may beEnglish</from the scheduleddownloads</label>
+suspectedmargin: 0spiritual</head>
+
+microsoftgraduallydiscussedhe becameexecutivejquery.jshouseholdconfirmedpurchasedliterallydestroyedup to thevariationremainingit is notcenturiesJapanese among thecompletedalgorithminterestsrebellionundefinedencourageresizableinvolvingsensitiveuniversalprovision(althoughfeaturingconducted), which continued-header">February numerous overflow:componentfragmentsexcellentcolspan="technicalnear the Advanced source ofexpressedHong Kong Facebookmultiple mechanismelevationoffensive</form>
+	sponsoreddocument.or &quot;there arethose whomovementsprocessesdifficultsubmittedrecommendconvincedpromoting" width=".replace(classicalcoalitionhis firstdecisionsassistantindicatedevolution-wrapper"enough toalong thedelivered-->

+<!--American protectedNovember </style><furnitureInternet  onblur="suspendedrecipientbased on Moreover,abolishedcollectedwere madeemotionalemergencynarrativeadvocatespx;bordercommitteddir="ltr"employeesresearch. selectedsuccessorcustomersdisplayedSeptemberaddClass(Facebook suggestedand lateroperatingelaborateSometimesInstitutecertainlyinstalledfollowersJerusalemthey havecomputinggeneratedprovincesguaranteearbitraryrecognizewanted topx;width:theory ofbehaviourWhile theestimatedbegan to it becamemagnitudemust havemore thanDirectoryextensionsecretarynaturallyoccurringvariablesgiven theplatform.</label><failed tocompoundskinds of societiesalongside --&gt;
+
+southwestthe rightradiationmay have unescape(spoken in" href="/programmeonly the come fromdirectoryburied ina similarthey were</font></Norwegianspecifiedproducingpassenger(new DatetemporaryfictionalAfter theequationsdownload.regularlydeveloperabove thelinked tophenomenaperiod oftooltip">substanceautomaticaspect ofAmong theconnectedestimatesAir Forcesystem ofobjectiveimmediatemaking itpaintingsconqueredare stillproceduregrowth ofheaded byEuropean divisionsmoleculesfranchiseintentionattractedchildhoodalso useddedicatedsingaporedegree offather ofconflicts</a></p>
+came fromwere usednote thatreceivingExecutiveeven moreaccess tocommanderPoliticalmusiciansdeliciousprisonersadvent ofUTF-8" /><![CDATA[">ContactSouthern bgcolor="series of. It was in Europepermittedvalidate.appearingofficialsseriously-languageinitiatedextendinglong-terminflationsuch thatgetCookiemarked by</button>implementbut it isincreasesdown the requiringdependent-->
+<!-- interviewWith the copies ofconsensuswas builtVenezuela(formerlythe statepersonnelstrategicfavour ofinventionWikipediacontinentvirtuallywhich wasprincipleComplete identicalshow thatprimitiveaway frommolecularpreciselydissolvedUnder theversion=">&nbsp;</It is the This is will haveorganismssome timeFriedrichwas firstthe only fact thatform id="precedingTechnicalphysicistoccurs innavigatorsection">span id="sought tobelow thesurviving}</style>his deathas in thecaused bypartiallyexisting using thewas givena list oflevels ofnotion ofOfficial dismissedscientistresemblesduplicateexplosiverecoveredall othergalleries{padding:people ofregion ofaddressesassociateimg alt="in modernshould bemethod ofreportingtimestampneeded tothe Greatregardingseemed toviewed asimpact onidea thatthe Worldheight ofexpandingThese arecurrent">carefullymaintainscharge ofClassicaladdressedpredictedownership<div id="right">

+residenceleave thecontent">are often  })();

+probably Professor-button" respondedsays thathad to beplaced inHungarianstatus ofserves asUniversalexecutionaggregatefor whichinfectionagreed tohowever, popular">placed onconstructelectoralsymbol ofincludingreturn toarchitectChristianprevious living ineasier toprofessor
+&lt;!-- effect ofanalyticswas takenwhere thetook overbelief inAfrikaansas far aspreventedwork witha special<fieldsetChristmasRetrieved
+
+In the back intonortheastmagazines><strong>committeegoverninggroups ofstored inestablisha generalits firsttheir ownpopulatedan objectCaribbeanallow thedistrictswisconsinlocation.; width: inhabitedSocialistJanuary 1</footer>similarlychoice ofthe same specific business The first.length; desire todeal withsince theuserAgentconceivedindex.phpas &quot;engage inrecently,few yearswere also
+<head>
+<edited byare knowncities inaccesskeycondemnedalso haveservices,family ofSchool ofconvertednature of languageministers</object>there is a popularsequencesadvocatedThey wereany otherlocation=enter themuch morereflectedwas namedoriginal a typicalwhen theyengineerscould notresidentswednesdaythe third productsJanuary 2what theya certainreactionsprocessorafter histhe last contained"></div>
+</a></td>depend onsearch">
+pieces ofcompetingReferencetennesseewhich has version=</span> <</header>gives thehistorianvalue="">padding:0view thattogether,the most was foundsubset ofattack onchildren,points ofpersonal position:allegedlyClevelandwas laterand afterare givenwas stillscrollingdesign ofmakes themuch lessAmericans.
+
+After , but theMuseum oflouisiana(from theminnesotaparticlesa processDominicanvolume ofreturningdefensive00px|righmade frommouseover" style="states of(which iscontinuesFranciscobuilding without awith somewho woulda form ofa part ofbefore itknown as  Serviceslocation and oftenmeasuringand it ispaperbackvalues of

+<title>= window.determineer&quot; played byand early</center>from thisthe threepower andof &quot;innerHTML<a href="y:inline;Church ofthe eventvery highofficial -height: content="/cgi-bin/to createafrikaansesperantofrançaislatviešulietuviųČeština�eštinaไทย日本語简体字�體字한국어为什么计算机笔记本討論��务器互�网房地产俱�部出版社排行榜部�格进一步支付�验��委员会数�库消费者办公室讨论区深圳市播放器北京市大学生越�越管�员信�网serviciosartículoargentinabarcelonacualquierpublicadoproductospolíticarespuestawikipediasiguientebúsquedacomunidadseguridadprincipalpreguntascontenidorespondervenezuelaproblemasdiciembrerelaciónnoviembresimilaresproyectosprogramasinstitutoactividadencuentraeconomíaimágenescontactardescargarnecesarioatenciónteléfonocomisióncancionescapacidadencontraranálisisfavoritostérminosprovinciaetiquetaselementosfuncionesresultadocarácterpropiedadprincipionecesidadmunicipalcreacióndescargaspresenciacomercialopinionesejercicioeditorialsalamancagonzálezdocumentopelícularecientesgeneralestarragonaprácticanovedadespropuestapacientestécnicasobjetivoscontactosमेंलि�हैंगयासाथ�वंरहेकोईक�छरहाबादकहासभीह��रहीमैंदिनबातdiplodocsसमयरूपनामपताफिरऔसततरहलोगह�आबारदेशह�ईखेलयदिकामवेबतीनबीचमौतसाललेखजॉबमददतथानहीशहरअलगकभीनगरपासरातकि�उसेगयीहू�आगेटीमखोजकारअभीगयेत�मवोटदेंअगर�सेमेललगाहालऊपरचार�सादेरजिसदिलबंदबनाहूंलाखजीतबटनमिलइसेआनेनयाक�ललॉगभागरेलजगहरामलगेपेजहाथइसीसहीकलाठीकहा�दूरतहतसातयादआयापाककौनशामदेखयहीरायख�दलगीcategoriesexperience</title>

+Copyright javascriptconditionseverything<p class="technologybackground<a class="management&copy; 201javaScriptcharactersbreadcrumbthemselveshorizontalgovernmentCaliforniaactivitiesdiscoveredNavigationtransitionconnectionnavigationappearance</title><mcheckbox" techniquesprotectionapparentlyas well asunt', 'UA-resolutionoperationstelevisiontranslatedWashingtonnavigator. = window.impression&lt;br&gt;literaturepopulationbgcolor="#especially content="productionnewsletterpropertiesdefinitionleadershipTechnologyParliamentcomparisonul class=".indexOf("conclusiondiscussioncomponentsbiologicalRevolution_containerunderstoodnoscript><permissioneach otheratmosphere onfocus="<form id="processingthis.valuegenerationConferencesubsequentwell-knownvariationsreputationphenomenondisciplinelogo.png" (document,boundariesexpressionsettlementBackgroundout of theenterprise("https:" unescape("password" democratic<a href="/wrapper">
+membershiplinguisticpx;paddingphilosophyassistanceuniversityfacilitiesrecognizedpreferenceif (typeofmaintainedvocabularyhypothesis.submit();&amp;nbsp;annotationbehind theFoundationpublisher"assumptionintroducedcorruptionscientistsexplicitlyinstead ofdimensions onClick="considereddepartmentoccupationsoon afterinvestmentpronouncedidentifiedexperimentManagementgeographic" height="link rel=".replace(/depressionconferencepunishmenteliminatedresistanceadaptationoppositionwell knownsupplementdeterminedh1 class="0px;marginmechanicalstatisticscelebratedGovernment
+
+During tdevelopersartificialequivalentoriginatedCommissionattachment<span id="there wereNederlandsbeyond theregisteredjournalistfrequentlyall of thelang="en" </style>

+absolute; supportingextremely mainstream</strong> popularityemployment</table>

+ colspan="</form>
+  conversionabout the </p></div>integrated" lang="enPortuguesesubstituteindividualimpossiblemultimediaalmost allpx solid #apart fromsubject toin Englishcriticizedexcept forguidelinesoriginallyremarkablethe secondh2 class="<a title="(includingparametersprohibited= "http://dictionaryperceptionrevolutionfoundationpx;height:successfulsupportersmillenniumhis fatherthe &quot;no-repeat;commercialindustrialencouragedamount of unofficialefficiencyReferencescoordinatedisclaimerexpeditiondevelopingcalculatedsimplifiedlegitimatesubstring(0" class="completelyillustratefive yearsinstrumentPublishing1" class="psychologyconfidencenumber of absence offocused onjoined thestructurespreviously></iframe>once againbut ratherimmigrantsof course,a group ofLiteratureUnlike the</a>&nbsp;
+function it was theConventionautomobileProtestantaggressiveafter the Similarly," /></div>collection

+functionvisibilitythe use ofvolunteersattractionunder the threatened*<![CDATA[importancein generalthe latter</form>
+</.indexOf('i = 0; i <differencedevoted totraditionssearch forultimatelytournamentattributesso-called }
+</style>evaluationemphasizedaccessible</section>successionalong withMeanwhile,industries</a><br />has becomeaspects ofTelevisionsufficientbasketballboth sidescontinuingan article<img alt="adventureshis mothermanchesterprinciplesparticularcommentaryeffects ofdecided to"><strong>publishersJournal ofdifficultyfacilitateacceptablestyle.css"	function innovation>Copyrightsituationswould havebusinessesDictionarystatementsoften usedpersistentin Januarycomprising</title>
+	diplomaticcontainingperformingextensionsmay not beconcept of onclick="It is alsofinancial making theLuxembourgadditionalare calledengaged in"script");but it waselectroniconsubmit="
+<!-- End electricalofficiallysuggestiontop of theunlike theAustralianOriginallyreferences
+</head>

+recognisedinitializelimited toAlexandriaretirementAdventuresfour years
+
+&lt;!-- increasingdecorationh3 class="origins ofobligationregulationclassified(function(advantagesbeing the historians<base hrefrepeatedlywilling tocomparabledesignatednominationfunctionalinside therevelationend of thes for the authorizedrefused totake placeautonomouscompromisepolitical restauranttwo of theFebruary 2quality ofswfobject.understandnearly allwritten byinterviews" width="1withdrawalfloat:leftis usuallycandidatesnewspapersmysteriousDepartmentbest knownparliamentsuppressedconvenientremembereddifferent systematichas led topropagandacontrolledinfluencesceremonialproclaimedProtectionli class="Scientificclass="no-trademarksmore than widespreadLiberationtook placeday of theas long asimprisonedAdditional
+<head>
+<mLaboratoryNovember 2exceptionsIndustrialvariety offloat: lefDuring theassessmenthave been deals withStatisticsoccurrence/ul></div>clearfix">the publicmany yearswhich wereover time,synonymouscontent">
+presumablyhis familyuserAgent.unexpectedincluding challengeda minorityundefined"belongs totaken fromin Octoberposition: said to bereligious Federation rowspan="only a fewmeant thatled to the-->

+<div <fieldset>Archbishop class="nobeing usedapproachesprivilegesnoscript>
+results inmay be theEaster eggmechanismsreasonablePopulationCollectionselected">noscript>
/index.phparrival of-jssdk'));managed toincompletecasualtiescompletionChristiansSeptember arithmeticproceduresmight haveProductionit appearsPhilosophyfriendshipleading togiving thetoward theguaranteeddocumentedcolor:#000video gamecommissionreflectingchange theassociatedsans-serifonkeypress; padding:He was theunderlyingtypically , and the srcElementsuccessivesince the should be networkingaccountinguse of thelower thanshows that</span>
+		complaintscontinuousquantitiesastronomerhe did notdue to itsapplied toan averageefforts tothe futureattempt toTherefore,capabilityRepublicanwas formedElectronickilometerschallengespublishingthe formerindigenousdirectionssubsidiaryconspiracydetails ofand in theaffordablesubstancesreason forconventionitemtype="absolutelysupposedlyremained aattractivetravellingseparatelyfocuses onelementaryapplicablefound thatstylesheetmanuscriptstands for no-repeat(sometimesCommercialin Americaundertakenquarter ofan examplepersonallyindex.php?</button>
+percentagebest-knowncreating a" dir="ltrLieutenant
+<div id="they wouldability ofmade up ofnoted thatclear thatargue thatto anotherchildren'spurpose offormulatedbased uponthe regionsubject ofpassengerspossession.
+
+In the Before theafterwardscurrently across thescientificcommunity.capitalismin Germanyright-wingthe systemSociety ofpoliticiandirection:went on toremoval of New York apartmentsindicationduring theunless thehistoricalhad been adefinitiveingredientattendanceCenter forprominencereadyStatestrategiesbut in theas part ofconstituteclaim thatlaboratorycompatiblefailure of, such as began withusing the to providefeature offrom which/" class="geologicalseveral ofdeliberateimportant holds thating&quot; valign=topthe Germanoutside ofnegotiatedhis careerseparationid="searchwas calledthe fourthrecreationother thanpreventionwhile the education,connectingaccuratelywere builtwas killedagreementsmuch more Due to thewidth: 100some otherKingdom ofthe entirefamous forto connectobjectivesthe Frenchpeople andfeatured">is said tostructuralreferendummost oftena separate->
+<div id Official worldwide.aria-labelthe planetand it wasd" value="looking atbeneficialare in themonitoringreportedlythe modernworking onallowed towhere the innovative</a></div>soundtracksearchFormtend to beinput id="opening ofrestrictedadopted byaddressingtheologianmethods ofvariant ofChristian very largeautomotiveby far therange frompursuit offollow thebrought toin Englandagree thataccused ofcomes frompreventingdiv style=his or hertremendousfreedom ofconcerning0 1em 1em;Basketball/style.cssan earliereven after/" title=".com/indextaking thepittsburghcontent">
<script>(fturned outhaving the</span>

+ occasionalbecause itstarted tophysically></div>
+  created byCurrently, bgcolor="tabindex="disastrousAnalytics also has a><div id="</style>
+<called forsinger and.src = "//violationsthis pointconstantlyis locatedrecordingsd from thenederlandsportuguêsעברית�ارسیdesarrollocomentarioeducaciónseptiembreregistradodirecciónubicaciónpublicidadrespuestasresultadosimportantereservadosartículosdiferentessiguientesrepúblicasituaciónministerioprivacidaddirectorioformaciónpoblaciónpresidentecontenidosaccesoriostechnoratipersonalescategoríaespecialesdisponibleactualidadreferenciavalladolidbibliotecarelacionescalendariopolíticasanterioresdocumentosnaturalezamaterialesdiferenciaeconómicatransporterodríguezparticiparencuentrandiscusiónestructurafundaciónfrecuentespermanentetotalmenteможнобудетможетврем�такжечтобыболееочень�тогокогдапо�лев�его�айтечерезмогут�айтажизнимеждубудутПои�кзде�ьвидео�в�зинужно�воейлюдейпорномногодетей�воихправатакойме�тоимеетжизньоднойлучшепередча�тича�тьработновыхправо�обойпотомменеечи�леновыеу�лугоколоназадтакоетогдапочтиПо�летакиеновый�тоиттаких�разуСанктфорумКогдакниги�лованашейнайти�воим�в�зьлюбойча�то�редиКромеФорумрынке�талипои�кты��чме��ццентртруда�амыхрынка�овыйча�овме�тафильммарта�транме�тетек�тнашихминутимениимеютномергород�амом�томуконце�воемкакой�рхивمنتدىإرسالرسالةالعامكتبهابرامجاليومالصورجديدةالعضوإضا�ةالقسمالعابتحميلمل�اتملتقىتعديلالشعرأخبارتطويرعليكمإر�اقطلباتاللغةترتيبالناسالشيخمنتديالعربالقصصا�لامعليهاتحديثاللهمالعملمكتبةيمكنكالط�ل�يديوإدارةتاريخالصحةتسجيلالوقتعندمامدينةتصميمأرشي�الذينعربيةبوابةألعابالس�رمشاكلتعالىالأولالسنةجامعةالصح�الدينكلماتالخاصالمل�أعضاءكتابةالخيررسائلالقلبالأدبمقاطعمراسلمنطقةالكتبالرجلاشتركالقدميعطيكsByTagName(.jpg" alt="1px solid #.gif" alt="transparentinformationapplication" onclick="establishedadvertising.png" alt="environmentperformanceappropriate&amp;mdash;immediately</strong></rather thantemperaturedevelopmentcompetitionplaceholdervisibility:copyright">0" height="even thoughreplacementdestinationCorporation<ul class="AssociationindividualsperspectivesetTimeout(url(http://mathematicsmargin-top:eventually description) no-repeatcollections.JPG|thumb|participate/head><bodyfloat:left;<li class="hundreds of
+
+However, compositionclear:both;cooperationwithin the label for="border-top:New Zealandrecommendedphotographyinteresting&lt;sup&gt;controversyNetherlandsalternativemaxlength="switzerlandDevelopmentessentially
+
+Although </textarea>thunderbirdrepresented&amp;ndash;speculationcommunitieslegislationelectronics
+	<div id="illustratedengineeringterritoriesauthoritiesdistributed6" height="sans-serif;capable of disappearedinteractivelooking forit would beAfghanistanwas createdMath.floor(surroundingcan also beobservationmaintenanceencountered<h2 class="more recentit has beeninvasion of).getTime()fundamentalDespite the"><div id="inspirationexaminationpreparationexplanation<input id="</a></span>versions ofinstrumentsbefore the  = 'http://Descriptionrelatively .substring(each of theexperimentsinfluentialintegrationmany peopledue to the combinationdo not haveMiddle East<noscript><copyright" perhaps theinstitutionin Decemberarrangementmost famouspersonalitycreation oflimitationsexclusivelysovereignty-content">
+<td class="undergroundparallel todoctrine ofoccupied byterminologyRenaissancea number ofsupport forexplorationrecognitionpredecessor<img src="/<h1 class="publicationmay also bespecialized</fieldset>progressivemillions ofstates thatenforcementaround the one another.parentNodeagricultureAlternativeresearcherstowards theMost of themany other (especially<td width=";width:100%independent<h3 class=" onchange=").addClass(interactionOne of the daughter ofaccessoriesbranches of

+<div id="the largestdeclarationregulationsInformationtranslationdocumentaryin order to">
+<head>
+<" height="1across the orientation);</script>implementedcan be seenthere was ademonstratecontainer">connectionsthe Britishwas written!important;px; margin-followed byability to complicatedduring the immigrationalso called<h4 class="distinctionreplaced bygovernmentslocation ofin Novemberwhether the</p>
+</div>acquisitioncalled the persecutiondesignation{font-size:appeared ininvestigateexperiencedmost likelywidely useddiscussionspresence of (document.extensivelyIt has beenit does notcontrary toinhabitantsimprovementscholarshipconsumptioninstructionfor exampleone or morepx; paddingthe currenta series ofare usuallyrole in thepreviously derivativesevidence ofexperiencescolorschemestated thatcertificate</a></div>
+ selected="high schoolresponse tocomfortableadoption ofthree yearsthe countryin Februaryso that thepeople who provided by<param nameaffected byin terms ofappointmentISO-8859-1"was born inhistorical regarded asmeasurementis based on and other : function(significantcelebrationtransmitted/js/jquery.is known astheoretical tabindex="it could be<noscript>
+having been

+<head>

+< &quot;The compilationhe had beenproduced byphilosopherconstructedintended toamong othercompared toto say thatEngineeringa differentreferred todifferencesbelief thatphotographsidentifyingHistory of Republic ofnecessarilyprobabilitytechnicallyleaving thespectacularfraction ofelectricityhead of therestaurantspartnershipemphasis onmost recentshare with saying thatfilled withdesigned toit is often"></iframe>as follows:merged withthrough thecommercial pointed outopportunityview of therequirementdivision ofprogramminghe receivedsetInterval"></span></in New Yorkadditional compression
+
+<div id="incorporate;</script><attachEventbecame the " target="_carried outSome of thescience andthe time ofContainer">maintainingChristopherMuch of thewritings of" height="2size of theversion of mixture of between theExamples ofeducationalcompetitive onsubmit="director ofdistinctive/DTD XHTML relating totendency toprovince ofwhich woulddespite thescientific legislature.innerHTML allegationsAgriculturewas used inapproach tointelligentyears later,sans-serifdeterminingPerformanceappearances, which is foundationsabbreviatedhigher thans from the individual composed ofsupposed toclaims thatattributionfont-size:1elements ofHistorical his brotherat the timeanniversarygoverned byrelated to ultimately innovationsit is stillcan only bedefinitionstoGMTStringA number ofimg class="Eventually,was changedoccurred inneighboringdistinguishwhen he wasintroducingterrestrialMany of theargues thatan Americanconquest ofwidespread were killedscreen and In order toexpected todescendantsare locatedlegislativegenerations backgroundmost peopleyears afterthere is nothe highestfrequently they do notargued thatshowed thatpredominanttheologicalby the timeconsideringshort-lived</span></a>can be usedvery littleone of the had alreadyinterpretedcommunicatefeatures ofgovernment,</noscript>entered the" height="3Independentpopulationslarge-scale. Although used in thedestructionpossibilitystarting intwo or moreexpressionssubordinatelarger thanhistory and</option>

+Continentaleliminatingwill not bepractice ofin front ofsite of theensure thatto create amississippipotentiallyoutstandingbetter thanwhat is nowsituated inmeta name="TraditionalsuggestionsTranslationthe form ofatmosphericideologicalenterprisescalculatingeast of theremnants ofpluginspage/index.php?remained intransformedHe was alsowas alreadystatisticalin favor ofMinistry ofmovement offormulationis required<link rel="This is the <a href="/popularizedinvolved inare used toand severalmade by theseems to belikely thatPalestiniannamed afterit had beenmost commonto refer tobut this isconsecutivetemporarilyIn general,conventionstakes placesubdivisionterritorialoperationalpermanentlywas largelyoutbreak ofin the pastfollowing a xmlns:og="><a class="class="textConversion may be usedmanufactureafter beingclearfix">
+question ofwas electedto become abecause of some peopleinspired bysuccessful a time whenmore commonamongst thean officialwidth:100%;technology,was adoptedto keep thesettlementslive birthsindex.html"Connecticutassigned to&amp;times;account foralign=rightthe companyalways beenreturned toinvolvementBecause thethis period" name="q" confined toa result ofvalue="" />is actuallyEnvironment

+</head>

+Conversely,>
+<div id="0" width="1is probablyhave becomecontrollingthe problemcitizens ofpoliticiansreached theas early as:none; over<table cellvalidity ofdirectly toonmousedownwhere it iswhen it wasmembers of relation toaccommodatealong with In the latethe Englishdelicious">this is notthe presentif they areand finallya matter of

+	</div>

+

+</script>faster thanmajority ofafter whichcomparativeto maintainimprove theawarded theer" class="frameborderrestorationin the sameanalysis oftheir firstDuring the continentalsequence offunction(){font-size: work on the</script>
+<begins withjavascript:constituentwas foundedequilibriumassume thatis given byneeds to becoordinatesthe variousare part ofonly in thesections ofis a commontheories ofdiscoveriesassociationedge of thestrength ofposition inpresent-dayuniversallyto form thebut insteadcorporationattached tois commonlyreasons for &quot;the can be madewas able towhich meansbut did notonMouseOveras possibleoperated bycoming fromthe primaryaddition offor severaltransferreda period ofare able tohowever, itshould havemuch larger
+	</script>adopted theproperty ofdirected byeffectivelywas broughtchildren ofProgramminglonger thanmanuscriptswar againstby means ofand most ofsimilar to proprietaryoriginatingprestigiousgrammaticalexperience.to make theIt was alsois found incompetitorsin the U.S.replace thebrought thecalculationfall of thethe generalpracticallyin honor ofreleased inresidentialand some ofking of thereaction to1st Earl ofculture andprincipally</title>
+  they can beback to thesome of hisexposure toare similarform of theaddFavoritecitizenshippart in thepeople within practiceto continue&amp;minus;approved by the first allowed theand for thefunctioningplaying thesolution toheight="0" in his bookmore than afollows thecreated thepresence in&nbsp;</td>nationalistthe idea ofa characterwere forced class="btndays of thefeatured inshowing theinterest inin place ofturn of thethe head ofLord of thepoliticallyhas its ownEducationalapproval ofsome of theeach other,behavior ofand becauseand anotherappeared onrecorded inblack&quot;may includethe world'scan lead torefers to aborder="0" government winning theresulted in while the Washington,the subjectcity in the></div>

+		reflect theto completebecame moreradioactiverejected bywithout anyhis father,which couldcopy of theto indicatea politicalaccounts ofconstitutesworked wither</a></li>of his lifeaccompaniedclientWidthprevent theLegislativedifferentlytogether inhas severalfor anothertext of thefounded thee with the is used forchanged theusually theplace wherewhereas the> <a href=""><a href="themselves,although hethat can betraditionalrole of theas a resultremoveChilddesigned bywest of theSome peopleproduction,side of thenewslettersused by thedown to theaccepted bylive in theattempts tooutside thefrequenciesHowever, inprogrammersat least inapproximatealthough itwas part ofand variousGovernor ofthe articleturned into><a href="/the economyis the mostmost widelywould laterand perhapsrise to theoccurs whenunder whichconditions.the westerntheory thatis producedthe city ofin which heseen in thethe centralbuilding ofmany of hisarea of theis the onlymost of themany of thethe WesternThere is noextended toStatisticalcolspan=2 |short storypossible totopologicalcritical ofreported toa Christiandecision tois equal toproblems ofThis can bemerchandisefor most ofno evidenceeditions ofelements in&quot;. Thecom/images/which makesthe processremains theliterature,is a memberthe popularthe ancientproblems intime of thedefeated bybody of thea few yearsmuch of thethe work ofCalifornia,served as agovernment.concepts ofmovement in		<div id="it" value="language ofas they areproduced inis that theexplain thediv></div>
+However thelead to the	<a href="/was grantedpeople havecontinuallywas seen asand relatedthe role ofproposed byof the besteach other.Constantinepeople fromdialects ofto revisionwas renameda source ofthe initiallaunched inprovide theto the westwhere thereand similarbetween twois also theEnglish andconditions,that it wasentitled tothemselves.quantity ofransparencythe same asto join thecountry andthis is theThis led toa statementcontrast tolastIndexOfthrough hisis designedthe term isis providedprotect theng</a></li>The currentthe site ofsubstantialexperience,in the Westthey shouldsloven�inacomentariosuniversidadcondicionesactividadesexperienciatecnologíaproducciónpuntuaciónaplicacióncontraseñacategoríasregistrarseprofesionaltratamientoregístratesecretaríaprincipalesprotecciónimportantesimportanciaposibilidadinteresantecrecimientonecesidadessuscribirseasociacióndisponiblesevaluaciónestudiantesresponsableresoluciónguadalajararegistradosoportunidadcomercialesfotografíaautoridadesingenieríatelevisióncompetenciaoperacionesestablecidosimplementeactualmentenavegaciónconformidadline-height:font-family:" : "http://applicationslink" href="specifically//<![CDATA[
+Organizationdistribution0px; height:relationshipdevice-width<div class="<label for="registration</noscript>
+/index.html"window.open( !important;application/independence//www.googleorganizationautocompleterequirementsconservative<form name="intellectualmargin-left:18th centuryan importantinstitutionsabbreviation<img class="organisationcivilization19th centuryarchitectureincorporated20th century-container">most notably/></a></div>notification'undefined')Furthermore,believe thatinnerHTML = prior to thedramaticallyreferring tonegotiationsheadquartersSouth AfricaunsuccessfulPennsylvaniaAs a result,<html lang="&lt;/sup&gt;dealing withphiladelphiahistorically);</script>
+padding-top:experimentalgetAttributeinstructionstechnologiespart of the =function(){subscriptionl.dtd">

+<htgeographicalConstitution', function(supported byagriculturalconstructionpublicationsfont-size: 1a variety of<div style="Encyclopediaiframe src="demonstratedaccomplisheduniversitiesDemographics);</script><dedicated toknowledge ofsatisfactionparticularly</div></div>English (US)appendChild(transmissions. However, intelligence" tabindex="float:right;Commonwealthranging fromin which theat least onereproductionencyclopedia;font-size:1jurisdictionat that time"><a class="In addition,description+conversationcontact withis generallyr" content="representing&lt;math&gt;presentationoccasionally<img width="navigation">compensationchampionshipmedia="all" violation ofreference toreturn true;Strict//EN" transactionsinterventionverificationInformation difficultiesChampionshipcapabilities<![endif]-->}
+</script>
+Christianityfor example,Professionalrestrictionssuggest thatwas released(such as theremoveClass(unemploymentthe Americanstructure of/index.html published inspan class=""><a href="/introductionbelonging toclaimed thatconsequences<meta name="Guide to theoverwhelmingagainst the concentrated,
+.nontouch observations</a>
+</div>
+f (document.border: 1px {font-size:1treatment of0" height="1modificationIndependencedivided intogreater thanachievementsestablishingJavaScript" neverthelesssignificanceBroadcasting>&nbsp;</td>container">
+such as the influence ofa particularsrc='http://navigation" half of the substantial &nbsp;</div>advantage ofdiscovery offundamental metropolitanthe opposite" xml:lang="deliberatelyalign=centerevolution ofpreservationimprovementsbeginning inJesus ChristPublicationsdisagreementtext-align:r, function()similaritiesbody></html>is currentlyalphabeticalis sometimestype="image/many of the flow:hidden;available indescribe theexistence ofall over thethe Internet	<ul class="installationneighborhoodarmed forcesreducing thecontinues toNonetheless,temperatures
+		<a href="close to theexamples of is about the(see below)." id="searchprofessionalis availablethe official		</script>
+
+		<div id="accelerationthrough the Hall of Famedescriptionstranslationsinterference type='text/recent yearsin the worldvery popular{background:traditional some of the connected toexploitationemergence ofconstitutionA History ofsignificant manufacturedexpectations><noscript><can be foundbecause the has not beenneighbouringwithout the added to the	<li class="instrumentalSoviet Unionacknowledgedwhich can bename for theattention toattempts to developmentsIn fact, the<li class="aimplicationssuitable formuch of the colonizationpresidentialcancelBubble Informationmost of the is describedrest of the more or lessin SeptemberIntelligencesrc="http://px; height: available tomanufacturerhuman rightslink href="/availabilityproportionaloutside the astronomicalhuman beingsname of the are found inare based onsmaller thana person whoexpansion ofarguing thatnow known asIn the earlyintermediatederived fromScandinavian</a></div>

+consider thean estimatedthe National<div id="pagresulting incommissionedanalogous toare required/ul>
+</div>
+was based onand became a&nbsp;&nbsp;t" value="" was capturedno more thanrespectivelycontinue to >

+<head>

+<were createdmore generalinformation used for theindependent the Imperialcomponent ofto the northinclude the Constructionside of the would not befor instanceinvention ofmore complexcollectivelybackground: text-align: its originalinto accountthis processan extensivehowever, thethey are notrejected thecriticism ofduring whichprobably thethis article(function(){It should bean agreementaccidentallydiffers fromArchitecturebetter knownarrangementsinfluence onattended theidentical tosouth of thepass throughxml" title="weight:bold;creating thedisplay:nonereplaced the<img src="/ihttps://www.World War IItestimonialsfound in therequired to and that thebetween the was designedconsists of considerablypublished bythe languageConservationconsisted ofrefer to theback to the css" media="People from available onproved to besuggestions"was known asvarieties oflikely to becomprised ofsupport the hands of thecoupled withconnect and border:none;performancesbefore beinglater becamecalculationsoften calledresidents ofmeaning that><li class="evidence forexplanationsenvironments"></a></div>which allowsIntroductiondeveloped bya wide rangeon behalf ofvalign="top"principle ofat the time,</noscript>
said to havein the firstwhile othershypotheticalphilosopherspower of thecontained inperformed byinability towere writtenspan style="input name="the questionintended forrejection ofimplies thatinvented thethe standardwas probablylink betweenprofessor ofinteractionschanging theIndian Ocean class="lastworking with'http://www.years beforeThis was therecreationalentering themeasurementsan extremelyvalue of thestart of the
+</script>
+
+an effort toincrease theto the southspacing="0">sufficientlythe Europeanconverted toclearTimeoutdid not haveconsequentlyfor the nextextension ofeconomic andalthough theare producedand with theinsufficientgiven by thestating thatexpenditures</span></a>
+thought thaton the basiscellpadding=image of thereturning toinformation,separated byassassinateds" content="authority ofnorthwestern</div>
+<div "></div>

+  consultationcommunity ofthe nationalit should beparticipants align="leftthe greatestselection ofsupernaturaldependent onis mentionedallowing thewas inventedaccompanyinghis personalavailable atstudy of theon the otherexecution ofHuman Rightsterms of theassociationsresearch andsucceeded bydefeated theand from thebut they arecommander ofstate of theyears of agethe study of<ul class="splace in thewhere he was<li class="fthere are nowhich becamehe publishedexpressed into which thecommissionerfont-weight:territory ofextensions">Roman Empireequal to theIn contrast,however, andis typicallyand his wife(also called><ul class="effectively evolved intoseem to havewhich is thethere was noan excellentall of thesedescribed byIn practice,broadcastingcharged withreflected insubjected tomilitary andto the pointeconomicallysetTargetingare actuallyvictory over();</script>continuouslyrequired forevolutionaryan effectivenorth of the, which was front of theor otherwisesome form ofhad not beengenerated byinformation.permitted toincludes thedevelopment,entered intothe previousconsistentlyare known asthe field ofthis type ofgiven to thethe title ofcontains theinstances ofin the northdue to theirare designedcorporationswas that theone of thesemore popularsucceeded insupport fromin differentdominated bydesigned forownership ofand possiblystandardizedresponseTextwas intendedreceived theassumed thatareas of theprimarily inthe basis ofin the senseaccounts fordestroyed byat least twowas declaredcould not beSecretary ofappear to bemargin-top:1/^\s+|\s+$/ge){throw e};the start oftwo separatelanguage andwho had beenoperation ofdeath of thereal numbers	<link rel="provided thethe story ofcompetitionsenglish (UK)english (US)МонголСрп�ки�рп�ки�рп�коلعربية正體中文简体中文�体中文有�公�人民政府阿里巴巴社会主义�作系统政策法规informaciónherramientaselectrónicodescripciónclasificadosconocimientopublicaciónrelacionadasinformáticarelacionadosdepartamentotrabajadoresdirectamenteayuntamientomercadoLibrecontáctenoshabitacionescumplimientorestaurantesdisposiciónconsecuenciaelectrónicaaplicacionesdesconectadoinstalaciónrealizaciónutilizaciónenciclopediaenfermedadesinstrumentosexperienciasinstituciónparticularessubcategoriaтолькоРо��ииработыбольшепро�томожетедругих�лучае�ейча�в�егдаРо��и�Мо�кведругиегородавопро�данныхдолжныименноМо�квырублейМо�ква�траныничегоработедолжену�лугитеперьОднакопотомуработуапрел�вообщеодного�воего�татьидругойфорумехорошопротив��ылкакаждыйвла�тигруппывме�теработа�казалпервыйделатьденьгипериодбизне�о�новемоменткупитьдолжнарамкахначалоРаботаТолько�ов�емвторойначала�пи�ок�лужбы�и�темпечатиновогопомощи�айтовпочемупомощьдолжно��ылкибы�троданныемногиепроектСейча�моделитакогоонлайнгородевер�и��транефильмыуровн�разныхи�катьнеделю�нвар�меньшемногихданнойзначитнельз�форумаТеперьме��цазащитыЛучшиеनहींकरनेअपनेकियाकरेंअन�यक�यागाइडबारेकिसीदियापहलेसिंहभारतअपनीवालेसेवाकरतेमेरेहोनेसकतेबह�तसाइटहोगाजानेमिनटकरताकरनाउनकेयहा�सबसेभाषाआपकेलियेश�रूइसकेघंटेमेरीसकतामेरालेकरअधिकअपनासमाजम��ेकारणहोताकड़ीयहांहोटलशब�दलियाजीवनजाताकैसेआपकावालीदेनेपूरीपानीउसकेहोगीबैठकआपकीवर�षगांवआपकोजिलाजानासहमतहमेंउनकीयाहूदर�जसूचीपसंदसवालहोनाहोतीजैसेवापसजनतानेताजारीघायलजिलेनीचेजांचपत�रगूगलजातेबाहरआपनेवाहनइसकास�बहरहनेइससेसहितबड़ेघटनातलाशपांचश�रीबड़ीहोतेसाईटशायदसकतीजातीवालाहजारपटनारखनेसड़कमिलाउसकीकेवललगताखानाअर�थजहांदेखापहलीनियमबिनाबैंककहींकहनादेताहमलेकाफीजबकित�रतमांगवहींरोज़मिलीआरोपसेनायादवलेनेखाताकरीबउनकाजवाबपूराबड़ासौदाशेयरकियेकहांअकसरबना�वहांस�थलमिलेलेखकविषयक�रंसमूहथानाتستطيعمشاركةبواسطةالص�حةمواضيعالخاصةالمزيدالعامةالكاتبالردودبرنامجالدولةالعالمالموقعالعربيالسريعالجوالالذهابالحياةالحقوقالكريمالعراقمح�وظةالثانيمشاهدةالمرأةالقرآنالشبابالحوارالجديدالأسرةالعلوممجموعةالرحمنالنقاط�لسطينالكويتالدنيابركاتهالرياضتحياتيبتوقيتالأولىالبريدالكلامالرابطالشخصيسياراتالثالثالصلاةالحديثالزوارالخليجالجميعالعامهالجمالالساعةمشاهدهالرئيسالدخولال�نيةالكتابالدوريالدروساستغرقتصاميمالبناتالعظيمentertainmentunderstanding = function().jpg" width="configuration.png" width="<body class="Math.random()contemporary United Statescircumstances.appendChild(organizations<span class=""><img src="/distinguishedthousands of communicationclear"></div>investigationfavicon.ico" margin-right:based on the Massachusettstable border=internationalalso known aspronunciationbackground:#fpadding-left:For example, miscellaneous&lt;/math&gt;psychologicalin particularearch" type="form method="as opposed toSupreme Courtoccasionally Additionally,North Americapx;backgroundopportunitiesEntertainment.toLowerCase(manufacturingprofessional combined withFor instance,consisting of" maxlength="return false;consciousnessMediterraneanextraordinaryassassinationsubsequently button type="the number ofthe original comprehensiverefers to the</ul>
+</div>
+philosophicallocation.hrefwas publishedSan Francisco(function(){
+<div id="mainsophisticatedmathematical /head>

+<bodysuggests thatdocumentationconcentrationrelationshipsmay have been(for example,This article in some casesparts of the definition ofGreat Britain cellpadding=equivalent toplaceholder="; font-size: justificationbelieved thatsuffered fromattempted to leader of thecript" src="/(function() {are available
+	<link rel=" src='http://interested inconventional " alt="" /></are generallyhas also beenmost popular correspondingcredited withtyle="border:</a></span></.gif" width="<iframe src="table class="inline-block;according to together withapproximatelyparliamentarymore and moredisplay:none;traditionallypredominantly&nbsp;|&nbsp;&nbsp;</span> cellspacing=<input name="or" content="controversialproperty="og:/x-shockwave-demonstrationsurrounded byNevertheless,was the firstconsiderable Although the collaborationshould not beproportion of<span style="known as the shortly afterfor instance,described as /head>
+<body starting withincreasingly the fact thatdiscussion ofmiddle of thean individualdifficult to point of viewhomosexualityacceptance of</span></div>manufacturersorigin of thecommonly usedimportance ofdenominationsbackground: #length of thedeterminationa significant" border="0">revolutionaryprinciples ofis consideredwas developedIndo-Europeanvulnerable toproponents ofare sometimescloser to theNew York City name="searchattributed tocourse of themathematicianby the end ofat the end of" border="0" technological.removeClass(branch of theevidence that![endif]-->

+Institute of into a singlerespectively.and thereforeproperties ofis located insome of whichThere is alsocontinued to appearance of &amp;ndash; describes theconsiderationauthor of theindependentlyequipped withdoes not have</a><a href="confused with<link href="/at the age ofappear in theThese includeregardless ofcould be used style=&quot;several timesrepresent thebody>
+</html>thought to bepopulation ofpossibilitiespercentage ofaccess to thean attempt toproduction ofjquery/jquerytwo differentbelong to theestablishmentreplacing thedescription" determine theavailable forAccording to wide range of	<div class="more commonlyorganisationsfunctionalitywas completed &amp;mdash; participationthe characteran additionalappears to befact that thean example ofsignificantlyonmouseover="because they async = true;problems withseems to havethe result of src="http://familiar withpossession offunction () {took place inand sometimessubstantially<span></span>is often usedin an attemptgreat deal ofEnvironmentalsuccessfully virtually all20th century,professionalsnecessary to determined bycompatibilitybecause it isDictionary ofmodificationsThe followingmay refer to:Consequently,Internationalalthough somethat would beworld's firstclassified asbottom of the(particularlyalign="left" most commonlybasis for thefoundation ofcontributionspopularity ofcenter of theto reduce thejurisdictionsapproximation onmouseout="New Testamentcollection of</span></a></in the Unitedfilm director-strict.dtd">has been usedreturn to thealthough thischange in theseveral otherbut there areunprecedentedis similar toespecially inweight: bold;is called thecomputationalindicate thatrestricted to	<meta name="are typicallyconflict withHowever, the An example ofcompared withquantities ofrather than aconstellationnecessary forreported thatspecificationpolitical and&nbsp;&nbsp;<references tothe same yearGovernment ofgeneration ofhave not beenseveral yearscommitment to		<ul class="visualization19th century,practitionersthat he wouldand continuedoccupation ofis defined ascentre of thethe amount of><div style="equivalent ofdifferentiatebrought aboutmargin-left: automaticallythought of asSome of these
+<div class="input class="replaced withis one of theeducation andinfluenced byreputation as
+<meta name="accommodation</div>
+</div>large part ofInstitute forthe so-called against the In this case,was appointedclaimed to beHowever, thisDepartment ofthe remainingeffect on theparticularly deal with the
+<div style="almost alwaysare currentlyexpression ofphilosophy offor more thancivilizationson the islandselectedIndexcan result in" value="" />the structure /></a></div>Many of thesecaused by theof the Unitedspan class="mcan be tracedis related tobecame one ofis frequentlyliving in thetheoreticallyFollowing theRevolutionarygovernment inis determinedthe politicalintroduced insufficient todescription">short storiesseparation ofas to whetherknown for itswas initiallydisplay:blockis an examplethe principalconsists of arecognized as/body></html>a substantialreconstructedhead of stateresistance toundergraduateThere are twogravitationalare describedintentionallyserved as theclass="headeropposition tofundamentallydominated theand the otheralliance withwas forced torespectively,and politicalin support ofpeople in the20th century.and publishedloadChartbeatto understandmember statesenvironmentalfirst half ofcountries andarchitecturalbe consideredcharacterizedclearIntervalauthoritativeFederation ofwas succeededand there area consequencethe Presidentalso includedfree softwaresuccession ofdeveloped thewas destroyedaway from the;
+</script>
+<although theyfollowed by amore powerfulresulted in aUniversity ofHowever, manythe presidentHowever, someis thought tountil the endwas announcedare importantalso includes><input type=the center of DO NOT ALTERused to referthemes/?sort=that had beenthe basis forhas developedin the summercomparativelydescribed thesuch as thosethe resultingis impossiblevarious otherSouth Africanhave the sameeffectivenessin which case; text-align:structure and; background:regarding thesupported theis also knownstyle="marginincluding thebahasa Melayunorsk bokmålnorsk nynorskslovenš�inainternacionalcalificacióncomunicaciónconstrucción"><div class="disambiguationDomainName', 'administrationsimultaneouslytransportationInternational margin-bottom:responsibility<![endif]-->
+</><meta name="implementationinfrastructurerepresentationborder-bottom:</head>
+<body>=http%3A%2F%2F<form method="method="post" /favicon.ico" });
+</script>
+.setAttribute(Administration= new Array();<![endif]-->

+display:block;Unfortunately,">&nbsp;</div>/favicon.ico">='stylesheet' identification, for example,<li><a href="/an alternativeas a result ofpt"></script>
+type="submit" 
+(function() {recommendationform action="/transformationreconstruction.style.display According to hidden" name="along with thedocument.body.approximately Communicationspost" action="meaning &quot;--<![endif]-->Prime Ministercharacteristic</a> <a class=the history of onmouseover="the governmenthref="https://was originallywas introducedclassificationrepresentativeare considered<![endif]-->
+
+depends on theUniversity of in contrast to placeholder="in the case ofinternational constitutionalstyle="border-: function() {Because of the-strict.dtd">
+<table class="accompanied byaccount of the<script src="/nature of the the people in in addition tos); js.id = id" width="100%"regarding the Roman Catholican independentfollowing the .gif" width="1the following discriminationarchaeologicalprime minister.js"></script>combination of marginwidth="createElement(w.attachEvent(</a></td></tr>src="https://aIn particular, align="left" Czech RepublicUnited Kingdomcorrespondenceconcluded that.html" title="(function () {comes from theapplication of<span class="sbelieved to beement('script'</a>
+</li>
+<livery different><span class="option value="(also known as	<li><a href="><input name="separated fromreferred to as valign="top">founder of theattempting to carbon dioxide
+
+<div class="class="search-/body>
+</html>opportunity tocommunications</head>

+<body style="width:Tiếng Việtchanges in theborder-color:#0" border="0" </span></div><was discovered" type="text" );
+</script>
+
+Department of ecclesiasticalthere has beenresulting from</body></html>has never beenthe first timein response toautomatically </div>
+
+<div iwas consideredpercent of the" /></a></div>collection of descended fromsection of theaccept-charsetto be confusedmember of the padding-right:translation ofinterpretation href='http://whether or notThere are alsothere are manya small numberother parts ofimpossible to  class="buttonlocated in the. However, theand eventuallyAt the end of because of itsrepresents the<form action=" method="post"it is possiblemore likely toan increase inhave also beencorresponds toannounced thatalign="right">many countriesfor many yearsearliest knownbecause it waspt"></script>
 valign="top" inhabitants offollowing year

+<div class="million peoplecontroversial concerning theargue that thegovernment anda reference totransferred todescribing the style="color:although therebest known forsubmit" name="multiplicationmore than one recognition ofCouncil of theedition of the  <meta name="Entertainment away from the ;margin-right:at the time ofinvestigationsconnected withand many otheralthough it isbeginning with <span class="descendants of<span class="i align="right"</head>
+<body aspects of thehas since beenEuropean Unionreminiscent ofmore difficultVice Presidentcomposition ofpassed throughmore importantfont-size:11pxexplanation ofthe concept ofwritten in the	<span class="is one of the resemblance toon the groundswhich containsincluding the defined by thepublication ofmeans that theoutside of thesupport of the<input class="<span class="t(Math.random()most prominentdescription ofConstantinoplewere published<div class="seappears in the1" height="1" most importantwhich includeswhich had beendestruction ofthe population
+	<div class="possibility ofsometimes usedappear to havesuccess of theintended to bepresent in thestyle="clear:b

+</script>

+<was founded ininterview with_id" content="capital of the

+<link rel="srelease of thepoint out thatxMLHttpRequestand subsequentsecond largestvery importantspecificationssurface of theapplied to theforeign policy_setDomainNameestablished inis believed toIn addition tomeaning of theis named afterto protect theis representedDeclaration ofmore efficientClassificationother forms ofhe returned to<span class="cperformance of(function() {
if and only ifregions of theleading to therelations withUnited Nationsstyle="height:other than theype" content="Association of
+</head>
+<bodylocated on theis referred to(including theconcentrationsthe individualamong the mostthan any other/>
+<link rel=" return false;the purpose ofthe ability to;color:#fff}
+.
+<span class="the subject ofdefinitions of>

+<link rel="claim that thehave developed<table width="celebration ofFollowing the to distinguish<span class="btakes place inunder the namenoted that the><![endif]-->
+style="margin-instead of theintroduced thethe process ofincreasing thedifferences inestimated thatespecially the/div><div id="was eventuallythroughout histhe differencesomething thatspan></span></significantly ></script>

+

+environmental to prevent thehave been usedespecially forunderstand theis essentiallywere the firstis the largesthave been made" src="http://interpreted assecond half ofcrolling="no" is composed ofII, Holy Romanis expected tohave their owndefined as thetraditionally have differentare often usedto ensure thatagreement withcontaining theare frequentlyinformation onexample is theresulting in a</a></li></ul> class="footerand especiallytype="button" </span></span>which included>
+<meta name="considered thecarried out byHowever, it isbecame part ofin relation topopular in thethe capital ofwas officiallywhich has beenthe History ofalternative todifferent fromto support thesuggested thatin the process  <div class="the foundationbecause of hisconcerned withthe universityopposed to thethe context of<span class="ptext" name="q"		<div class="the scientificrepresented bymathematicianselected by thethat have been><div class="cdiv id="headerin particular,converted into);
+</script>
+<philosophical srpskohrvatskitiếng ViệtРу��кийру��кийinvestigaciónparticipaciónкоторыеобла�тикоторыйчеловек�и�темы�ово�тикоторыхобла�тьвременикотора��егодн��качатьново�тиУкраинывопро�ыкоторой�делатьпомощью�ред�твобразом�тороныуча�тиетечениеГлавна�и�тории�и�темарешени�Скачатьпо�тому�ледует�казатьтоваровконечнорешениекотороеоргановкоторомРекламаالمنتدىمنتدياتالموضوعالبرامجالمواقعالرسائلمشاركاتالأعضاءالرياضةالتصميمالاعضاءالنتائجالألعابالتسجيلالأقسامالضغطاتال�يديوالترحيبالجديدةالتعليمالأخبارالا�لامالأ�لامالتاريخالتقنيةالالعابالخواطرالمجتمعالديكورالسياحةعبداللهالتربيةالروابطالأدبيةالاخبارالمتحدةالاغانيcursor:pointer;</title>
+<meta " href="http://"><span class="members of the window.locationvertical-align:/a> | <a href="<!doctype html>media="screen" <option value="favicon.ico" />
+		<div class="characteristics" method="get" /body>
+</html>
+shortcut icon" document.write(padding-bottom:representativessubmit" value="align="center" throughout the science fiction
+  <div class="submit" class="one of the most valign="top"><was established);

+</script>

+return false;">).style.displaybecause of the document.cookie<form action="/}body{margin:0;Encyclopedia ofversion of the .createElement(name" content="</div>
+</div>
+
+administrative </body>
+</html>history of the "><input type="portion of the as part of the &nbsp;<a href="other countries">
+<div class="</span></span><In other words,display: block;control of the introduction of/>
+<meta name="as well as the in recent years

+	<div class="</div>
+	</div>
+inspired by thethe end of the compatible withbecame known as style="margin:.js"></script>< International there have beenGerman language style="color:#Communist Partyconsistent withborder="0" cell marginheight="the majority of" align="centerrelated to the many different Orthodox Churchsimilar to the />
+<link rel="swas one of the until his death})();
+</script>other languagescompared to theportions of thethe Netherlandsthe most commonbackground:url(argued that thescrolling="no" included in theNorth American the name of theinterpretationsthe traditionaldevelopment of frequently useda collection ofvery similar tosurrounding theexample of thisalign="center">would have beenimage_caption =attached to thesuggesting thatin the form of involved in theis derived fromnamed after theIntroduction torestrictions on style="width: can be used to the creation ofmost important information andresulted in thecollapse of theThis means thatelements of thewas replaced byanalysis of theinspiration forregarded as themost successfulknown as &quot;a comprehensiveHistory of the were consideredreturned to theare referred toUnsourced image>
+	<div class="consists of thestopPropagationinterest in theavailability ofappears to haveelectromagneticenableServices(function of theIt is important</script></div>function(){var relative to theas a result of the position ofFor example, in method="post" was followed by&amp;mdash; thethe applicationjs"></script>

+ul></div></div>after the deathwith respect tostyle="padding:is particularlydisplay:inline; type="submit" is divided into中文 (简体)responsabilidadadministracióninternacionalescorrespondienteउपयोगपूर�वहमारेलोगोंच�नावलेकिनसरकारप�लिसखोजेंचाहि�भेजेंशामिलहमारीजागरणबनानेक�मारब�लॉगमालिकमहिलापृष�ठबढ़तेभाजपाक�लिकट�रेनखिलाफदौरानमामलेमतदानबाजारविकासक�योंचाहतेपह��चबतायासंवाददेखनेपिछलेविशेषराज�यउत�तरम�ंबईदोनोंउपकरणपढ़ेंस�थितफिल�मम�ख�यअच�छाछूटतीसंगीतजा�गाविभागघण�टेदूसरेदिनोंहत�यासेक�सगांधीविश�वरातेंदैट�सनक�शासामनेअदालतबिजलीप�रूषहिंदीमित�रकवितार�पयेस�थानकरोड़म�क�तयोजनाकृपयापोस�टघरेलूकार�यविचारसूचनामूल�यदेखेंहमेशास�कूलमैंनेतैयारजिसकेrss+xml" title="-type" content="title" content="at the same time.js"></script>
+<" method="post" </span></a></li>vertical-align:t/jquery.min.js">.click(function( style="padding-})();
+</script>
+</span><a href="<a href="http://); return false;text-decoration: scrolling="no" border-collapse:associated with Bahasa IndonesiaEnglish language<text xml:space=.gif" border="0"</body>
+</html>
+overflow:hidden;img src="http://addEventListenerresponsible for s.js"></script>
+/favicon.ico" />operating system" style="width:1target="_blank">State Universitytext-align:left;
+document.write(, including the around the world);

+</script>

+<" style="height:;overflow:hiddenmore informationan internationala member of the one of the firstcan be found in </div>
+		</div>
+display: none;">" />
+<link rel="
+  (function() {the 15th century.preventDefault(large number of Byzantine Empire.jpg|thumb|left|vast majority ofmajority of the  align="center">University Pressdominated by theSecond World Wardistribution of style="position:the rest of the characterized by rel="nofollow">derives from therather than the a combination ofstyle="width:100English-speakingcomputer scienceborder="0" alt="the existence ofDemocratic Party" style="margin-For this reason,.js"></script>
+	sByTagName(s)[0]js"></script>

+<.js"></script>

+link rel="icon" ' alt='' class='formation of theversions of the </a></div></div>/page>
+  <page>
+<div class="contbecame the firstbahasa Indonesiaenglish (simple)Ελληνικάхрват�кикомпании�вл�ет��Добавитьчеловекаразвити�ИнтернетОтветитьнапримеринтернеткоторого�траницыкаче�твеу�лови�хпроблемыполучить�вл�ют��наиболеекомпани�внимание�ред�тваالمواضيعالرئيسيةالانتقالمشاركاتكالسياراتالمكتوبةالسعوديةاحصائياتالعالميةالصوتياتالانترنتالتصاميمالإسلاميالمشاركةالمرئياتrobots" content="<div id="footer">the United States<img src="http://.jpg|right|thumb|.js"></script>

+<location.protocolframeborder="0" s" />
+<meta name="</a></div></div><font-weight:bold;&quot; and &quot;depending on the margin:0;padding:" rel="nofollow" President of the twentieth centuryevision>
+  </pageInternet Explorera.async = true;

+information about<div id="header">" action="http://<a href="https://<div id="content"</div>

+</div>

+<derived from the <img src='http://according to the 
+</body>
+</html>
+style="font-size:script language="Arial, Helvetica,</a><span class="</script><script political partiestd></tr></table><href="http://www.interpretation ofrel="stylesheet" document.write('<charset="utf-8">
+beginning of the revealed that thetelevision series" rel="nofollow"> target="_blank">claiming that thehttp%3A%2F%2Fwww.manifestations ofPrime Minister ofinfluenced by theclass="clearfix">/div>

+</div>

+

+three-dimensionalChurch of Englandof North Carolinasquare kilometres.addEventListenerdistinct from thecommonly known asPhonetic Alphabetdeclared that thecontrolled by theBenjamin Franklinrole-playing gamethe University ofin Western Europepersonal computerProject Gutenbergregardless of thehas been proposedtogether with the></li><li class="in some countriesmin.js"></script>of the populationofficial language<img src="images/identified by thenatural resourcesclassification ofcan be consideredquantum mechanicsNevertheless, themillion years ago</body>

+</html>
Ελληνικά
+take advantage ofand, according toattributed to theMicrosoft Windowsthe first centuryunder the controldiv class="headershortly after thenotable exceptiontens of thousandsseveral differentaround the world.reaching militaryisolated from theopposition to thethe Old TestamentAfrican Americansinserted into theseparate from themetropolitan areamakes it possibleacknowledged thatarguably the mosttype="text/css">
+the InternationalAccording to the pe="text/css" />
+coincide with thetwo-thirds of theDuring this time,during the periodannounced that hethe internationaland more recentlybelieved that theconsciousness andformerly known assurrounded by thefirst appeared inoccasionally usedposition:absolute;" target="_blank" position:relative;text-align:center;jax/libs/jquery/1.background-color:#type="application/anguage" content="<meta http-equiv="Privacy Policy</a>e("%3Cscript src='" target="_blank">On the other hand,.jpg|thumb|right|2</div><div class="<div style="float:nineteenth century</body>

+</html>

+<img src="http://s;text-align:centerfont-weight: bold; According to the difference between" frameborder="0" " style="position:link href="http://html4/loose.dtd">
+during this period</td></tr></table>closely related tofor the first time;font-weight:bold;input type="text" <span style="font-onreadystatechange	<div class="cleardocument.location. For example, the a wide variety of <!DOCTYPE html>

+<&nbsp;&nbsp;&nbsp;"><a href="http://style="float:left;concerned with the=http%3A%2F%2Fwww.in popular culturetype="text/css" />it is possible to Harvard Universitytylesheet" href="/the main characterOxford University  name="keywords" cstyle="text-align:the United Kingdomfederal government<div style="margin depending on the description of the<div class="header.min.js"></script>destruction of theslightly differentin accordance withtelecommunicationsindicates that theshortly thereafterespecially in the European countriesHowever, there aresrc="http://staticsuggested that the" src="http://www.a large number of Telecommunications" rel="nofollow" tHoly Roman Emperoralmost exclusively" border="0" alt="Secretary of Stateculminating in theCIA World Factbookthe most importantanniversary of thestyle="background-<li><em><a href="/the Atlantic Oceanstrictly speaking,shortly before thedifferent types ofthe Ottoman Empire><img src="http://An Introduction toconsequence of thedeparture from theConfederate Statesindigenous peoplesProceedings of theinformation on thetheories have beeninvolvement in thedivided into threeadjacent countriesis responsible fordissolution of thecollaboration withwidely regarded ashis contemporariesfounding member ofDominican Republicgenerally acceptedthe possibility ofare also availableunder constructionrestoration of thethe general publicis almost entirelypasses through thehas been suggestedcomputer and videoGermanic languages according to the different from theshortly afterwardshref="https://www.recent developmentBoard of Directors<div class="search| <a href="http://In particular, theMultiple footnotesor other substancethousands of yearstranslation of the</div>

+</div>

+

+<a href="index.phpwas established inmin.js"></script>
+participate in thea strong influencestyle="margin-top:represented by thegraduated from theTraditionally, theElement("script");However, since the/div>
+</div>
+<div left; margin-left:protection against0; vertical-align:Unfortunately, thetype="image/x-icon/div>
+<div class=" class="clearfix"><div class="footer		</div>
+		</div>
+the motion pictureБългар�кибългар�киФедерациине�колько�ообщение�ообщени�программыОтправитьбе�платноматериалыпозвол�етпо�ледниеразличныхпродукциипрограммаполно�тьюнаходит��избранноена�елени�изменени�категории�лек�андрद�वारामैन�अलप�रदानभारतीयअन�देशहिन�दीइंडियादिल�लीअधिकारवीडियोचिट�ठेसमाचारजंक�शनद�नियाप�रयोगअन�सारऑनलाइनपार�टीशर�तोंलोकसभाफ़�लैशशर�तेंप�रदेशप�लेयरकेंद�रस�थितिउत�पादउन�हेंचिट�ठायात�राज�यादाप�रानेजोड़ेंअन�वादश�रेणीशिक�षासरकारीसंग�रहपरिणामब�रांडबच�चोंउपलब�धमंत�रीसंपर�कउम�मीदमाध�यमसहायताशब�दोंमीडियाआईपी�लमोबाइलसंख�याआपरेशनअन�बंधबाज़ारनवीनतमप�रम�खप�रश�नपरिवारन�कसानसमर�थनआयोजितसोमवारالمشاركاتالمنتدياتالكمبيوترالمشاهداتعددالزوارعددالردودالإسلاميةال�وتوشوبالمسابقاتالمعلوماتالمسلسلاتالجرا�يكسالاسلاميةالاتصالاتkeywords" content="w3.org/1999/xhtml"><a target="_blank" text/html; charset=" target="_blank"><table cellpadding="autocomplete="off" text-align: center;to last version by background-color: #" href="http://www./div></div><div id=<a href="#" class=""><img src="http://cript" src="http://
+<script language="//EN" "http://www.wencodeURIComponent(" href="javascript:<div class="contentdocument.write('<scposition: absolute;script src="http:// style="margin-top:.min.js"></script>
+</div>
+<div class="w3.org/1999/xhtml" 
+

+</body>

+</html>distinction between/" target="_blank"><link href="http://encoding="utf-8"?>
+w.addEventListener?action="http://www.icon" href="http:// style="background:type="text/css" />
+meta property="og:t<input type="text"  style="text-align:the development of tylesheet" type="tehtml; charset=utf-8is considered to betable width="100%" In addition to the contributed to the differences betweendevelopment of the It is important to </script>
+
+<script  style="font-size:1></span><span id=gbLibrary of Congress<img src="http://imEnglish translationAcademy of Sciencesdiv style="display:construction of the.getElementById(id)in conjunction withElement('script'); <meta property="og:Българ�ки
+ type="text" name=">Privacy Policy</a>administered by theenableSingleRequeststyle=&quot;margin:</div></div></div><><img src="http://i style=&quot;float:referred to as the total population ofin Washington, D.C. style="background-among other things,organization of theparticipated in thethe introduction ofidentified with thefictional character Oxford University misunderstanding ofThere are, however,stylesheet" href="/Columbia Universityexpanded to includeusually referred toindicating that thehave suggested thataffiliated with thecorrelation betweennumber of different></td></tr></table>Republic of Ireland
+</script>
+<script under the influencecontribution to theOfficial website ofheadquarters of thecentered around theimplications of thehave been developedFederal Republic ofbecame increasinglycontinuation of theNote, however, thatsimilar to that of capabilities of theaccordance with theparticipants in thefurther developmentunder the directionis often consideredhis younger brother</td></tr></table><a http-equiv="X-UA-physical propertiesof British Columbiahas been criticized(with the exceptionquestions about thepassing through the0" cellpadding="0" thousands of peopleredirects here. Forhave children under%3E%3C/script%3E"));<a href="http://www.<li><a href="http://site_name" content="text-decoration:nonestyle="display: none<meta http-equiv="X-new Date().getTime() type="image/x-icon"</span><span class="language="javascriptwindow.location.href<a href="javascript:-->

+<script type="t<a href='http://www.hortcut icon" href="</div>

+<div class="<script src="http://" rel="stylesheet" t</div>
+<script type=/a> <a href="http:// allowTransparency="X-UA-Compatible" conrelationship between
+</script>

+<script </a></li></ul></div>associated with the programming language</a><a href="http://</a></li><li class="form action="http://<div style="display:type="text" name="q"<table width="100%" background-position:" border="0" width="rel="shortcut icon" h6><ul><li><a href="  <meta http-equiv="css" media="screen" responsible for the " type="application/" style="background-html; charset=utf-8" allowtransparency="stylesheet" type="te

+<meta http-equiv="></span><span class="0" cellspacing="0">;
+</script>
+<script sometimes called thedoes not necessarilyFor more informationat the beginning of <!DOCTYPE html><htmlparticularly in the type="hidden" name="javascript:void(0);"effectiveness of the autocomplete="off" generally considered><input type="text" "></script>

+<scriptthroughout the worldcommon misconceptionassociation with the</div>
+</div>
+<div cduring his lifetime,corresponding to thetype="image/x-icon" an increasing numberdiplomatic relationsare often consideredmeta charset="utf-8" <input type="text" examples include the"><img src="http://iparticipation in thethe establishment of
+</div>
+<div class="&amp;nbsp;&amp;nbsp;to determine whetherquite different frommarked the beginningdistance between thecontributions to theconflict between thewidely considered towas one of the firstwith varying degreeshave speculated that(document.getElementparticipating in theoriginally developedeta charset="utf-8"> type="text/css" />
+interchangeably withmore closely relatedsocial and politicalthat would otherwiseperpendicular to thestyle type="text/csstype="submit" name="families residing indeveloping countriescomputer programmingeconomic developmentdetermination of thefor more informationon several occasionsportuguês (Europeu)Україн�ькаукраїн�ькаРо��ий�койматериаловинформацииуправлени�необходимоинформаци�Информаци�Ре�публикиколиче�твоинформациютерриториидо�таточноالمتواجدونالاشتراكاتالاقتراحاتhtml; charset=UTF-8" setTimeout(function()display:inline-block;<input type="submit" type = 'text/javascri<img src="http://www." "http://www.w3.org/shortcut icon" href="" autocomplete="off" </a></div><div class=</a></li>
+<li class="css" type="text/css" <form action="http://xt/css" href="http://link rel="alternate" 

+<script type="text/ onclick="javascript:(new Date).getTime()}height="1" width="1" People's Republic of  <a href="http://www.text-decoration:underthe beginning of the </div>
+</div>
+</div>
+establishment of the </div></div></div></d#viewport{min-height:
+<script src="http://option><option value=often referred to as /option>
+<option valu<!DOCTYPE html>
+<!--[International Airport>
+<a href="http://www</a><a href="http://wภาษาไทยქ�რთული正體中文 (�體)निर�देशडाउनलोडक�षेत�रजानकारीसंबंधितस�थापनास�वीकारसंस�करणसामग�रीचिट�ठोंविज�ञानअमेरिकाविभिन�नगाडिया�क�योंकिस�रक�षापह��चतीप�रबंधनटिप�पणीक�रिकेटप�रारंभप�राप�तमालिकोंरफ़�तारनिर�माणलिमिटेडdescription" content="document.location.prot.getElementsByTagName(<!DOCTYPE html>
+<html <meta charset="utf-8">:url" content="http://.css" rel="stylesheet"style type="text/css">type="text/css" href="w3.org/1999/xhtml" xmltype="text/javascript" method="get" action="link rel="stylesheet"  = document.getElementtype="image/x-icon" />cellpadding="0" cellsp.css" type="text/css" </a></li><li><a href="" width="1" height="1""><a href="http://www.style="display:none;">alternate" type="appli-//W3C//DTD XHTML 1.0 ellspacing="0" cellpad type="hidden" value="/a>&nbsp;<span role="s
+<input type="hidden" language="JavaScript"  document.getElementsBg="0" cellspacing="0" ype="text/css" media="type='text/javascript'with the exception of ype="text/css" rel="st height="1" width="1" ='+encodeURIComponent(<link rel="alternate" 
+body, tr, input, textmeta name="robots" conmethod="post" action=">
+<a href="http://www.css" rel="stylesheet" </div></div><div classlanguage="javascript">aria-hidden="true">·<ript" type="text/javasl=0;})();
+(function(){background-image: url(/a></li><li><a href="h		<li><a href="http://ator" aria-hidden="tru> <a href="http://www.language="javascript" /option>
+<option value/div></div><div class=rator" aria-hidden="tre=(new Date).getTime()português (do Brasil)организациивозможно�тьобразовани�реги�трациивозможно�тиоб�зательна<!DOCTYPE html PUBLIC "nt-Type" content="text/<meta http-equiv="Conteransitional//EN" "http:<html xmlns="http://www-//W3C//DTD XHTML 1.0 TDTD/xhtml1-transitional//www.w3.org/TR/xhtml1/pe = 'text/javascript';<meta name="descriptionparentNode.insertBefore<input type="hidden" najs" type="text/javascri(document).ready(functiscript type="text/javasimage" content="http://UA-Compatible" content=tml; charset=utf-8" />
+link rel="shortcut icon<link rel="stylesheet" </script>
+<script type== document.createElemen<a target="_blank" href= document.getElementsBinput type="text" name=a.type = 'text/javascrinput type="hidden" namehtml; charset=utf-8" />dtd">
+<html xmlns="http-//W3C//DTD HTML 4.01 TentsByTagName('script')input type="hidden" nam<script type="text/javas" style="display:none;">document.getElementById(=document.createElement(' type='text/javascript'input type="text" name="d.getElementsByTagName(snical" href="http://www.C//DTD HTML 4.01 Transit<style type="text/css">
+
+<style type="text/css">ional.dtd">
+<html xmlns=http-equiv="Content-Typeding="0" cellspacing="0"html; charset=utf-8" />
+ style="display:none;"><<li><a href="http://www. type='text/javascript'>де�тельно�ти�оответ�твиипроизвод�твабезопа�но�тиप�स�तिकाकांग�रेसउन�होंनेविधानसभाफिक�सिंगस�रक�षितकॉपीराइटविज�ञापनकार�रवाईसक�रियता
\ No newline at end of file
diff --git a/Source/ThirdParty/brotli/common/dictionary.c b/Source/ThirdParty/brotli/common/dictionary.c
new file mode 100644
index 000000000..d0872bdd8
--- /dev/null
+++ b/Source/ThirdParty/brotli/common/dictionary.c
@@ -0,0 +1,5905 @@
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+   Distributed under MIT license.
+   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+#include "./dictionary.h"
+
+#if defined(__cplusplus) || defined(c_plusplus)
+extern "C" {
+#endif
+
+#ifndef BROTLI_EXTERNAL_DICTIONARY_DATA
+static const uint8_t kBrotliDictionaryData[] =
+{
+116,105,109,101,100,111,119,110,108,105,102,101,108,101,102,116,98,97,99,107,99,
+111,100,101,100,97,116,97,115,104,111,119,111,110,108,121,115,105,116,101,99,105
+,116,121,111,112,101,110,106,117,115,116,108,105,107,101,102,114,101,101,119,111
+,114,107,116,101,120,116,121,101,97,114,111,118,101,114,98,111,100,121,108,111,
+118,101,102,111,114,109,98,111,111,107,112,108,97,121,108,105,118,101,108,105,
+110,101,104,101,108,112,104,111,109,101,115,105,100,101,109,111,114,101,119,111,
+114,100,108,111,110,103,116,104,101,109,118,105,101,119,102,105,110,100,112,97,
+103,101,100,97,121,115,102,117,108,108,104,101,97,100,116,101,114,109,101,97,99,
+104,97,114,101,97,102,114,111,109,116,114,117,101,109,97,114,107,97,98,108,101,
+117,112,111,110,104,105,103,104,100,97,116,101,108,97,110,100,110,101,119,115,
+101,118,101,110,110,101,120,116,99,97,115,101,98,111,116,104,112,111,115,116,117
+,115,101,100,109,97,100,101,104,97,110,100,104,101,114,101,119,104,97,116,110,97
+,109,101,76,105,110,107,98,108,111,103,115,105,122,101,98,97,115,101,104,101,108
+,100,109,97,107,101,109,97,105,110,117,115,101,114,39,41,32,43,104,111,108,100,
+101,110,100,115,119,105,116,104,78,101,119,115,114,101,97,100,119,101,114,101,
+115,105,103,110,116,97,107,101,104,97,118,101,103,97,109,101,115,101,101,110,99,
+97,108,108,112,97,116,104,119,101,108,108,112,108,117,115,109,101,110,117,102,
+105,108,109,112,97,114,116,106,111,105,110,116,104,105,115,108,105,115,116,103,
+111,111,100,110,101,101,100,119,97,121,115,119,101,115,116,106,111,98,115,109,
+105,110,100,97,108,115,111,108,111,103,111,114,105,99,104,117,115,101,115,108,97
+,115,116,116,101,97,109,97,114,109,121,102,111,111,100,107,105,110,103,119,105,
+108,108,101,97,115,116,119,97,114,100,98,101,115,116,102,105,114,101,80,97,103,
+101,107,110,111,119,97,119,97,121,46,112,110,103,109,111,118,101,116,104,97,110,
+108,111,97,100,103,105,118,101,115,101,108,102,110,111,116,101,109,117,99,104,
+102,101,101,100,109,97,110,121,114,111,99,107,105,99,111,110,111,110,99,101,108,
+111,111,107,104,105,100,101,100,105,101,100,72,111,109,101,114,117,108,101,104,
+111,115,116,97,106,97,120,105,110,102,111,99,108,117,98,108,97,119,115,108,101,
+115,115,104,97,108,102,115,111,109,101,115,117,99,104,122,111,110,101,49,48,48,
+37,111,110,101,115,99,97,114,101,84,105,109,101,114,97,99,101,98,108,117,101,102
+,111,117,114,119,101,101,107,102,97,99,101,104,111,112,101,103,97,118,101,104,97
+,114,100,108,111,115,116,119,104,101,110,112,97,114,107,107,101,112,116,112,97,
+115,115,115,104,105,112,114,111,111,109,72,84,77,76,112,108,97,110,84,121,112,
+101,100,111,110,101,115,97,118,101,107,101,101,112,102,108,97,103,108,105,110,
+107,115,111,108,100,102,105,118,101,116,111,111,107,114,97,116,101,116,111,119,
+110,106,117,109,112,116,104,117,115,100,97,114,107,99,97,114,100,102,105,108,101
+,102,101,97,114,115,116,97,121,107,105,108,108,116,104,97,116,102,97,108,108,97,
+117,116,111,101,118,101,114,46,99,111,109,116,97,108,107,115,104,111,112,118,111
+,116,101,100,101,101,112,109,111,100,101,114,101,115,116,116,117,114,110,98,111,
+114,110,98,97,110,100,102,101,108,108,114,111,115,101,117,114,108,40,115,107,105
+,110,114,111,108,101,99,111,109,101,97,99,116,115,97,103,101,115,109,101,101,116
+,103,111,108,100,46,106,112,103,105,116,101,109,118,97,114,121,102,101,108,116,
+116,104,101,110,115,101,110,100,100,114,111,112,86,105,101,119,99,111,112,121,49
+,46,48,34,60,47,97,62,115,116,111,112,101,108,115,101,108,105,101,115,116,111,
+117,114,112,97,99,107,46,103,105,102,112,97,115,116,99,115,115,63,103,114,97,121
+,109,101,97,110,38,103,116,59,114,105,100,101,115,104,111,116,108,97,116,101,115
+,97,105,100,114,111,97,100,118,97,114,32,102,101,101,108,106,111,104,110,114,105
+,99,107,112,111,114,116,102,97,115,116,39,85,65,45,100,101,97,100,60,47,98,62,
+112,111,111,114,98,105,108,108,116,121,112,101,85,46,83,46,119,111,111,100,109,
+117,115,116,50,112,120,59,73,110,102,111,114,97,110,107,119,105,100,101,119,97,
+110,116,119,97,108,108,108,101,97,100,91,48,93,59,112,97,117,108,119,97,118,101,
+115,117,114,101,36,40,39,35,119,97,105,116,109,97,115,115,97,114,109,115,103,111
+,101,115,103,97,105,110,108,97,110,103,112,97,105,100,33,45,45,32,108,111,99,107
+,117,110,105,116,114,111,111,116,119,97,108,107,102,105,114,109,119,105,102,101,
+120,109,108,34,115,111,110,103,116,101,115,116,50,48,112,120,107,105,110,100,114
+,111,119,115,116,111,111,108,102,111,110,116,109,97,105,108,115,97,102,101,115,
+116,97,114,109,97,112,115,99,111,114,101,114,97,105,110,102,108,111,119,98,97,98
+,121,115,112,97,110,115,97,121,115,52,112,120,59,54,112,120,59,97,114,116,115,
+102,111,111,116,114,101,97,108,119,105,107,105,104,101,97,116,115,116,101,112,
+116,114,105,112,111,114,103,47,108,97,107,101,119,101,97,107,116,111,108,100,70,
+111,114,109,99,97,115,116,102,97,110,115,98,97,110,107,118,101,114,121,114,117,
+110,115,106,117,108,121,116,97,115,107,49,112,120,59,103,111,97,108,103,114,101,
+119,115,108,111,119,101,100,103,101,105,100,61,34,115,101,116,115,53,112,120,59,
+46,106,115,63,52,48,112,120,105,102,32,40,115,111,111,110,115,101,97,116,110,111
+,110,101,116,117,98,101,122,101,114,111,115,101,110,116,114,101,101,100,102,97,
+99,116,105,110,116,111,103,105,102,116,104,97,114,109,49,56,112,120,99,97,109,
+101,104,105,108,108,98,111,108,100,122,111,111,109,118,111,105,100,101,97,115,
+121,114,105,110,103,102,105,108,108,112,101,97,107,105,110,105,116,99,111,115,
+116,51,112,120,59,106,97,99,107,116,97,103,115,98,105,116,115,114,111,108,108,
+101,100,105,116,107,110,101,119,110,101,97,114,60,33,45,45,103,114,111,119,74,83
+,79,78,100,117,116,121,78,97,109,101,115,97,108,101,121,111,117,32,108,111,116,
+115,112,97,105,110,106,97,122,122,99,111,108,100,101,121,101,115,102,105,115,104
+,119,119,119,46,114,105,115,107,116,97,98,115,112,114,101,118,49,48,112,120,114,
+105,115,101,50,53,112,120,66,108,117,101,100,105,110,103,51,48,48,44,98,97,108,
+108,102,111,114,100,101,97,114,110,119,105,108,100,98,111,120,46,102,97,105,114,
+108,97,99,107,118,101,114,115,112,97,105,114,106,117,110,101,116,101,99,104,105,
+102,40,33,112,105,99,107,101,118,105,108,36,40,34,35,119,97,114,109,108,111,114,
+100,100,111,101,115,112,117,108,108,44,48,48,48,105,100,101,97,100,114,97,119,
+104,117,103,101,115,112,111,116,102,117,110,100,98,117,114,110,104,114,101,102,
+99,101,108,108,107,101,121,115,116,105,99,107,104,111,117,114,108,111,115,115,
+102,117,101,108,49,50,112,120,115,117,105,116,100,101,97,108,82,83,83,34,97,103,
+101,100,103,114,101,121,71,69,84,34,101,97,115,101,97,105,109,115,103,105,114,
+108,97,105,100,115,56,112,120,59,110,97,118,121,103,114,105,100,116,105,112,115,
+35,57,57,57,119,97,114,115,108,97,100,121,99,97,114,115,41,59,32,125,112,104,112
+,63,104,101,108,108,116,97,108,108,119,104,111,109,122,104,58,229,42,47,13,10,32
+,49,48,48,104,97,108,108,46,10,10,65,55,112,120,59,112,117,115,104,99,104,97,116
+,48,112,120,59,99,114,101,119,42,47,60,47,104,97,115,104,55,53,112,120,102,108,
+97,116,114,97,114,101,32,38,38,32,116,101,108,108,99,97,109,112,111,110,116,111,
+108,97,105,100,109,105,115,115,115,107,105,112,116,101,110,116,102,105,110,101,
+109,97,108,101,103,101,116,115,112,108,111,116,52,48,48,44,13,10,13,10,99,111,
+111,108,102,101,101,116,46,112,104,112,60,98,114,62,101,114,105,99,109,111,115,
+116,103,117,105,100,98,101,108,108,100,101,115,99,104,97,105,114,109,97,116,104,
+97,116,111,109,47,105,109,103,38,35,56,50,108,117,99,107,99,101,110,116,48,48,48
+,59,116,105,110,121,103,111,110,101,104,116,109,108,115,101,108,108,100,114,117,
+103,70,82,69,69,110,111,100,101,110,105,99,107,63,105,100,61,108,111,115,101,110
+,117,108,108,118,97,115,116,119,105,110,100,82,83,83,32,119,101,97,114,114,101,
+108,121,98,101,101,110,115,97,109,101,100,117,107,101,110,97,115,97,99,97,112,
+101,119,105,115,104,103,117,108,102,84,50,51,58,104,105,116,115,115,108,111,116,
+103,97,116,101,107,105,99,107,98,108,117,114,116,104,101,121,49,53,112,120,39,39
+,41,59,41,59,34,62,109,115,105,101,119,105,110,115,98,105,114,100,115,111,114,
+116,98,101,116,97,115,101,101,107,84,49,56,58,111,114,100,115,116,114,101,101,
+109,97,108,108,54,48,112,120,102,97,114,109,226,128,153,115,98,111,121,115,91,48
+,93,46,39,41,59,34,80,79,83,84,98,101,97,114,107,105,100,115,41,59,125,125,109,
+97,114,121,116,101,110,100,40,85,75,41,113,117,97,100,122,104,58,230,45,115,105,
+122,45,45,45,45,112,114,111,112,39,41,59,13,108,105,102,116,84,49,57,58,118,105,
+99,101,97,110,100,121,100,101,98,116,62,82,83,83,112,111,111,108,110,101,99,107,
+98,108,111,119,84,49,54,58,100,111,111,114,101,118,97,108,84,49,55,58,108,101,
+116,115,102,97,105,108,111,114,97,108,112,111,108,108,110,111,118,97,99,111,108,
+115,103,101,110,101,32,226,128,148,115,111,102,116,114,111,109,101,116,105,108,
+108,114,111,115,115,60,104,51,62,112,111,117,114,102,97,100,101,112,105,110,107,
+60,116,114,62,109,105,110,105,41,124,33,40,109,105,110,101,122,104,58,232,98,97,
+114,115,104,101,97,114,48,48,41,59,109,105,108,107,32,45,45,62,105,114,111,110,
+102,114,101,100,100,105,115,107,119,101,110,116,115,111,105,108,112,117,116,115,
+47,106,115,47,104,111,108,121,84,50,50,58,73,83,66,78,84,50,48,58,97,100,97,109,
+115,101,101,115,60,104,50,62,106,115,111,110,39,44,32,39,99,111,110,116,84,50,49
+,58,32,82,83,83,108,111,111,112,97,115,105,97,109,111,111,110,60,47,112,62,115,
+111,117,108,76,73,78,69,102,111,114,116,99,97,114,116,84,49,52,58,60,104,49,62,
+56,48,112,120,33,45,45,60,57,112,120,59,84,48,52,58,109,105,107,101,58,52,54,90,
+110,105,99,101,105,110,99,104,89,111,114,107,114,105,99,101,122,104,58,228,39,41
+,41,59,112,117,114,101,109,97,103,101,112,97,114,97,116,111,110,101,98,111,110,
+100,58,51,55,90,95,111,102,95,39,93,41,59,48,48,48,44,122,104,58,231,116,97,110,
+107,121,97,114,100,98,111,119,108,98,117,115,104,58,53,54,90,74,97,118,97,51,48,
+112,120,10,124,125,10,37,67,51,37,58,51,52,90,106,101,102,102,69,88,80,73,99,97,
+115,104,118,105,115,97,103,111,108,102,115,110,111,119,122,104,58,233,113,117,
+101,114,46,99,115,115,115,105,99,107,109,101,97,116,109,105,110,46,98,105,110,
+100,100,101,108,108,104,105,114,101,112,105,99,115,114,101,110,116,58,51,54,90,
+72,84,84,80,45,50,48,49,102,111,116,111,119,111,108,102,69,78,68,32,120,98,111,
+120,58,53,52,90,66,79,68,89,100,105,99,107,59,10,125,10,101,120,105,116,58,51,53
+,90,118,97,114,115,98,101,97,116,39,125,41,59,100,105,101,116,57,57,57,59,97,110
+,110,101,125,125,60,47,91,105,93,46,76,97,110,103,107,109,194,178,119,105,114,
+101,116,111,121,115,97,100,100,115,115,101,97,108,97,108,101,120,59,10,9,125,101
+,99,104,111,110,105,110,101,46,111,114,103,48,48,53,41,116,111,110,121,106,101,
+119,115,115,97,110,100,108,101,103,115,114,111,111,102,48,48,48,41,32,50,48,48,
+119,105,110,101,103,101,97,114,100,111,103,115,98,111,111,116,103,97,114,121,99,
+117,116,115,116,121,108,101,116,101,109,112,116,105,111,110,46,120,109,108,99,
+111,99,107,103,97,110,103,36,40,39,46,53,48,112,120,80,104,46,68,109,105,115,99,
+97,108,97,110,108,111,97,110,100,101,115,107,109,105,108,101,114,121,97,110,117,
+110,105,120,100,105,115,99,41,59,125,10,100,117,115,116,99,108,105,112,41,46,10,
+10,55,48,112,120,45,50,48,48,68,86,68,115,55,93,62,60,116,97,112,101,100,101,109
+,111,105,43,43,41,119,97,103,101,101,117,114,111,112,104,105,108,111,112,116,115
+,104,111,108,101,70,65,81,115,97,115,105,110,45,50,54,84,108,97,98,115,112,101,
+116,115,85,82,76,32,98,117,108,107,99,111,111,107,59,125,13,10,72,69,65,68,91,48
+,93,41,97,98,98,114,106,117,97,110,40,49,57,56,108,101,115,104,116,119,105,110,
+60,47,105,62,115,111,110,121,103,117,121,115,102,117,99,107,112,105,112,101,124,
+45,10,33,48,48,50,41,110,100,111,119,91,49,93,59,91,93,59,10,76,111,103,32,115,
+97,108,116,13,10,9,9,98,97,110,103,116,114,105,109,98,97,116,104,41,123,13,10,48
+,48,112,120,10,125,41,59,107,111,58,236,102,101,101,115,97,100,62,13,115,58,47,
+47,32,91,93,59,116,111,108,108,112,108,117,103,40,41,123,10,123,13,10,32,46,106,
+115,39,50,48,48,112,100,117,97,108,98,111,97,116,46,74,80,71,41,59,10,125,113,
+117,111,116,41,59,10,10,39,41,59,10,13,10,125,13,50,48,49,52,50,48,49,53,50,48,
+49,54,50,48,49,55,50,48,49,56,50,48,49,57,50,48,50,48,50,48,50,49,50,48,50,50,50
+,48,50,51,50,48,50,52,50,48,50,53,50,48,50,54,50,48,50,55,50,48,50,56,50,48,50,
+57,50,48,51,48,50,48,51,49,50,48,51,50,50,48,51,51,50,48,51,52,50,48,51,53,50,48
+,51,54,50,48,51,55,50,48,49,51,50,48,49,50,50,48,49,49,50,48,49,48,50,48,48,57,
+50,48,48,56,50,48,48,55,50,48,48,54,50,48,48,53,50,48,48,52,50,48,48,51,50,48,48
+,50,50,48,48,49,50,48,48,48,49,57,57,57,49,57,57,56,49,57,57,55,49,57,57,54,49,
+57,57,53,49,57,57,52,49,57,57,51,49,57,57,50,49,57,57,49,49,57,57,48,49,57,56,57
+,49,57,56,56,49,57,56,55,49,57,56,54,49,57,56,53,49,57,56,52,49,57,56,51,49,57,
+56,50,49,57,56,49,49,57,56,48,49,57,55,57,49,57,55,56,49,57,55,55,49,57,55,54,49
+,57,55,53,49,57,55,52,49,57,55,51,49,57,55,50,49,57,55,49,49,57,55,48,49,57,54,
+57,49,57,54,56,49,57,54,55,49,57,54,54,49,57,54,53,49,57,54,52,49,57,54,51,49,57
+,54,50,49,57,54,49,49,57,54,48,49,57,53,57,49,57,53,56,49,57,53,55,49,57,53,54,
+49,57,53,53,49,57,53,52,49,57,53,51,49,57,53,50,49,57,53,49,49,57,53,48,49,48,48
+,48,49,48,50,52,49,51,57,52,48,48,48,48,57,57,57,57,99,111,109,111,109,195,161,
+115,101,115,116,101,101,115,116,97,112,101,114,111,116,111,100,111,104,97,99,101
+,99,97,100,97,97,195,177,111,98,105,101,110,100,195,173,97,97,115,195,173,118,
+105,100,97,99,97,115,111,111,116,114,111,102,111,114,111,115,111,108,111,111,116
+,114,97,99,117,97,108,100,105,106,111,115,105,100,111,103,114,97,110,116,105,112
+,111,116,101,109,97,100,101,98,101,97,108,103,111,113,117,195,169,101,115,116,
+111,110,97,100,97,116,114,101,115,112,111,99,111,99,97,115,97,98,97,106,111,116,
+111,100,97,115,105,110,111,97,103,117,97,112,117,101,115,117,110,111,115,97,110,
+116,101,100,105,99,101,108,117,105,115,101,108,108,97,109,97,121,111,122,111,110
+,97,97,109,111,114,112,105,115,111,111,98,114,97,99,108,105,99,101,108,108,111,
+100,105,111,115,104,111,114,97,99,97,115,105,208,183,208,176,208,189,208,176,208
+,190,208,188,209,128,208,176,209,128,209,131,209,130,208,176,208,189,208,181,208
+,191,208,190,208,190,209,130,208,184,208,183,208,189,208,190,208,180,208,190,209
+,130,208,190,208,182,208,181,208,190,208,189,208,184,209,133,208,157,208,176,208
+,181,208,181,208,177,209,139,208,188,209,139,208,146,209,139,209,129,208,190,208
+,178,209,139,208,178,208,190,208,157,208,190,208,190,208,177,208,159,208,190,208
+,187,208,184,208,189,208,184,208,160,208,164,208,157,208,181,208,156,209,139,209
+,130,209,139,208,158,208,189,208,184,208,188,208,180,208,176,208,151,208,176,208
+,148,208,176,208,157,209,131,208,158,208,177,209,130,208,181,208,152,208,183,208
+,181,208,185,208,189,209,131,208,188,208,188,208,162,209,139,209,131,208,182,217
+,129,217,138,216,163,217,134,217,133,216,167,217,133,216,185,217,131,217,132,216
+,163,217,136,216,177,216,175,217,138,216,167,217,129,217,137,217,135,217,136,217
+,132,217,133,217,132,217,131,216,167,217,136,217,132,217,135,216,168,216,179,216
+,167,217,132,216,165,217,134,217,135,217,138,216,163,217,138,217,130,216,175,217
+,135,217,132,216,171,217,133,216,168,217,135,217,132,217,136,217,132,217,138,216
+,168,217,132,216,167,217,138,216,168,217,131,216,180,217,138,216,167,217,133,216
+,163,217,133,217,134,216,170,216,168,217,138,217,132,217,134,216,173,216,168,217
+,135,217,133,217,133,216,180,217,136,216,180,102,105,114,115,116,118,105,100,101
+,111,108,105,103,104,116,119,111,114,108,100,109,101,100,105,97,119,104,105,116,
+101,99,108,111,115,101,98,108,97,99,107,114,105,103,104,116,115,109,97,108,108,
+98,111,111,107,115,112,108,97,99,101,109,117,115,105,99,102,105,101,108,100,111,
+114,100,101,114,112,111,105,110,116,118,97,108,117,101,108,101,118,101,108,116,
+97,98,108,101,98,111,97,114,100,104,111,117,115,101,103,114,111,117,112,119,111,
+114,107,115,121,101,97,114,115,115,116,97,116,101,116,111,100,97,121,119,97,116,
+101,114,115,116,97,114,116,115,116,121,108,101,100,101,97,116,104,112,111,119,
+101,114,112,104,111,110,101,110,105,103,104,116,101,114,114,111,114,105,110,112,
+117,116,97,98,111,117,116,116,101,114,109,115,116,105,116,108,101,116,111,111,
+108,115,101,118,101,110,116,108,111,99,97,108,116,105,109,101,115,108,97,114,103
+,101,119,111,114,100,115,103,97,109,101,115,115,104,111,114,116,115,112,97,99,
+101,102,111,99,117,115,99,108,101,97,114,109,111,100,101,108,98,108,111,99,107,
+103,117,105,100,101,114,97,100,105,111,115,104,97,114,101,119,111,109,101,110,97
+,103,97,105,110,109,111,110,101,121,105,109,97,103,101,110,97,109,101,115,121,
+111,117,110,103,108,105,110,101,115,108,97,116,101,114,99,111,108,111,114,103,
+114,101,101,110,102,114,111,110,116,38,97,109,112,59,119,97,116,99,104,102,111,
+114,99,101,112,114,105,99,101,114,117,108,101,115,98,101,103,105,110,97,102,116,
+101,114,118,105,115,105,116,105,115,115,117,101,97,114,101,97,115,98,101,108,111
+,119,105,110,100,101,120,116,111,116,97,108,104,111,117,114,115,108,97,98,101,
+108,112,114,105,110,116,112,114,101,115,115,98,117,105,108,116,108,105,110,107,
+115,115,112,101,101,100,115,116,117,100,121,116,114,97,100,101,102,111,117,110,
+100,115,101,110,115,101,117,110,100,101,114,115,104,111,119,110,102,111,114,109,
+115,114,97,110,103,101,97,100,100,101,100,115,116,105,108,108,109,111,118,101,
+100,116,97,107,101,110,97,98,111,118,101,102,108,97,115,104,102,105,120,101,100,
+111,102,116,101,110,111,116,104,101,114,118,105,101,119,115,99,104,101,99,107,
+108,101,103,97,108,114,105,118,101,114,105,116,101,109,115,113,117,105,99,107,
+115,104,97,112,101,104,117,109,97,110,101,120,105,115,116,103,111,105,110,103,
+109,111,118,105,101,116,104,105,114,100,98,97,115,105,99,112,101,97,99,101,115,
+116,97,103,101,119,105,100,116,104,108,111,103,105,110,105,100,101,97,115,119,
+114,111,116,101,112,97,103,101,115,117,115,101,114,115,100,114,105,118,101,115,
+116,111,114,101,98,114,101,97,107,115,111,117,116,104,118,111,105,99,101,115,105
+,116,101,115,109,111,110,116,104,119,104,101,114,101,98,117,105,108,100,119,104,
+105,99,104,101,97,114,116,104,102,111,114,117,109,116,104,114,101,101,115,112,
+111,114,116,112,97,114,116,121,67,108,105,99,107,108,111,119,101,114,108,105,118
+,101,115,99,108,97,115,115,108,97,121,101,114,101,110,116,114,121,115,116,111,
+114,121,117,115,97,103,101,115,111,117,110,100,99,111,117,114,116,121,111,117,
+114,32,98,105,114,116,104,112,111,112,117,112,116,121,112,101,115,97,112,112,108
+,121,73,109,97,103,101,98,101,105,110,103,117,112,112,101,114,110,111,116,101,
+115,101,118,101,114,121,115,104,111,119,115,109,101,97,110,115,101,120,116,114,
+97,109,97,116,99,104,116,114,97,99,107,107,110,111,119,110,101,97,114,108,121,98
+,101,103,97,110,115,117,112,101,114,112,97,112,101,114,110,111,114,116,104,108,
+101,97,114,110,103,105,118,101,110,110,97,109,101,100,101,110,100,101,100,84,101
+,114,109,115,112,97,114,116,115,71,114,111,117,112,98,114,97,110,100,117,115,105
+,110,103,119,111,109,97,110,102,97,108,115,101,114,101,97,100,121,97,117,100,105
+,111,116,97,107,101,115,119,104,105,108,101,46,99,111,109,47,108,105,118,101,100
+,99,97,115,101,115,100,97,105,108,121,99,104,105,108,100,103,114,101,97,116,106,
+117,100,103,101,116,104,111,115,101,117,110,105,116,115,110,101,118,101,114,98,
+114,111,97,100,99,111,97,115,116,99,111,118,101,114,97,112,112,108,101,102,105,
+108,101,115,99,121,99,108,101,115,99,101,110,101,112,108,97,110,115,99,108,105,
+99,107,119,114,105,116,101,113,117,101,101,110,112,105,101,99,101,101,109,97,105
+,108,102,114,97,109,101,111,108,100,101,114,112,104,111,116,111,108,105,109,105,
+116,99,97,99,104,101,99,105,118,105,108,115,99,97,108,101,101,110,116,101,114,
+116,104,101,109,101,116,104,101,114,101,116,111,117,99,104,98,111,117,110,100,
+114,111,121,97,108,97,115,107,101,100,119,104,111,108,101,115,105,110,99,101,115
+,116,111,99,107,32,110,97,109,101,102,97,105,116,104,104,101,97,114,116,101,109,
+112,116,121,111,102,102,101,114,115,99,111,112,101,111,119,110,101,100,109,105,
+103,104,116,97,108,98,117,109,116,104,105,110,107,98,108,111,111,100,97,114,114,
+97,121,109,97,106,111,114,116,114,117,115,116,99,97,110,111,110,117,110,105,111,
+110,99,111,117,110,116,118,97,108,105,100,115,116,111,110,101,83,116,121,108,101
+,76,111,103,105,110,104,97,112,112,121,111,99,99,117,114,108,101,102,116,58,102,
+114,101,115,104,113,117,105,116,101,102,105,108,109,115,103,114,97,100,101,110,
+101,101,100,115,117,114,98,97,110,102,105,103,104,116,98,97,115,105,115,104,111,
+118,101,114,97,117,116,111,59,114,111,117,116,101,46,104,116,109,108,109,105,120
+,101,100,102,105,110,97,108,89,111,117,114,32,115,108,105,100,101,116,111,112,
+105,99,98,114,111,119,110,97,108,111,110,101,100,114,97,119,110,115,112,108,105,
+116,114,101,97,99,104,82,105,103,104,116,100,97,116,101,115,109,97,114,99,104,
+113,117,111,116,101,103,111,111,100,115,76,105,110,107,115,100,111,117,98,116,97
+,115,121,110,99,116,104,117,109,98,97,108,108,111,119,99,104,105,101,102,121,111
+,117,116,104,110,111,118,101,108,49,48,112,120,59,115,101,114,118,101,117,110,
+116,105,108,104,97,110,100,115,67,104,101,99,107,83,112,97,99,101,113,117,101,
+114,121,106,97,109,101,115,101,113,117,97,108,116,119,105,99,101,48,44,48,48,48,
+83,116,97,114,116,112,97,110,101,108,115,111,110,103,115,114,111,117,110,100,101
+,105,103,104,116,115,104,105,102,116,119,111,114,116,104,112,111,115,116,115,108
+,101,97,100,115,119,101,101,107,115,97,118,111,105,100,116,104,101,115,101,109,
+105,108,101,115,112,108,97,110,101,115,109,97,114,116,97,108,112,104,97,112,108,
+97,110,116,109,97,114,107,115,114,97,116,101,115,112,108,97,121,115,99,108,97,
+105,109,115,97,108,101,115,116,101,120,116,115,115,116,97,114,115,119,114,111,
+110,103,60,47,104,51,62,116,104,105,110,103,46,111,114,103,47,109,117,108,116,
+105,104,101,97,114,100,80,111,119,101,114,115,116,97,110,100,116,111,107,101,110
+,115,111,108,105,100,40,116,104,105,115,98,114,105,110,103,115,104,105,112,115,
+115,116,97,102,102,116,114,105,101,100,99,97,108,108,115,102,117,108,108,121,102
+,97,99,116,115,97,103,101,110,116,84,104,105,115,32,47,47,45,45,62,97,100,109,
+105,110,101,103,121,112,116,69,118,101,110,116,49,53,112,120,59,69,109,97,105,
+108,116,114,117,101,34,99,114,111,115,115,115,112,101,110,116,98,108,111,103,115
+,98,111,120,34,62,110,111,116,101,100,108,101,97,118,101,99,104,105,110,97,115,
+105,122,101,115,103,117,101,115,116,60,47,104,52,62,114,111,98,111,116,104,101,
+97,118,121,116,114,117,101,44,115,101,118,101,110,103,114,97,110,100,99,114,105,
+109,101,115,105,103,110,115,97,119,97,114,101,100,97,110,99,101,112,104,97,115,
+101,62,60,33,45,45,101,110,95,85,83,38,35,51,57,59,50,48,48,112,120,95,110,97,
+109,101,108,97,116,105,110,101,110,106,111,121,97,106,97,120,46,97,116,105,111,
+110,115,109,105,116,104,85,46,83,46,32,104,111,108,100,115,112,101,116,101,114,
+105,110,100,105,97,110,97,118,34,62,99,104,97,105,110,115,99,111,114,101,99,111,
+109,101,115,100,111,105,110,103,112,114,105,111,114,83,104,97,114,101,49,57,57,
+48,115,114,111,109,97,110,108,105,115,116,115,106,97,112,97,110,102,97,108,108,
+115,116,114,105,97,108,111,119,110,101,114,97,103,114,101,101,60,47,104,50,62,97
+,98,117,115,101,97,108,101,114,116,111,112,101,114,97,34,45,47,47,87,99,97,114,
+100,115,104,105,108,108,115,116,101,97,109,115,80,104,111,116,111,116,114,117,
+116,104,99,108,101,97,110,46,112,104,112,63,115,97,105,110,116,109,101,116,97,
+108,108,111,117,105,115,109,101,97,110,116,112,114,111,111,102,98,114,105,101,
+102,114,111,119,34,62,103,101,110,114,101,116,114,117,99,107,108,111,111,107,115
+,86,97,108,117,101,70,114,97,109,101,46,110,101,116,47,45,45,62,10,60,116,114,
+121,32,123,10,118,97,114,32,109,97,107,101,115,99,111,115,116,115,112,108,97,105
+,110,97,100,117,108,116,113,117,101,115,116,116,114,97,105,110,108,97,98,111,114
+,104,101,108,112,115,99,97,117,115,101,109,97,103,105,99,109,111,116,111,114,116
+,104,101,105,114,50,53,48,112,120,108,101,97,115,116,115,116,101,112,115,67,111,
+117,110,116,99,111,117,108,100,103,108,97,115,115,115,105,100,101,115,102,117,
+110,100,115,104,111,116,101,108,97,119,97,114,100,109,111,117,116,104,109,111,
+118,101,115,112,97,114,105,115,103,105,118,101,115,100,117,116,99,104,116,101,
+120,97,115,102,114,117,105,116,110,117,108,108,44,124,124,91,93,59,116,111,112,
+34,62,10,60,33,45,45,80,79,83,84,34,111,99,101,97,110,60,98,114,47,62,102,108,
+111,111,114,115,112,101,97,107,100,101,112,116,104,32,115,105,122,101,98,97,110,
+107,115,99,97,116,99,104,99,104,97,114,116,50,48,112,120,59,97,108,105,103,110,
+100,101,97,108,115,119,111,117,108,100,53,48,112,120,59,117,114,108,61,34,112,97
+,114,107,115,109,111,117,115,101,77,111,115,116,32,46,46,46,60,47,97,109,111,110
+,103,98,114,97,105,110,98,111,100,121,32,110,111,110,101,59,98,97,115,101,100,99
+,97,114,114,121,100,114,97,102,116,114,101,102,101,114,112,97,103,101,95,104,111
+,109,101,46,109,101,116,101,114,100,101,108,97,121,100,114,101,97,109,112,114,
+111,118,101,106,111,105,110,116,60,47,116,114,62,100,114,117,103,115,60,33,45,45
+,32,97,112,114,105,108,105,100,101,97,108,97,108,108,101,110,101,120,97,99,116,
+102,111,114,116,104,99,111,100,101,115,108,111,103,105,99,86,105,101,119,32,115,
+101,101,109,115,98,108,97,110,107,112,111,114,116,115,32,40,50,48,48,115,97,118,
+101,100,95,108,105,110,107,103,111,97,108,115,103,114,97,110,116,103,114,101,101
+,107,104,111,109,101,115,114,105,110,103,115,114,97,116,101,100,51,48,112,120,59
+,119,104,111,115,101,112,97,114,115,101,40,41,59,34,32,66,108,111,99,107,108,105
+,110,117,120,106,111,110,101,115,112,105,120,101,108,39,41,59,34,62,41,59,105,
+102,40,45,108,101,102,116,100,97,118,105,100,104,111,114,115,101,70,111,99,117,
+115,114,97,105,115,101,98,111,120,101,115,84,114,97,99,107,101,109,101,110,116,
+60,47,101,109,62,98,97,114,34,62,46,115,114,99,61,116,111,119,101,114,97,108,116
+,61,34,99,97,98,108,101,104,101,110,114,121,50,52,112,120,59,115,101,116,117,112
+,105,116,97,108,121,115,104,97,114,112,109,105,110,111,114,116,97,115,116,101,
+119,97,110,116,115,116,104,105,115,46,114,101,115,101,116,119,104,101,101,108,
+103,105,114,108,115,47,99,115,115,47,49,48,48,37,59,99,108,117,98,115,115,116,
+117,102,102,98,105,98,108,101,118,111,116,101,115,32,49,48,48,48,107,111,114,101
+,97,125,41,59,13,10,98,97,110,100,115,113,117,101,117,101,61,32,123,125,59,56,48
+,112,120,59,99,107,105,110,103,123,13,10,9,9,97,104,101,97,100,99,108,111,99,107
+,105,114,105,115,104,108,105,107,101,32,114,97,116,105,111,115,116,97,116,115,70
+,111,114,109,34,121,97,104,111,111,41,91,48,93,59,65,98,111,117,116,102,105,110,
+100,115,60,47,104,49,62,100,101,98,117,103,116,97,115,107,115,85,82,76,32,61,99,
+101,108,108,115,125,41,40,41,59,49,50,112,120,59,112,114,105,109,101,116,101,108
+,108,115,116,117,114,110,115,48,120,54,48,48,46,106,112,103,34,115,112,97,105,
+110,98,101,97,99,104,116,97,120,101,115,109,105,99,114,111,97,110,103,101,108,45
+,45,62,60,47,103,105,102,116,115,115,116,101,118,101,45,108,105,110,107,98,111,
+100,121,46,125,41,59,10,9,109,111,117,110,116,32,40,49,57,57,70,65,81,60,47,114,
+111,103,101,114,102,114,97,110,107,67,108,97,115,115,50,56,112,120,59,102,101,
+101,100,115,60,104,49,62,60,115,99,111,116,116,116,101,115,116,115,50,50,112,120
+,59,100,114,105,110,107,41,32,124,124,32,108,101,119,105,115,115,104,97,108,108,
+35,48,51,57,59,32,102,111,114,32,108,111,118,101,100,119,97,115,116,101,48,48,
+112,120,59,106,97,58,227,130,115,105,109,111,110,60,102,111,110,116,114,101,112,
+108,121,109,101,101,116,115,117,110,116,101,114,99,104,101,97,112,116,105,103,
+104,116,66,114,97,110,100,41,32,33,61,32,100,114,101,115,115,99,108,105,112,115,
+114,111,111,109,115,111,110,107,101,121,109,111,98,105,108,109,97,105,110,46,78,
+97,109,101,32,112,108,97,116,101,102,117,110,110,121,116,114,101,101,115,99,111,
+109,47,34,49,46,106,112,103,119,109,111,100,101,112,97,114,97,109,83,84,65,82,84
+,108,101,102,116,32,105,100,100,101,110,44,32,50,48,49,41,59,10,125,10,102,111,
+114,109,46,118,105,114,117,115,99,104,97,105,114,116,114,97,110,115,119,111,114,
+115,116,80,97,103,101,115,105,116,105,111,110,112,97,116,99,104,60,33,45,45,10,
+111,45,99,97,99,102,105,114,109,115,116,111,117,114,115,44,48,48,48,32,97,115,
+105,97,110,105,43,43,41,123,97,100,111,98,101,39,41,91,48,93,105,100,61,49,48,98
+,111,116,104,59,109,101,110,117,32,46,50,46,109,105,46,112,110,103,34,107,101,
+118,105,110,99,111,97,99,104,67,104,105,108,100,98,114,117,99,101,50,46,106,112,
+103,85,82,76,41,43,46,106,112,103,124,115,117,105,116,101,115,108,105,99,101,104
+,97,114,114,121,49,50,48,34,32,115,119,101,101,116,116,114,62,13,10,110,97,109,
+101,61,100,105,101,103,111,112,97,103,101,32,115,119,105,115,115,45,45,62,10,10,
+35,102,102,102,59,34,62,76,111,103,46,99,111,109,34,116,114,101,97,116,115,104,
+101,101,116,41,32,38,38,32,49,52,112,120,59,115,108,101,101,112,110,116,101,110,
+116,102,105,108,101,100,106,97,58,227,131,105,100,61,34,99,78,97,109,101,34,119,
+111,114,115,101,115,104,111,116,115,45,98,111,120,45,100,101,108,116,97,10,38,
+108,116,59,98,101,97,114,115,58,52,56,90,60,100,97,116,97,45,114,117,114,97,108,
+60,47,97,62,32,115,112,101,110,100,98,97,107,101,114,115,104,111,112,115,61,32,
+34,34,59,112,104,112,34,62,99,116,105,111,110,49,51,112,120,59,98,114,105,97,110
+,104,101,108,108,111,115,105,122,101,61,111,61,37,50,70,32,106,111,105,110,109,
+97,121,98,101,60,105,109,103,32,105,109,103,34,62,44,32,102,106,115,105,109,103,
+34,32,34,41,91,48,93,77,84,111,112,66,84,121,112,101,34,110,101,119,108,121,68,
+97,110,115,107,99,122,101,99,104,116,114,97,105,108,107,110,111,119,115,60,47,
+104,53,62,102,97,113,34,62,122,104,45,99,110,49,48,41,59,10,45,49,34,41,59,116,
+121,112,101,61,98,108,117,101,115,116,114,117,108,121,100,97,118,105,115,46,106,
+115,39,59,62,13,10,60,33,115,116,101,101,108,32,121,111,117,32,104,50,62,13,10,
+102,111,114,109,32,106,101,115,117,115,49,48,48,37,32,109,101,110,117,46,13,10,9
+,13,10,119,97,108,101,115,114,105,115,107,115,117,109,101,110,116,100,100,105,
+110,103,98,45,108,105,107,116,101,97,99,104,103,105,102,34,32,118,101,103,97,115
+,100,97,110,115,107,101,101,115,116,105,115,104,113,105,112,115,117,111,109,105,
+115,111,98,114,101,100,101,115,100,101,101,110,116,114,101,116,111,100,111,115,
+112,117,101,100,101,97,195,177,111,115,101,115,116,195,161,116,105,101,110,101,
+104,97,115,116,97,111,116,114,111,115,112,97,114,116,101,100,111,110,100,101,110
+,117,101,118,111,104,97,99,101,114,102,111,114,109,97,109,105,115,109,111,109,
+101,106,111,114,109,117,110,100,111,97,113,117,195,173,100,195,173,97,115,115,
+195,179,108,111,97,121,117,100,97,102,101,99,104,97,116,111,100,97,115,116,97,
+110,116,111,109,101,110,111,115,100,97,116,111,115,111,116,114,97,115,115,105,
+116,105,111,109,117,99,104,111,97,104,111,114,97,108,117,103,97,114,109,97,121,
+111,114,101,115,116,111,115,104,111,114,97,115,116,101,110,101,114,97,110,116,
+101,115,102,111,116,111,115,101,115,116,97,115,112,97,195,173,115,110,117,101,
+118,97,115,97,108,117,100,102,111,114,111,115,109,101,100,105,111,113,117,105,
+101,110,109,101,115,101,115,112,111,100,101,114,99,104,105,108,101,115,101,114,
+195,161,118,101,99,101,115,100,101,99,105,114,106,111,115,195,169,101,115,116,97
+,114,118,101,110,116,97,103,114,117,112,111,104,101,99,104,111,101,108,108,111,
+115,116,101,110,103,111,97,109,105,103,111,99,111,115,97,115,110,105,118,101,108
+,103,101,110,116,101,109,105,115,109,97,97,105,114,101,115,106,117,108,105,111,
+116,101,109,97,115,104,97,99,105,97,102,97,118,111,114,106,117,110,105,111,108,
+105,98,114,101,112,117,110,116,111,98,117,101,110,111,97,117,116,111,114,97,98,
+114,105,108,98,117,101,110,97,116,101,120,116,111,109,97,114,122,111,115,97,98,
+101,114,108,105,115,116,97,108,117,101,103,111,99,195,179,109,111,101,110,101,
+114,111,106,117,101,103,111,112,101,114,195,186,104,97,98,101,114,101,115,116,
+111,121,110,117,110,99,97,109,117,106,101,114,118,97,108,111,114,102,117,101,114
+,97,108,105,98,114,111,103,117,115,116,97,105,103,117,97,108,118,111,116,111,115
+,99,97,115,111,115,103,117,195,173,97,112,117,101,100,111,115,111,109,111,115,97
+,118,105,115,111,117,115,116,101,100,100,101,98,101,110,110,111,99,104,101,98,
+117,115,99,97,102,97,108,116,97,101,117,114,111,115,115,101,114,105,101,100,105,
+99,104,111,99,117,114,115,111,99,108,97,118,101,99,97,115,97,115,108,101,195,179
+,110,112,108,97,122,111,108,97,114,103,111,111,98,114,97,115,118,105,115,116,97,
+97,112,111,121,111,106,117,110,116,111,116,114,97,116,97,118,105,115,116,111,99,
+114,101,97,114,99,97,109,112,111,104,101,109,111,115,99,105,110,99,111,99,97,114
+,103,111,112,105,115,111,115,111,114,100,101,110,104,97,99,101,110,195,161,114,
+101,97,100,105,115,99,111,112,101,100,114,111,99,101,114,99,97,112,117,101,100,
+97,112,97,112,101,108,109,101,110,111,114,195,186,116,105,108,99,108,97,114,111,
+106,111,114,103,101,99,97,108,108,101,112,111,110,101,114,116,97,114,100,101,110
+,97,100,105,101,109,97,114,99,97,115,105,103,117,101,101,108,108,97,115,115,105,
+103,108,111,99,111,99,104,101,109,111,116,111,115,109,97,100,114,101,99,108,97,
+115,101,114,101,115,116,111,110,105,195,177,111,113,117,101,100,97,112,97,115,97
+,114,98,97,110,99,111,104,105,106,111,115,118,105,97,106,101,112,97,98,108,111,
+195,169,115,116,101,118,105,101,110,101,114,101,105,110,111,100,101,106,97,114,
+102,111,110,100,111,99,97,110,97,108,110,111,114,116,101,108,101,116,114,97,99,
+97,117,115,97,116,111,109,97,114,109,97,110,111,115,108,117,110,101,115,97,117,
+116,111,115,118,105,108,108,97,118,101,110,100,111,112,101,115,97,114,116,105,
+112,111,115,116,101,110,103,97,109,97,114,99,111,108,108,101,118,97,112,97,100,
+114,101,117,110,105,100,111,118,97,109,111,115,122,111,110,97,115,97,109,98,111,
+115,98,97,110,100,97,109,97,114,105,97,97,98,117,115,111,109,117,99,104,97,115,
+117,98,105,114,114,105,111,106,97,118,105,118,105,114,103,114,97,100,111,99,104,
+105,99,97,97,108,108,195,173,106,111,118,101,110,100,105,99,104,97,101,115,116,
+97,110,116,97,108,101,115,115,97,108,105,114,115,117,101,108,111,112,101,115,111
+,115,102,105,110,101,115,108,108,97,109,97,98,117,115,99,111,195,169,115,116,97,
+108,108,101,103,97,110,101,103,114,111,112,108,97,122,97,104,117,109,111,114,112
+,97,103,97,114,106,117,110,116,97,100,111,98,108,101,105,115,108,97,115,98,111,
+108,115,97,98,97,195,177,111,104,97,98,108,97,108,117,99,104,97,195,129,114,101,
+97,100,105,99,101,110,106,117,103,97,114,110,111,116,97,115,118,97,108,108,101,
+97,108,108,195,161,99,97,114,103,97,100,111,108,111,114,97,98,97,106,111,101,115
+,116,195,169,103,117,115,116,111,109,101,110,116,101,109,97,114,105,111,102,105,
+114,109,97,99,111,115,116,111,102,105,99,104,97,112,108,97,116,97,104,111,103,97
+,114,97,114,116,101,115,108,101,121,101,115,97,113,117,101,108,109,117,115,101,
+111,98,97,115,101,115,112,111,99,111,115,109,105,116,97,100,99,105,101,108,111,
+99,104,105,99,111,109,105,101,100,111,103,97,110,97,114,115,97,110,116,111,101,
+116,97,112,97,100,101,98,101,115,112,108,97,121,97,114,101,100,101,115,115,105,
+101,116,101,99,111,114,116,101,99,111,114,101,97,100,117,100,97,115,100,101,115,
+101,111,118,105,101,106,111,100,101,115,101,97,97,103,117,97,115,38,113,117,111,
+116,59,100,111,109,97,105,110,99,111,109,109,111,110,115,116,97,116,117,115,101,
+118,101,110,116,115,109,97,115,116,101,114,115,121,115,116,101,109,97,99,116,105
+,111,110,98,97,110,110,101,114,114,101,109,111,118,101,115,99,114,111,108,108,
+117,112,100,97,116,101,103,108,111,98,97,108,109,101,100,105,117,109,102,105,108
+,116,101,114,110,117,109,98,101,114,99,104,97,110,103,101,114,101,115,117,108,
+116,112,117,98,108,105,99,115,99,114,101,101,110,99,104,111,111,115,101,110,111,
+114,109,97,108,116,114,97,118,101,108,105,115,115,117,101,115,115,111,117,114,99
+,101,116,97,114,103,101,116,115,112,114,105,110,103,109,111,100,117,108,101,109,
+111,98,105,108,101,115,119,105,116,99,104,112,104,111,116,111,115,98,111,114,100
+,101,114,114,101,103,105,111,110,105,116,115,101,108,102,115,111,99,105,97,108,
+97,99,116,105,118,101,99,111,108,117,109,110,114,101,99,111,114,100,102,111,108,
+108,111,119,116,105,116,108,101,62,101,105,116,104,101,114,108,101,110,103,116,
+104,102,97,109,105,108,121,102,114,105,101,110,100,108,97,121,111,117,116,97,117
+,116,104,111,114,99,114,101,97,116,101,114,101,118,105,101,119,115,117,109,109,
+101,114,115,101,114,118,101,114,112,108,97,121,101,100,112,108,97,121,101,114,
+101,120,112,97,110,100,112,111,108,105,99,121,102,111,114,109,97,116,100,111,117
+,98,108,101,112,111,105,110,116,115,115,101,114,105,101,115,112,101,114,115,111,
+110,108,105,118,105,110,103,100,101,115,105,103,110,109,111,110,116,104,115,102,
+111,114,99,101,115,117,110,105,113,117,101,119,101,105,103,104,116,112,101,111,
+112,108,101,101,110,101,114,103,121,110,97,116,117,114,101,115,101,97,114,99,104
+,102,105,103,117,114,101,104,97,118,105,110,103,99,117,115,116,111,109,111,102,
+102,115,101,116,108,101,116,116,101,114,119,105,110,100,111,119,115,117,98,109,
+105,116,114,101,110,100,101,114,103,114,111,117,112,115,117,112,108,111,97,100,
+104,101,97,108,116,104,109,101,116,104,111,100,118,105,100,101,111,115,115,99,
+104,111,111,108,102,117,116,117,114,101,115,104,97,100,111,119,100,101,98,97,116
+,101,118,97,108,117,101,115,79,98,106,101,99,116,111,116,104,101,114,115,114,105
+,103,104,116,115,108,101,97,103,117,101,99,104,114,111,109,101,115,105,109,112,
+108,101,110,111,116,105,99,101,115,104,97,114,101,100,101,110,100,105,110,103,
+115,101,97,115,111,110,114,101,112,111,114,116,111,110,108,105,110,101,115,113,
+117,97,114,101,98,117,116,116,111,110,105,109,97,103,101,115,101,110,97,98,108,
+101,109,111,118,105,110,103,108,97,116,101,115,116,119,105,110,116,101,114,70,
+114,97,110,99,101,112,101,114,105,111,100,115,116,114,111,110,103,114,101,112,
+101,97,116,76,111,110,100,111,110,100,101,116,97,105,108,102,111,114,109,101,100
+,100,101,109,97,110,100,115,101,99,117,114,101,112,97,115,115,101,100,116,111,
+103,103,108,101,112,108,97,99,101,115,100,101,118,105,99,101,115,116,97,116,105,
+99,99,105,116,105,101,115,115,116,114,101,97,109,121,101,108,108,111,119,97,116,
+116,97,99,107,115,116,114,101,101,116,102,108,105,103,104,116,104,105,100,100,
+101,110,105,110,102,111,34,62,111,112,101,110,101,100,117,115,101,102,117,108,
+118,97,108,108,101,121,99,97,117,115,101,115,108,101,97,100,101,114,115,101,99,
+114,101,116,115,101,99,111,110,100,100,97,109,97,103,101,115,112,111,114,116,115
+,101,120,99,101,112,116,114,97,116,105,110,103,115,105,103,110,101,100,116,104,
+105,110,103,115,101,102,102,101,99,116,102,105,101,108,100,115,115,116,97,116,
+101,115,111,102,102,105,99,101,118,105,115,117,97,108,101,100,105,116,111,114,
+118,111,108,117,109,101,82,101,112,111,114,116,109,117,115,101,117,109,109,111,
+118,105,101,115,112,97,114,101,110,116,97,99,99,101,115,115,109,111,115,116,108,
+121,109,111,116,104,101,114,34,32,105,100,61,34,109,97,114,107,101,116,103,114,
+111,117,110,100,99,104,97,110,99,101,115,117,114,118,101,121,98,101,102,111,114,
+101,115,121,109,98,111,108,109,111,109,101,110,116,115,112,101,101,99,104,109,
+111,116,105,111,110,105,110,115,105,100,101,109,97,116,116,101,114,67,101,110,
+116,101,114,111,98,106,101,99,116,101,120,105,115,116,115,109,105,100,100,108,
+101,69,117,114,111,112,101,103,114,111,119,116,104,108,101,103,97,99,121,109,97,
+110,110,101,114,101,110,111,117,103,104,99,97,114,101,101,114,97,110,115,119,101
+,114,111,114,105,103,105,110,112,111,114,116,97,108,99,108,105,101,110,116,115,
+101,108,101,99,116,114,97,110,100,111,109,99,108,111,115,101,100,116,111,112,105
+,99,115,99,111,109,105,110,103,102,97,116,104,101,114,111,112,116,105,111,110,
+115,105,109,112,108,121,114,97,105,115,101,100,101,115,99,97,112,101,99,104,111,
+115,101,110,99,104,117,114,99,104,100,101,102,105,110,101,114,101,97,115,111,110
+,99,111,114,110,101,114,111,117,116,112,117,116,109,101,109,111,114,121,105,102,
+114,97,109,101,112,111,108,105,99,101,109,111,100,101,108,115,78,117,109,98,101,
+114,100,117,114,105,110,103,111,102,102,101,114,115,115,116,121,108,101,115,107,
+105,108,108,101,100,108,105,115,116,101,100,99,97,108,108,101,100,115,105,108,
+118,101,114,109,97,114,103,105,110,100,101,108,101,116,101,98,101,116,116,101,
+114,98,114,111,119,115,101,108,105,109,105,116,115,71,108,111,98,97,108,115,105,
+110,103,108,101,119,105,100,103,101,116,99,101,110,116,101,114,98,117,100,103,
+101,116,110,111,119,114,97,112,99,114,101,100,105,116,99,108,97,105,109,115,101,
+110,103,105,110,101,115,97,102,101,116,121,99,104,111,105,99,101,115,112,105,114
+,105,116,45,115,116,121,108,101,115,112,114,101,97,100,109,97,107,105,110,103,
+110,101,101,100,101,100,114,117,115,115,105,97,112,108,101,97,115,101,101,120,
+116,101,110,116,83,99,114,105,112,116,98,114,111,107,101,110,97,108,108,111,119,
+115,99,104,97,114,103,101,100,105,118,105,100,101,102,97,99,116,111,114,109,101,
+109,98,101,114,45,98,97,115,101,100,116,104,101,111,114,121,99,111,110,102,105,
+103,97,114,111,117,110,100,119,111,114,107,101,100,104,101,108,112,101,100,67,
+104,117,114,99,104,105,109,112,97,99,116,115,104,111,117,108,100,97,108,119,97,
+121,115,108,111,103,111,34,32,98,111,116,116,111,109,108,105,115,116,34,62,41,
+123,118,97,114,32,112,114,101,102,105,120,111,114,97,110,103,101,72,101,97,100,
+101,114,46,112,117,115,104,40,99,111,117,112,108,101,103,97,114,100,101,110,98,
+114,105,100,103,101,108,97,117,110,99,104,82,101,118,105,101,119,116,97,107,105,
+110,103,118,105,115,105,111,110,108,105,116,116,108,101,100,97,116,105,110,103,
+66,117,116,116,111,110,98,101,97,117,116,121,116,104,101,109,101,115,102,111,114
+,103,111,116,83,101,97,114,99,104,97,110,99,104,111,114,97,108,109,111,115,116,
+108,111,97,100,101,100,67,104,97,110,103,101,114,101,116,117,114,110,115,116,114
+,105,110,103,114,101,108,111,97,100,77,111,98,105,108,101,105,110,99,111,109,101
+,115,117,112,112,108,121,83,111,117,114,99,101,111,114,100,101,114,115,118,105,
+101,119,101,100,38,110,98,115,112,59,99,111,117,114,115,101,65,98,111,117,116,32
+,105,115,108,97,110,100,60,104,116,109,108,32,99,111,111,107,105,101,110,97,109,
+101,61,34,97,109,97,122,111,110,109,111,100,101,114,110,97,100,118,105,99,101,
+105,110,60,47,97,62,58,32,84,104,101,32,100,105,97,108,111,103,104,111,117,115,
+101,115,66,69,71,73,78,32,77,101,120,105,99,111,115,116,97,114,116,115,99,101,
+110,116,114,101,104,101,105,103,104,116,97,100,100,105,110,103,73,115,108,97,110
+,100,97,115,115,101,116,115,69,109,112,105,114,101,83,99,104,111,111,108,101,102
+,102,111,114,116,100,105,114,101,99,116,110,101,97,114,108,121,109,97,110,117,97
+,108,83,101,108,101,99,116,46,10,10,79,110,101,106,111,105,110,101,100,109,101,
+110,117,34,62,80,104,105,108,105,112,97,119,97,114,100,115,104,97,110,100,108,
+101,105,109,112,111,114,116,79,102,102,105,99,101,114,101,103,97,114,100,115,107
+,105,108,108,115,110,97,116,105,111,110,83,112,111,114,116,115,100,101,103,114,
+101,101,119,101,101,107,108,121,32,40,101,46,103,46,98,101,104,105,110,100,100,
+111,99,116,111,114,108,111,103,103,101,100,117,110,105,116,101,100,60,47,98,62,
+60,47,98,101,103,105,110,115,112,108,97,110,116,115,97,115,115,105,115,116,97,
+114,116,105,115,116,105,115,115,117,101,100,51,48,48,112,120,124,99,97,110,97,
+100,97,97,103,101,110,99,121,115,99,104,101,109,101,114,101,109,97,105,110,66,
+114,97,122,105,108,115,97,109,112,108,101,108,111,103,111,34,62,98,101,121,111,
+110,100,45,115,99,97,108,101,97,99,99,101,112,116,115,101,114,118,101,100,109,97
+,114,105,110,101,70,111,111,116,101,114,99,97,109,101,114,97,60,47,104,49,62,10,
+95,102,111,114,109,34,108,101,97,118,101,115,115,116,114,101,115,115,34,32,47,62
+,13,10,46,103,105,102,34,32,111,110,108,111,97,100,108,111,97,100,101,114,79,120
+,102,111,114,100,115,105,115,116,101,114,115,117,114,118,105,118,108,105,115,116
+,101,110,102,101,109,97,108,101,68,101,115,105,103,110,115,105,122,101,61,34,97,
+112,112,101,97,108,116,101,120,116,34,62,108,101,118,101,108,115,116,104,97,110,
+107,115,104,105,103,104,101,114,102,111,114,99,101,100,97,110,105,109,97,108,97,
+110,121,111,110,101,65,102,114,105,99,97,97,103,114,101,101,100,114,101,99,101,
+110,116,80,101,111,112,108,101,60,98,114,32,47,62,119,111,110,100,101,114,112,
+114,105,99,101,115,116,117,114,110,101,100,124,124,32,123,125,59,109,97,105,110,
+34,62,105,110,108,105,110,101,115,117,110,100,97,121,119,114,97,112,34,62,102,97
+,105,108,101,100,99,101,110,115,117,115,109,105,110,117,116,101,98,101,97,99,111
+,110,113,117,111,116,101,115,49,53,48,112,120,124,101,115,116,97,116,101,114,101
+,109,111,116,101,101,109,97,105,108,34,108,105,110,107,101,100,114,105,103,104,
+116,59,115,105,103,110,97,108,102,111,114,109,97,108,49,46,104,116,109,108,115,
+105,103,110,117,112,112,114,105,110,99,101,102,108,111,97,116,58,46,112,110,103,
+34,32,102,111,114,117,109,46,65,99,99,101,115,115,112,97,112,101,114,115,115,111
+,117,110,100,115,101,120,116,101,110,100,72,101,105,103,104,116,115,108,105,100,
+101,114,85,84,70,45,56,34,38,97,109,112,59,32,66,101,102,111,114,101,46,32,87,
+105,116,104,115,116,117,100,105,111,111,119,110,101,114,115,109,97,110,97,103,
+101,112,114,111,102,105,116,106,81,117,101,114,121,97,110,110,117,97,108,112,97,
+114,97,109,115,98,111,117,103,104,116,102,97,109,111,117,115,103,111,111,103,108
+,101,108,111,110,103,101,114,105,43,43,41,32,123,105,115,114,97,101,108,115,97,
+121,105,110,103,100,101,99,105,100,101,104,111,109,101,34,62,104,101,97,100,101,
+114,101,110,115,117,114,101,98,114,97,110,99,104,112,105,101,99,101,115,98,108,
+111,99,107,59,115,116,97,116,101,100,116,111,112,34,62,60,114,97,99,105,110,103,
+114,101,115,105,122,101,45,45,38,103,116,59,112,97,99,105,116,121,115,101,120,
+117,97,108,98,117,114,101,97,117,46,106,112,103,34,32,49,48,44,48,48,48,111,98,
+116,97,105,110,116,105,116,108,101,115,97,109,111,117,110,116,44,32,73,110,99,46
+,99,111,109,101,100,121,109,101,110,117,34,32,108,121,114,105,99,115,116,111,100
+,97,121,46,105,110,100,101,101,100,99,111,117,110,116,121,95,108,111,103,111,46,
+70,97,109,105,108,121,108,111,111,107,101,100,77,97,114,107,101,116,108,115,101,
+32,105,102,80,108,97,121,101,114,116,117,114,107,101,121,41,59,118,97,114,32,102
+,111,114,101,115,116,103,105,118,105,110,103,101,114,114,111,114,115,68,111,109,
+97,105,110,125,101,108,115,101,123,105,110,115,101,114,116,66,108,111,103,60,47,
+102,111,111,116,101,114,108,111,103,105,110,46,102,97,115,116,101,114,97,103,101
+,110,116,115,60,98,111,100,121,32,49,48,112,120,32,48,112,114,97,103,109,97,102,
+114,105,100,97,121,106,117,110,105,111,114,100,111,108,108,97,114,112,108,97,99,
+101,100,99,111,118,101,114,115,112,108,117,103,105,110,53,44,48,48,48,32,112,97,
+103,101,34,62,98,111,115,116,111,110,46,116,101,115,116,40,97,118,97,116,97,114,
+116,101,115,116,101,100,95,99,111,117,110,116,102,111,114,117,109,115,115,99,104
+,101,109,97,105,110,100,101,120,44,102,105,108,108,101,100,115,104,97,114,101,
+115,114,101,97,100,101,114,97,108,101,114,116,40,97,112,112,101,97,114,83,117,98
+,109,105,116,108,105,110,101,34,62,98,111,100,121,34,62,10,42,32,84,104,101,84,
+104,111,117,103,104,115,101,101,105,110,103,106,101,114,115,101,121,78,101,119,
+115,60,47,118,101,114,105,102,121,101,120,112,101,114,116,105,110,106,117,114,
+121,119,105,100,116,104,61,67,111,111,107,105,101,83,84,65,82,84,32,97,99,114,
+111,115,115,95,105,109,97,103,101,116,104,114,101,97,100,110,97,116,105,118,101,
+112,111,99,107,101,116,98,111,120,34,62,10,83,121,115,116,101,109,32,68,97,118,
+105,100,99,97,110,99,101,114,116,97,98,108,101,115,112,114,111,118,101,100,65,
+112,114,105,108,32,114,101,97,108,108,121,100,114,105,118,101,114,105,116,101,
+109,34,62,109,111,114,101,34,62,98,111,97,114,100,115,99,111,108,111,114,115,99,
+97,109,112,117,115,102,105,114,115,116,32,124,124,32,91,93,59,109,101,100,105,97
+,46,103,117,105,116,97,114,102,105,110,105,115,104,119,105,100,116,104,58,115,
+104,111,119,101,100,79,116,104,101,114,32,46,112,104,112,34,32,97,115,115,117,
+109,101,108,97,121,101,114,115,119,105,108,115,111,110,115,116,111,114,101,115,
+114,101,108,105,101,102,115,119,101,100,101,110,67,117,115,116,111,109,101,97,
+115,105,108,121,32,121,111,117,114,32,83,116,114,105,110,103,10,10,87,104,105,
+108,116,97,121,108,111,114,99,108,101,97,114,58,114,101,115,111,114,116,102,114,
+101,110,99,104,116,104,111,117,103,104,34,41,32,43,32,34,60,98,111,100,121,62,98
+,117,121,105,110,103,98,114,97,110,100,115,77,101,109,98,101,114,110,97,109,101,
+34,62,111,112,112,105,110,103,115,101,99,116,111,114,53,112,120,59,34,62,118,115
+,112,97,99,101,112,111,115,116,101,114,109,97,106,111,114,32,99,111,102,102,101,
+101,109,97,114,116,105,110,109,97,116,117,114,101,104,97,112,112,101,110,60,47,
+110,97,118,62,107,97,110,115,97,115,108,105,110,107,34,62,73,109,97,103,101,115,
+61,102,97,108,115,101,119,104,105,108,101,32,104,115,112,97,99,101,48,38,97,109,
+112,59,32,10,10,73,110,32,32,112,111,119,101,114,80,111,108,115,107,105,45,99,
+111,108,111,114,106,111,114,100,97,110,66,111,116,116,111,109,83,116,97,114,116,
+32,45,99,111,117,110,116,50,46,104,116,109,108,110,101,119,115,34,62,48,49,46,
+106,112,103,79,110,108,105,110,101,45,114,105,103,104,116,109,105,108,108,101,
+114,115,101,110,105,111,114,73,83,66,78,32,48,48,44,48,48,48,32,103,117,105,100,
+101,115,118,97,108,117,101,41,101,99,116,105,111,110,114,101,112,97,105,114,46,
+120,109,108,34,32,32,114,105,103,104,116,115,46,104,116,109,108,45,98,108,111,99
+,107,114,101,103,69,120,112,58,104,111,118,101,114,119,105,116,104,105,110,118,
+105,114,103,105,110,112,104,111,110,101,115,60,47,116,114,62,13,117,115,105,110,
+103,32,10,9,118,97,114,32,62,39,41,59,10,9,60,47,116,100,62,10,60,47,116,114,62,
+10,98,97,104,97,115,97,98,114,97,115,105,108,103,97,108,101,103,111,109,97,103,
+121,97,114,112,111,108,115,107,105,115,114,112,115,107,105,216,177,216,175,217,
+136,228,184,173,230,150,135,231,174,128,228,189,147,231,185,129,233,171,148,228,
+191,161,230,129,175,228,184,173,229,155,189,230,136,145,228,187,172,228,184,128,
+228,184,170,229,133,172,229,143,184,231,174,161,231,144,134,232,174,186,229,157,
+155,229,143,175,228,187,165,230,156,141,229,138,161,230,151,182,233,151,180,228,
+184,170,228,186,186,228,186,167,229,147,129,232,135,170,229,183,177,228,188,129,
+228,184,154,230,159,165,231,156,139,229,183,165,228,189,156,232,129,148,231,179,
+187,230,178,161,230,156,137,231,189,145,231,171,153,230,137,128,230,156,137,232,
+175,132,232,174,186,228,184,173,229,191,131,230,150,135,231,171,160,231,148,168,
+230,136,183,233,166,150,233,161,181,228,189,156,232,128,133,230,138,128,230,156,
+175,233,151,174,233,162,152,231,155,184,229,133,179,228,184,139,232,189,189,230,
+144,156,231,180,162,228,189,191,231,148,168,232,189,175,228,187,182,229,156,168,
+231,186,191,228,184,187,233,162,152,232,181,132,230,150,153,232,167,134,233,162,
+145,229,155,158,229,164,141,230,179,168,229,134,140,231,189,145,231,187,156,230,
+148,182,232,151,143,229,134,133,229,174,185,230,142,168,232,141,144,229,184,130,
+229,156,186,230,182,136,230,129,175,231,169,186,233,151,180,229,143,145,229,184,
+131,228,187,128,228,185,136,229,165,189,229,143,139,231,148,159,230,180,187,229,
+155,190,231,137,135,229,143,145,229,177,149,229,166,130,230,158,156,230,137,139,
+230,156,186,230,150,176,233,151,187,230,156,128,230,150,176,230,150,185,229,188,
+143,229,140,151,228,186,172,230,143,144,228,190,155,229,133,179,228,186,142,230,
+155,180,229,164,154,232,191,153,228,184,170,231,179,187,231,187,159,231,159,165,
+233,129,147,230,184,184,230,136,143,229,185,191,229,145,138,229,133,182,228,187,
+150,229,143,145,232,161,168,229,174,137,229,133,168,231,172,172,228,184,128,228,
+188,154,229,145,152,232,191,155,232,161,140,231,130,185,229,135,187,231,137,136,
+230,157,131,231,148,181,229,173,144,228,184,150,231,149,140,232,174,190,232,174,
+161,229,133,141,232,180,185,230,149,153,232,130,178,229,138,160,229,133,165,230,
+180,187,229,138,168,228,187,150,228,187,172,229,149,134,229,147,129,229,141,154,
+229,174,162,231,142,176,229,156,168,228,184,138,230,181,183,229,166,130,228,189,
+149,229,183,178,231,187,143,231,149,153,232,168,128,232,175,166,231,187,134,231,
+164,190,229,140,186,231,153,187,229,189,149,230,156,172,231,171,153,233,156,128,
+232,166,129,228,187,183,230,160,188,230,148,175,230,140,129,229,155,189,233,153,
+133,233,147,190,230,142,165,229,155,189,229,174,182,229,187,186,232,174,190,230,
+156,139,229,143,139,233,152,133,232,175,187,230,179,149,229,190,139,228,189,141,
+231,189,174,231,187,143,230,181,142,233,128,137,230,139,169,232,191,153,230,160,
+183,229,189,147,229,137,141,229,136,134,231,177,187,230,142,146,232,161,140,229,
+155,160,228,184,186,228,186,164,230,152,147,230,156,128,229,144,142,233,159,179,
+228,185,144,228,184,141,232,131,189,233,128,154,232,191,135,232,161,140,228,184,
+154,231,167,145,230,138,128,229,143,175,232,131,189,232,174,190,229,164,135,229,
+144,136,228,189,156,229,164,167,229,174,182,231,164,190,228,188,154,231,160,148,
+231,169,182,228,184,147,228,184,154,229,133,168,233,131,168,233,161,185,231,155,
+174,232,191,153,233,135,140,232,191,152,230,152,175,229,188,128,229,167,139,230,
+131,133,229,134,181,231,148,181,232,132,145,230,150,135,228,187,182,229,147,129,
+231,137,140,229,184,174,229,138,169,230,150,135,229,140,150,232,181,132,230,186,
+144,229,164,167,229,173,166,229,173,166,228,185,160,229,156,176,229,157,128,230,
+181,143,232,167,136,230,138,149,232,181,132,229,183,165,231,168,139,232,166,129,
+230,177,130,230,128,142,228,185,136,230,151,182,229,128,153,229,138,159,232,131,
+189,228,184,187,232,166,129,231,155,174,229,137,141,232,181,132,232,174,175,229,
+159,142,229,184,130,230,150,185,230,179,149,231,148,181,229,189,177,230,139,155,
+232,129,152,229,163,176,230,152,142,228,187,187,228,189,149,229,129,165,229,186,
+183,230,149,176,230,141,174,231,190,142,229,155,189,230,177,189,232,189,166,228,
+187,139,231,187,141,228,189,134,230,152,175,228,186,164,230,181,129,231,148,159,
+228,186,167,230,137,128,228,187,165,231,148,181,232,175,157,230,152,190,231,164,
+186,228,184,128,228,186,155,229,141,149,228,189,141,228,186,186,229,145,152,229,
+136,134,230,158,144,229,156,176,229,155,190,230,151,133,230,184,184,229,183,165,
+229,133,183,229,173,166,231,148,159,231,179,187,229,136,151,231,189,145,229,143,
+139,229,184,150,229,173,144,229,175,134,231,160,129,233,162,145,233,129,147,230,
+142,167,229,136,182,229,156,176,229,140,186,229,159,186,230,156,172,229,133,168,
+229,155,189,231,189,145,228,184,138,233,135,141,232,166,129,231,172,172,228,186,
+140,229,150,156,230,172,162,232,191,155,229,133,165,229,143,139,230,131,133,232,
+191,153,228,186,155,232,128,131,232,175,149,229,143,145,231,142,176,229,159,185,
+232,174,173,228,187,165,228,184,138,230,148,191,229,186,156,230,136,144,228,184,
+186,231,142,175,229,162,131,233,166,153,230,184,175,229,144,140,230,151,182,229,
+168,177,228,185,144,229,143,145,233,128,129,228,184,128,229,174,154,229,188,128,
+229,143,145,228,189,156,229,147,129,230,160,135,229,135,134,230,172,162,232,191,
+142,232,167,163,229,134,179,229,156,176,230,150,185,228,184,128,228,184,139,228,
+187,165,229,143,138,232,180,163,228,187,187,230,136,150,232,128,133,229,174,162,
+230,136,183,228,187,163,232,161,168,231,167,175,229,136,134,229,165,179,228,186,
+186,230,149,176,231,160,129,233,148,128,229,148,174,229,135,186,231,142,176,231,
+166,187,231,186,191,229,186,148,231,148,168,229,136,151,232,161,168,228,184,141,
+229,144,140,231,188,150,232,190,145,231,187,159,232,174,161,230,159,165,232,175,
+162,228,184,141,232,166,129,230,156,137,229,133,179,230,156,186,230,158,132,229,
+190,136,229,164,154,230,146,173,230,148,190,231,187,132,231,187,135,230,148,191,
+231,173,150,231,155,180,230,142,165,232,131,189,229,138,155,230,157,165,230,186,
+144,230,153,130,233,150,147,231,156,139,229,136,176,231,131,173,233,151,168,229,
+133,179,233,148,174,228,184,147,229,140,186,233,157,158,229,184,184,232,139,177,
+232,175,173,231,153,190,229,186,166,229,184,140,230,156,155,231,190,142,229,165,
+179,230,175,148,232,190,131,231,159,165,232,175,134,232,167,132,229,174,154,229,
+187,186,232,174,174,233,131,168,233,151,168,230,132,143,232,167,129,231,178,190,
+229,189,169,230,151,165,230,156,172,230,143,144,233,171,152,229,143,145,232,168,
+128,230,150,185,233,157,162,229,159,186,233,135,145,229,164,132,231,144,134,230,
+157,131,233,153,144,229,189,177,231,137,135,233,147,182,232,161,140,232,191,152,
+230,156,137,229,136,134,228,186,171,231,137,169,229,147,129,231,187,143,232,144,
+165,230,183,187,229,138,160,228,184,147,229,174,182,232,191,153,231,167,141,232,
+175,157,233,162,152,232,181,183,230,157,165,228,184,154,229,138,161,229,133,172,
+229,145,138,232,174,176,229,189,149,231,174,128,228,187,139,232,180,168,233,135,
+143,231,148,183,228,186,186,229,189,177,229,147,141,229,188,149,231,148,168,230,
+138,165,229,145,138,233,131,168,229,136,134,229,191,171,233,128,159,229,146,168,
+232,175,162,230,151,182,229,176,154,230,179,168,230,132,143,231,148,179,232,175,
+183,229,173,166,230,160,161,229,186,148,232,175,165,229,142,134,229,143,178,229,
+143,170,230,152,175,232,191,148,229,155,158,232,180,173,228,185,176,229,144,141,
+231,167,176,228,184,186,228,186,134,230,136,144,229,138,159,232,175,180,230,152,
+142,228,190,155,229,186,148,229,173,169,229,173,144,228,184,147,233,162,152,231,
+168,139,229,186,143,228,184,128,232,136,172,230,156,131,229,147,161,229,143,170,
+230,156,137,229,133,182,229,174,131,228,191,157,230,138,164,232,128,140,228,184,
+148,228,187,138,229,164,169,231,170,151,229,143,163,229,138,168,230,128,129,231,
+138,182,230,128,129,231,137,185,229,136,171,232,174,164,228,184,186,229,191,133,
+233,161,187,230,155,180,230,150,176,229,176,143,232,175,180,230,136,145,229,128,
+145,228,189,156,228,184,186,229,170,146,228,189,147,229,140,133,230,139,172,233,
+130,163,228,185,136,228,184,128,230,160,183,229,155,189,229,134,133,230,152,175,
+229,144,166,230,160,185,230,141,174,231,148,181,232,167,134,229,173,166,233,153,
+162,229,133,183,230,156,137,232,191,135,231,168,139,231,148,177,228,186,142,228,
+186,186,230,137,141,229,135,186,230,157,165,228,184,141,232,191,135,230,173,163,
+229,156,168,230,152,142,230,152,159,230,149,133,228,186,139,229,133,179,231,179,
+187,230,160,135,233,162,152,229,149,134,229,138,161,232,190,147,229,133,165,228,
+184,128,231,155,180,229,159,186,231,161,128,230,149,153,229,173,166,228,186,134,
+232,167,163,229,187,186,231,173,145,231,187,147,230,158,156,229,133,168,231,144,
+131,233,128,154,231,159,165,232,174,161,229,136,146,229,175,185,228,186,142,232,
+137,186,230,156,175,231,155,184,229,134,140,229,143,145,231,148,159,231,156,159,
+231,154,132,229,187,186,231,171,139,231,173,137,231,186,167,231,177,187,229,158,
+139,231,187,143,233,170,140,229,174,158,231,142,176,229,136,182,228,189,156,230,
+157,165,232,135,170,230,160,135,231,173,190,228,187,165,228,184,139,229,142,159,
+229,136,155,230,151,160,230,179,149,229,133,182,228,184,173,229,128,139,228,186,
+186,228,184,128,229,136,135,230,140,135,229,141,151,229,133,179,233,151,173,233,
+155,134,229,155,162,231,172,172,228,184,137,229,133,179,230,179,168,229,155,160,
+230,173,164,231,133,167,231,137,135,230,183,177,229,156,179,229,149,134,228,184,
+154,229,185,191,229,183,158,230,151,165,230,156,159,233,171,152,231,186,167,230,
+156,128,232,191,145,231,187,188,229,144,136,232,161,168,231,164,186,228,184,147,
+232,190,145,232,161,140,228,184,186,228,186,164,233,128,154,232,175,132,228,187,
+183,232,167,137,229,190,151,231,178,190,229,141,142,229,174,182,229,186,173,229,
+174,140,230,136,144,230,132,159,232,167,137,229,174,137,232,163,133,229,190,151,
+229,136,176,233,130,174,228,187,182,229,136,182,229,186,166,233,163,159,229,147,
+129,232,153,189,231,132,182,232,189,172,232,189,189,230,138,165,228,187,183,232,
+174,176,232,128,133,230,150,185,230,161,136,232,161,140,230,148,191,228,186,186,
+230,176,145,231,148,168,229,147,129,228,184,156,232,165,191,230,143,144,229,135,
+186,233,133,146,229,186,151,231,132,182,229,144,142,228,187,152,230,172,190,231,
+131,173,231,130,185,228,187,165,229,137,141,229,174,140,229,133,168,229,143,145,
+229,184,150,232,174,190,231,189,174,233,162,134,229,175,188,229,183,165,228,184,
+154,229,140,187,233,153,162,231,156,139,231,156,139,231,187,143,229,133,184,229,
+142,159,229,155,160,229,185,179,229,143,176,229,144,132,231,167,141,229,162,158,
+229,138,160,230,157,144,230,150,153,230,150,176,229,162,158,228,185,139,229,144,
+142,232,129,140,228,184,154,230,149,136,230,158,156,228,187,138,229,185,180,232,
+174,186,230,150,135,230,136,145,229,155,189,229,145,138,232,175,137,231,137,136,
+228,184,187,228,191,174,230,148,185,229,143,130,228,184,142,230,137,147,229,141,
+176,229,191,171,228,185,144,230,156,186,230,162,176,232,167,130,231,130,185,229,
+173,152,229,156,168,231,178,190,231,165,158,232,142,183,229,190,151,229,136,169,
+231,148,168,231,187,167,231,187,173,228,189,160,228,187,172,232,191,153,228,185,
+136,230,168,161,229,188,143,232,175,173,232,168,128,232,131,189,229,164,159,233,
+155,133,232,153,142,230,147,141,228,189,156,233,163,142,230,160,188,228,184,128,
+232,181,183,231,167,145,229,173,166,228,189,147,232,130,178,231,159,173,228,191,
+161,230,157,161,228,187,182,230,178,187,231,150,151,232,191,144,229,138,168,228,
+186,167,228,184,154,228,188,154,232,174,174,229,175,188,232,136,170,229,133,136,
+231,148,159,232,129,148,231,155,159,229,143,175,230,152,175,229,149,143,233,161,
+140,231,187,147,230,158,132,228,189,156,231,148,168,232,176,131,230,159,165,232,
+179,135,230,150,153,232,135,170,229,138,168,232,180,159,232,180,163,229,134,156,
+228,184,154,232,174,191,233,151,174,229,174,158,230,150,189,230,142,165,229,143,
+151,232,174,168,232,174,186,233,130,163,228,184,170,229,143,141,233,166,136,229,
+138,160,229,188,186,229,165,179,230,128,167,232,140,131,229,155,180,230,156,141,
+229,139,153,228,188,145,233,151,178,228,187,138,230,151,165,229,174,162,230,156,
+141,232,167,128,231,156,139,229,143,130,229,138,160,231,154,132,232,175,157,228,
+184,128,231,130,185,228,191,157,232,175,129,229,155,190,228,185,166,230,156,137,
+230,149,136,230,181,139,232,175,149,231,167,187,229,138,168,230,137,141,232,131,
+189,229,134,179,229,174,154,232,130,161,231,165,168,228,184,141,230,150,173,233,
+156,128,230,177,130,228,184,141,229,190,151,229,138,158,230,179,149,228,185,139,
+233,151,180,233,135,135,231,148,168,232,144,165,233,148,128,230,138,149,232,175,
+137,231,155,174,230,160,135,231,136,177,230,131,133,230,145,132,229,189,177,230,
+156,137,228,186,155,232,164,135,232,163,189,230,150,135,229,173,166,230,156,186,
+228,188,154,230,149,176,229,173,151,232,163,133,228,191,174,232,180,173,231,137,
+169,229,134,156,230,157,145,229,133,168,233,157,162,231,178,190,229,147,129,229,
+133,182,229,174,158,228,186,139,230,131,133,230,176,180,229,185,179,230,143,144,
+231,164,186,228,184,138,229,184,130,232,176,162,232,176,162,230,153,174,233,128,
+154,230,149,153,229,184,136,228,184,138,228,188,160,231,177,187,229,136,171,230,
+173,140,230,155,178,230,139,165,230,156,137,229,136,155,230,150,176,233,133,141,
+228,187,182,229,143,170,232,166,129,230,151,182,228,187,163,232,179,135,232,168,
+138,232,190,190,229,136,176,228,186,186,231,148,159,232,174,162,233,152,133,232,
+128,129,229,184,136,229,177,149,231,164,186,229,191,131,231,144,134,232,180,180,
+229,173,144,231,182,178,231,171,153,228,184,187,233,161,140,232,135,170,231,132,
+182,231,186,167,229,136,171,231,174,128,229,141,149,230,148,185,233,157,169,233,
+130,163,228,186,155,230,157,165,232,175,180,230,137,147,229,188,128,228,187,163,
+231,160,129,229,136,160,233,153,164,232,175,129,229,136,184,232,138,130,231,155,
+174,233,135,141,231,130,185,230,172,161,230,149,184,229,164,154,229,176,145,232,
+167,132,229,136,146,232,181,132,233,135,145,230,137,190,229,136,176,228,187,165,
+229,144,142,229,164,167,229,133,168,228,184,187,233,161,181,230,156,128,228,189,
+179,229,155,158,231,173,148,229,164,169,228,184,139,228,191,157,233,154,156,231,
+142,176,228,187,163,230,163,128,230,159,165,230,138,149,231,165,168,229,176,143,
+230,151,182,230,178,146,230,156,137,230,173,163,229,184,184,231,148,154,232,135,
+179,228,187,163,231,144,134,231,155,174,229,189,149,229,133,172,229,188,128,229,
+164,141,229,136,182,233,135,145,232,158,141,229,185,184,231,166,143,231,137,136,
+230,156,172,229,189,162,230,136,144,229,135,134,229,164,135,232,161,140,230,131,
+133,229,155,158,229,136,176,230,128,157,230,131,179,230,128,142,230,160,183,229,
+141,143,232,174,174,232,174,164,232,175,129,230,156,128,229,165,189,228,186,167,
+231,148,159,230,140,137,231,133,167,230,156,141,232,163,133,229,185,191,228,184,
+156,229,138,168,230,188,171,233,135,135,232,180,173,230,150,176,230,137,139,231,
+187,132,229,155,190,233,157,162,230,157,191,229,143,130,232,128,131,230,148,191,
+230,178,187,229,174,185,230,152,147,229,164,169,229,156,176,229,138,170,229,138,
+155,228,186,186,228,187,172,229,141,135,231,186,167,233,128,159,229,186,166,228,
+186,186,231,137,169,232,176,131,230,149,180,230,181,129,232,161,140,233,128,160,
+230,136,144,230,150,135,229,173,151,233,159,169,229,155,189,232,180,184,230,152,
+147,229,188,128,229,177,149,231,155,184,233,151,156,232,161,168,231,142,176,229,
+189,177,232,167,134,229,166,130,230,173,164,231,190,142,229,174,185,229,164,167,
+229,176,143,230,138,165,233,129,147,230,157,161,230,172,190,229,191,131,230,131,
+133,232,174,184,229,164,154,230,179,149,232,167,132,229,174,182,229,177,133,228,
+185,166,229,186,151,232,191,158,230,142,165,231,171,139,229,141,179,228,184,190,
+230,138,165,230,138,128,229,183,167,229,165,165,232,191,144,231,153,187,229,133,
+165,228,187,165,230,157,165,231,144,134,232,174,186,228,186,139,228,187,182,232,
+135,170,231,148,177,228,184,173,229,141,142,229,138,158,229,133,172,229,166,136,
+229,166,136,231,156,159,230,173,163,228,184,141,233,148,153,229,133,168,230,150,
+135,229,144,136,229,144,140,228,187,183,229,128,188,229,136,171,228,186,186,231,
+155,145,231,157,163,229,133,183,228,189,147,228,184,150,231,186,170,229,155,162,
+233,152,159,229,136,155,228,184,154,230,137,191,230,139,133,229,162,158,233,149,
+191,230,156,137,228,186,186,228,191,157,230,140,129,229,149,134,229,174,182,231,
+187,180,228,191,174,229,143,176,230,185,190,229,183,166,229,143,179,232,130,161,
+228,187,189,231,173,148,230,161,136,229,174,158,233,153,133,231,148,181,228,191,
+161,231,187,143,231,144,134,231,148,159,229,145,189,229,174,163,228,188,160,228,
+187,187,229,138,161,230,173,163,229,188,143,231,137,185,232,137,178,228,184,139,
+230,157,165,229,141,143,228,188,154,229,143,170,232,131,189,229,189,147,231,132,
+182,233,135,141,230,150,176,229,133,167,229,174,185,230,140,135,229,175,188,232,
+191,144,232,161,140,230,151,165,229,191,151,232,179,163,229,174,182,232,182,133,
+232,191,135,229,156,159,229,156,176,230,181,153,230,177,159,230,148,175,228,187,
+152,230,142,168,229,135,186,231,171,153,233,149,191,230,157,173,229,183,158,230,
+137,167,232,161,140,229,136,182,233,128,160,228,185,139,228,184,128,230,142,168,
+229,185,191,231,142,176,229,156,186,230,143,143,232,191,176,229,143,152,229,140,
+150,228,188,160,231,187,159,230,173,140,230,137,139,228,191,157,233,153,169,232,
+175,190,231,168,139,229,140,187,231,150,151,231,187,143,232,191,135,232,191,135,
+229,142,187,228,185,139,229,137,141,230,148,182,229,133,165,229,185,180,229,186,
+166,230,157,130,229,191,151,231,190,142,228,184,189,230,156,128,233,171,152,231,
+153,187,233,153,134,230,156,170,230,157,165,229,138,160,229,183,165,229,133,141,
+232,180,163,230,149,153,231,168,139,231,137,136,229,157,151,232,186,171,228,189,
+147,233,135,141,229,186,134,229,135,186,229,148,174,230,136,144,230,156,172,229,
+189,162,229,188,143,229,156,159,232,177,134,229,135,186,229,131,185,228,184,156,
+230,150,185,233,130,174,231,174,177,229,141,151,228,186,172,230,177,130,232,129,
+140,229,143,150,229,190,151,232,129,140,228,189,141,231,155,184,228,191,161,233,
+161,181,233,157,162,229,136,134,233,146,159,231,189,145,233,161,181,231,161,174,
+229,174,154,229,155,190,228,190,139,231,189,145,229,157,128,231,167,175,230,158,
+129,233,148,153,232,175,175,231,155,174,231,154,132,229,174,157,232,180,157,230,
+156,186,229,133,179,233,163,142,233,153,169,230,142,136,230,157,131,231,151,133,
+230,175,146,229,174,160,231,137,169,233,153,164,228,186,134,232,169,149,232,171,
+150,231,150,190,231,151,133,229,143,138,230,151,182,230,177,130,232,180,173,231,
+171,153,231,130,185,229,132,191,231,171,165,230,175,143,229,164,169,228,184,173,
+229,164,174,232,174,164,232,175,134,230,175,143,228,184,170,229,164,169,230,180,
+165,229,173,151,228,189,147,229,143,176,231,129,163,231,187,180,230,138,164,230,
+156,172,233,161,181,228,184,170,230,128,167,229,174,152,230,150,185,229,184,184,
+232,167,129,231,155,184,230,156,186,230,136,152,231,149,165,229,186,148,229,189,
+147,229,190,139,229,184,136,230,150,185,228,190,191,230,160,161,229,155,173,232,
+130,161,229,184,130,230,136,191,229,177,139,230,160,143,231,155,174,229,145,152,
+229,183,165,229,175,188,232,135,180,231,170,129,231,132,182,233,129,147,229,133,
+183,230,156,172,231,189,145,231,187,147,229,144,136,230,161,163,230,161,136,229,
+138,179,229,138,168,229,143,166,229,164,150,231,190,142,229,133,131,229,188,149,
+232,181,183,230,148,185,229,143,152,231,172,172,229,155,155,228,188,154,232,174,
+161,232,170,170,230,152,142,233,154,144,231,167,129,229,174,157,229,174,157,232,
+167,132,232,140,131,230,182,136,232,180,185,229,133,177,229,144,140,229,191,152,
+232,174,176,228,189,147,231,179,187,229,184,166,230,157,165,229,144,141,229,173,
+151,231,153,188,232,161,168,229,188,128,230,148,190,229,138,160,231,155,159,229,
+143,151,229,136,176,228,186,140,230,137,139,229,164,167,233,135,143,230,136,144,
+228,186,186,230,149,176,233,135,143,229,133,177,228,186,171,229,140,186,229,159,
+159,229,165,179,229,173,169,229,142,159,229,136,153,230,137,128,229,156,168,231,
+187,147,230,157,159,233,128,154,228,191,161,232,182,133,231,186,167,233,133,141,
+231,189,174,229,189,147,230,151,182,228,188,152,231,167,128,230,128,167,230,132,
+159,230,136,191,228,186,167,233,129,138,230,136,178,229,135,186,229,143,163,230,
+143,144,228,186,164,229,176,177,228,184,154,228,191,157,229,129,165,231,168,139,
+229,186,166,229,143,130,230,149,176,228,186,139,228,184,154,230,149,180,228,184,
+170,229,177,177,228,184,156,230,131,133,230,132,159,231,137,185,230,174,138,229,
+136,134,233,161,158,230,144,156,229,176,139,229,177,158,228,186,142,233,151,168,
+230,136,183,232,180,162,229,138,161,229,163,176,233,159,179,229,143,138,229,133,
+182,232,180,162,231,187,143,229,157,154,230,140,129,229,185,178,233,131,168,230,
+136,144,231,171,139,229,136,169,231,155,138,232,128,131,232,153,145,230,136,144,
+233,131,189,229,140,133,232,163,133,231,148,168,230,136,182,230,175,148,232,181,
+155,230,150,135,230,152,142,230,139,155,229,149,134,229,174,140,230,149,180,231,
+156,159,230,152,175,231,156,188,231,157,155,228,188,153,228,188,180,229,168,129,
+230,156,155,233,162,134,229,159,159,229,141,171,231,148,159,228,188,152,230,131,
+160,232,171,150,229,163,135,229,133,172,229,133,177,232,137,175,229,165,189,229,
+133,133,229,136,134,231,172,166,229,144,136,233,153,132,228,187,182,231,137,185,
+231,130,185,228,184,141,229,143,175,232,139,177,230,150,135,232,181,132,228,186,
+167,230,160,185,230,156,172,230,152,142,230,152,190,229,175,134,231,162,188,229,
+133,172,228,188,151,230,176,145,230,151,143,230,155,180,229,138,160,228,186,171,
+229,143,151,229,144,140,229,173,166,229,144,175,229,138,168,233,128,130,229,144,
+136,229,142,159,230,157,165,233,151,174,231,173,148,230,156,172,230,150,135,231,
+190,142,233,163,159,231,187,191,232,137,178,231,168,179,229,174,154,231,187,136,
+228,186,142,231,148,159,231,137,169,228,190,155,230,177,130,230,144,156,231,139,
+144,229,138,155,233,135,143,228,184,165,233,135,141,230,176,184,232,191,156,229,
+134,153,231,156,159,230,156,137,233,153,144,231,171,158,228,186,137,229,175,185,
+232,177,161,232,180,185,231,148,168,228,184,141,229,165,189,231,187,157,229,175,
+185,229,141,129,229,136,134,228,191,131,232,191,155,231,130,185,232,175,132,229,
+189,177,233,159,179,228,188,152,229,138,191,228,184,141,229,176,145,230,172,163,
+232,181,143,229,185,182,228,184,148,230,156,137,231,130,185,230,150,185,229,144,
+145,229,133,168,230,150,176,228,191,161,231,148,168,232,174,190,230,150,189,229,
+189,162,232,177,161,232,181,132,230,160,188,231,170,129,231,160,180,233,154,143,
+231,157,128,233,135,141,229,164,167,228,186,142,230,152,175,230,175,149,228,184,
+154,230,153,186,232,131,189,229,140,150,229,183,165,229,174,140,231,190,142,229,
+149,134,229,159,142,231,187,159,228,184,128,229,135,186,231,137,136,230,137,147,
+233,128,160,231,148,162,229,147,129,230,166,130,229,134,181,231,148,168,228,186,
+142,228,191,157,231,149,153,229,155,160,231,180,160,228,184,173,229,156,139,229,
+173,152,229,130,168,232,180,180,229,155,190,230,156,128,230,132,155,233,149,191,
+230,156,159,229,143,163,228,187,183,231,144,134,232,180,162,229,159,186,229,156,
+176,229,174,137,230,142,146,230,173,166,230,177,137,233,135,140,233,157,162,229,
+136,155,229,187,186,229,164,169,231,169,186,233,166,150,229,133,136,229,174,140,
+229,150,132,233,169,177,229,138,168,228,184,139,233,157,162,228,184,141,229,134,
+141,232,175,154,228,191,161,230,132,143,228,185,137,233,152,179,229,133,137,232,
+139,177,229,155,189,230,188,130,228,186,174,229,134,155,228,186,139,231,142,169,
+229,174,182,231,190,164,228,188,151,229,134,156,230,176,145,229,141,179,229,143,
+175,229,144,141,231,168,177,229,174,182,229,133,183,229,138,168,231,148,187,230,
+131,179,229,136,176,230,179,168,230,152,142,229,176,143,229,173,166,230,128,167,
+232,131,189,232,128,131,231,160,148,231,161,172,228,187,182,232,167,130,231,156,
+139,230,184,133,230,165,154,230,144,158,231,172,145,233,166,150,233,160,129,233,
+187,132,233,135,145,233,128,130,231,148,168,230,177,159,232,139,143,231,156,159,
+229,174,158,228,184,187,231,174,161,233,152,182,230,174,181,232,168,187,229,134,
+138,231,191,187,232,175,145,230,157,131,229,136,169,229,129,154,229,165,189,228,
+188,188,228,185,142,233,128,154,232,174,175,230,150,189,229,183,165,231,139,128,
+230,133,139,228,185,159,232,174,184,231,142,175,228,191,157,229,159,185,229,133,
+187,230,166,130,229,191,181,229,164,167,229,158,139,230,156,186,231,165,168,231,
+144,134,232,167,163,229,140,191,229,144,141,99,117,97,110,100,111,101,110,118,
+105,97,114,109,97,100,114,105,100,98,117,115,99,97,114,105,110,105,99,105,111,
+116,105,101,109,112,111,112,111,114,113,117,101,99,117,101,110,116,97,101,115,
+116,97,100,111,112,117,101,100,101,110,106,117,101,103,111,115,99,111,110,116,
+114,97,101,115,116,195,161,110,110,111,109,98,114,101,116,105,101,110,101,110,
+112,101,114,102,105,108,109,97,110,101,114,97,97,109,105,103,111,115,99,105,117,
+100,97,100,99,101,110,116,114,111,97,117,110,113,117,101,112,117,101,100,101,115
+,100,101,110,116,114,111,112,114,105,109,101,114,112,114,101,99,105,111,115,101,
+103,195,186,110,98,117,101,110,111,115,118,111,108,118,101,114,112,117,110,116,
+111,115,115,101,109,97,110,97,104,97,98,195,173,97,97,103,111,115,116,111,110,
+117,101,118,111,115,117,110,105,100,111,115,99,97,114,108,111,115,101,113,117,
+105,112,111,110,105,195,177,111,115,109,117,99,104,111,115,97,108,103,117,110,97
+,99,111,114,114,101,111,105,109,97,103,101,110,112,97,114,116,105,114,97,114,114
+,105,98,97,109,97,114,195,173,97,104,111,109,98,114,101,101,109,112,108,101,111,
+118,101,114,100,97,100,99,97,109,98,105,111,109,117,99,104,97,115,102,117,101,
+114,111,110,112,97,115,97,100,111,108,195,173,110,101,97,112,97,114,101,99,101,
+110,117,101,118,97,115,99,117,114,115,111,115,101,115,116,97,98,97,113,117,105,
+101,114,111,108,105,98,114,111,115,99,117,97,110,116,111,97,99,99,101,115,111,
+109,105,103,117,101,108,118,97,114,105,111,115,99,117,97,116,114,111,116,105,101
+,110,101,115,103,114,117,112,111,115,115,101,114,195,161,110,101,117,114,111,112
+,97,109,101,100,105,111,115,102,114,101,110,116,101,97,99,101,114,99,97,100,101,
+109,195,161,115,111,102,101,114,116,97,99,111,99,104,101,115,109,111,100,101,108
+,111,105,116,97,108,105,97,108,101,116,114,97,115,97,108,103,195,186,110,99,111,
+109,112,114,97,99,117,97,108,101,115,101,120,105,115,116,101,99,117,101,114,112,
+111,115,105,101,110,100,111,112,114,101,110,115,97,108,108,101,103,97,114,118,
+105,97,106,101,115,100,105,110,101,114,111,109,117,114,99,105,97,112,111,100,114
+,195,161,112,117,101,115,116,111,100,105,97,114,105,111,112,117,101,98,108,111,
+113,117,105,101,114,101,109,97,110,117,101,108,112,114,111,112,105,111,99,114,
+105,115,105,115,99,105,101,114,116,111,115,101,103,117,114,111,109,117,101,114,
+116,101,102,117,101,110,116,101,99,101,114,114,97,114,103,114,97,110,100,101,101
+,102,101,99,116,111,112,97,114,116,101,115,109,101,100,105,100,97,112,114,111,
+112,105,97,111,102,114,101,99,101,116,105,101,114,114,97,101,45,109,97,105,108,
+118,97,114,105,97,115,102,111,114,109,97,115,102,117,116,117,114,111,111,98,106,
+101,116,111,115,101,103,117,105,114,114,105,101,115,103,111,110,111,114,109,97,
+115,109,105,115,109,111,115,195,186,110,105,99,111,99,97,109,105,110,111,115,105
+,116,105,111,115,114,97,122,195,179,110,100,101,98,105,100,111,112,114,117,101,
+98,97,116,111,108,101,100,111,116,101,110,195,173,97,106,101,115,195,186,115,101
+,115,112,101,114,111,99,111,99,105,110,97,111,114,105,103,101,110,116,105,101,
+110,100,97,99,105,101,110,116,111,99,195,161,100,105,122,104,97,98,108,97,114,
+115,101,114,195,173,97,108,97,116,105,110,97,102,117,101,114,122,97,101,115,116,
+105,108,111,103,117,101,114,114,97,101,110,116,114,97,114,195,169,120,105,116,
+111,108,195,179,112,101,122,97,103,101,110,100,97,118,195,173,100,101,111,101,
+118,105,116,97,114,112,97,103,105,110,97,109,101,116,114,111,115,106,97,118,105,
+101,114,112,97,100,114,101,115,102,195,161,99,105,108,99,97,98,101,122,97,195,
+161,114,101,97,115,115,97,108,105,100,97,101,110,118,195,173,111,106,97,112,195,
+179,110,97,98,117,115,111,115,98,105,101,110,101,115,116,101,120,116,111,115,108
+,108,101,118,97,114,112,117,101,100,97,110,102,117,101,114,116,101,99,111,109,
+195,186,110,99,108,97,115,101,115,104,117,109,97,110,111,116,101,110,105,100,111
+,98,105,108,98,97,111,117,110,105,100,97,100,101,115,116,195,161,115,101,100,105
+,116,97,114,99,114,101,97,100,111,208,180,208,187,209,143,209,135,209,130,208,
+190,208,186,208,176,208,186,208,184,208,187,208,184,209,141,209,130,208,190,208,
+178,209,129,208,181,208,181,208,179,208,190,208,191,209,128,208,184,209,130,208,
+176,208,186,208,181,209,137,208,181,209,131,208,182,208,181,208,154,208,176,208,
+186,208,177,208,181,208,183,208,177,209,139,208,187,208,190,208,189,208,184,208,
+146,209,129,208,181,208,191,208,190,208,180,208,173,209,130,208,190,209,130,208,
+190,208,188,209,135,208,181,208,188,208,189,208,181,209,130,208,187,208,181,209,
+130,209,128,208,176,208,183,208,190,208,189,208,176,208,179,208,180,208,181,208,
+188,208,189,208,181,208,148,208,187,209,143,208,159,209,128,208,184,208,189,208,
+176,209,129,208,189,208,184,209,133,209,130,208,181,208,188,208,186,209,130,208,
+190,208,179,208,190,208,180,208,178,208,190,209,130,209,130,208,176,208,188,208,
+161,208,168,208,144,208,188,208,176,209,143,208,167,209,130,208,190,208,178,208,
+176,209,129,208,178,208,176,208,188,208,181,208,188,209,131,208,162,208,176,208,
+186,208,180,208,178,208,176,208,189,208,176,208,188,209,141,209,130,208,184,209,
+141,209,130,209,131,208,146,208,176,208,188,209,130,208,181,209,133,208,191,209,
+128,208,190,209,130,209,131,209,130,208,189,208,176,208,180,208,180,208,189,209,
+143,208,146,208,190,209,130,209,130,209,128,208,184,208,189,208,181,208,185,208,
+146,208,176,209,129,208,189,208,184,208,188,209,129,208,176,208,188,209,130,208,
+190,209,130,209,128,209,131,208,177,208,158,208,189,208,184,208,188,208,184,209,
+128,208,189,208,181,208,181,208,158,208,158,208,158,208,187,208,184,209,134,209,
+141,209,130,208,176,208,158,208,189,208,176,208,189,208,181,208,188,208,180,208,
+190,208,188,208,188,208,190,208,185,208,180,208,178,208,181,208,190,208,189,208,
+190,209,129,209,131,208,180,224,164,149,224,165,135,224,164,185,224,165,136,224,
+164,149,224,165,128,224,164,184,224,165,135,224,164,149,224,164,190,224,164,149,
+224,165,139,224,164,148,224,164,176,224,164,170,224,164,176,224,164,168,224,165,
+135,224,164,143,224,164,149,224,164,149,224,164,191,224,164,173,224,165,128,224,
+164,135,224,164,184,224,164,149,224,164,176,224,164,164,224,165,139,224,164,185,
+224,165,139,224,164,134,224,164,170,224,164,185,224,165,128,224,164,175,224,164,
+185,224,164,175,224,164,190,224,164,164,224,164,149,224,164,165,224,164,190,106,
+97,103,114,97,110,224,164,134,224,164,156,224,164,156,224,165,139,224,164,133,
+224,164,172,224,164,166,224,165,139,224,164,151,224,164,136,224,164,156,224,164,
+190,224,164,151,224,164,143,224,164,185,224,164,174,224,164,135,224,164,168,224,
+164,181,224,164,185,224,164,175,224,165,135,224,164,165,224,165,135,224,164,165,
+224,165,128,224,164,152,224,164,176,224,164,156,224,164,172,224,164,166,224,165,
+128,224,164,149,224,164,136,224,164,156,224,165,128,224,164,181,224,165,135,224,
+164,168,224,164,136,224,164,168,224,164,143,224,164,185,224,164,176,224,164,137,
+224,164,184,224,164,174,224,165,135,224,164,149,224,164,174,224,164,181,224,165,
+139,224,164,178,224,165,135,224,164,184,224,164,172,224,164,174,224,164,136,224,
+164,166,224,165,135,224,164,147,224,164,176,224,164,134,224,164,174,224,164,172,
+224,164,184,224,164,173,224,164,176,224,164,172,224,164,168,224,164,154,224,164,
+178,224,164,174,224,164,168,224,164,134,224,164,151,224,164,184,224,165,128,224,
+164,178,224,165,128,216,185,217,132,217,137,216,165,217,132,217,137,217,135,216,
+176,216,167,216,162,216,174,216,177,216,185,216,175,216,175,216,167,217,132,217,
+137,217,135,216,176,217,135,216,181,217,136,216,177,216,186,217,138,216,177,217,
+131,216,167,217,134,217,136,217,132,216,167,216,168,217,138,217,134,216,185,216,
+177,216,182,216,176,217,132,217,131,217,135,217,134,216,167,217,138,217,136,217,
+133,217,130,216,167,217,132,216,185,217,132,217,138,216,167,217,134,216,167,217,
+132,217,131,217,134,216,173,216,170,217,137,217,130,216,168,217,132,217,136,216,
+173,216,169,216,167,216,174,216,177,217,129,217,130,216,183,216,185,216,168,216,
+175,216,177,217,131,217,134,216,165,216,176,216,167,217,131,217,133,216,167,216,
+167,216,173,216,175,216,165,217,132,216,167,217,129,217,138,217,135,216,168,216,
+185,216,182,217,131,217,138,217,129,216,168,216,173,216,171,217,136,217,133,217,
+134,217,136,217,135,217,136,216,163,217,134,216,167,216,172,216,175,216,167,217,
+132,217,135,216,167,216,179,217,132,217,133,216,185,217,134,216,175,217,132,217,
+138,216,179,216,185,216,168,216,177,216,181,217,132,217,137,217,133,217,134,216,
+176,216,168,217,135,216,167,216,163,217,134,217,135,217,133,216,171,217,132,217,
+131,217,134,216,170,216,167,217,132,216,167,216,173,217,138,216,171,217,133,216,
+181,216,177,216,180,216,177,216,173,216,173,217,136,217,132,217,136,217,129,217,
+138,216,167,216,176,216,167,217,132,217,131,217,132,217,133,216,177,216,169,216,
+167,217,134,216,170,216,167,217,132,217,129,216,163,216,168,217,136,216,174,216,
+167,216,181,216,163,217,134,216,170,216,167,217,134,217,135,216,167,217,132,217,
+138,216,185,216,182,217,136,217,136,217,130,216,175,216,167,216,168,217,134,216,
+174,217,138,216,177,216,168,217,134,216,170,217,132,217,131,217,133,216,180,216,
+167,216,161,217,136,217,135,217,138,216,167,216,168,217,136,217,130,216,181,216,
+181,217,136,217,133,216,167,216,177,217,130,217,133,216,163,216,173,216,175,217,
+134,216,173,217,134,216,185,216,175,217,133,216,177,216,163,217,138,216,167,216,
+173,216,169,217,131,216,170,216,168,216,175,217,136,217,134,217,138,216,172,216,
+168,217,133,217,134,217,135,216,170,216,173,216,170,216,172,217,135,216,169,216,
+179,217,134,216,169,217,138,216,170,217,133,217,131,216,177,216,169,216,186,216,
+178,216,169,217,134,217,129,216,179,216,168,217,138,216,170,217,132,217,132,217,
+135,217,132,217,134,216,167,216,170,217,132,217,131,217,130,217,132,216,168,217,
+132,217,133,216,167,216,185,217,134,217,135,216,163,217,136,217,132,216,180,217,
+138,216,161,217,134,217,136,216,177,216,163,217,133,216,167,217,129,217,138,217,
+131,216,168,217,131,217,132,216,176,216,167,216,170,216,177,216,170,216,168,216,
+168,216,163,217,134,217,135,217,133,216,179,216,167,217,134,217,131,216,168,217,
+138,216,185,217,129,217,130,216,175,216,173,216,179,217,134,217,132,217,135,217,
+133,216,180,216,185,216,177,216,163,217,135,217,132,216,180,217,135,216,177,217,
+130,216,183,216,177,216,183,217,132,216,168,112,114,111,102,105,108,101,115,101,
+114,118,105,99,101,100,101,102,97,117,108,116,104,105,109,115,101,108,102,100,
+101,116,97,105,108,115,99,111,110,116,101,110,116,115,117,112,112,111,114,116,
+115,116,97,114,116,101,100,109,101,115,115,97,103,101,115,117,99,99,101,115,115,
+102,97,115,104,105,111,110,60,116,105,116,108,101,62,99,111,117,110,116,114,121,
+97,99,99,111,117,110,116,99,114,101,97,116,101,100,115,116,111,114,105,101,115,
+114,101,115,117,108,116,115,114,117,110,110,105,110,103,112,114,111,99,101,115,
+115,119,114,105,116,105,110,103,111,98,106,101,99,116,115,118,105,115,105,98,108
+,101,119,101,108,99,111,109,101,97,114,116,105,99,108,101,117,110,107,110,111,
+119,110,110,101,116,119,111,114,107,99,111,109,112,97,110,121,100,121,110,97,109
+,105,99,98,114,111,119,115,101,114,112,114,105,118,97,99,121,112,114,111,98,108,
+101,109,83,101,114,118,105,99,101,114,101,115,112,101,99,116,100,105,115,112,108
+,97,121,114,101,113,117,101,115,116,114,101,115,101,114,118,101,119,101,98,115,
+105,116,101,104,105,115,116,111,114,121,102,114,105,101,110,100,115,111,112,116,
+105,111,110,115,119,111,114,107,105,110,103,118,101,114,115,105,111,110,109,105,
+108,108,105,111,110,99,104,97,110,110,101,108,119,105,110,100,111,119,46,97,100,
+100,114,101,115,115,118,105,115,105,116,101,100,119,101,97,116,104,101,114,99,
+111,114,114,101,99,116,112,114,111,100,117,99,116,101,100,105,114,101,99,116,102
+,111,114,119,97,114,100,121,111,117,32,99,97,110,114,101,109,111,118,101,100,115
+,117,98,106,101,99,116,99,111,110,116,114,111,108,97,114,99,104,105,118,101,99,
+117,114,114,101,110,116,114,101,97,100,105,110,103,108,105,98,114,97,114,121,108
+,105,109,105,116,101,100,109,97,110,97,103,101,114,102,117,114,116,104,101,114,
+115,117,109,109,97,114,121,109,97,99,104,105,110,101,109,105,110,117,116,101,115
+,112,114,105,118,97,116,101,99,111,110,116,101,120,116,112,114,111,103,114,97,
+109,115,111,99,105,101,116,121,110,117,109,98,101,114,115,119,114,105,116,116,
+101,110,101,110,97,98,108,101,100,116,114,105,103,103,101,114,115,111,117,114,99
+,101,115,108,111,97,100,105,110,103,101,108,101,109,101,110,116,112,97,114,116,
+110,101,114,102,105,110,97,108,108,121,112,101,114,102,101,99,116,109,101,97,110
+,105,110,103,115,121,115,116,101,109,115,107,101,101,112,105,110,103,99,117,108,
+116,117,114,101,38,113,117,111,116,59,44,106,111,117,114,110,97,108,112,114,111,
+106,101,99,116,115,117,114,102,97,99,101,115,38,113,117,111,116,59,101,120,112,
+105,114,101,115,114,101,118,105,101,119,115,98,97,108,97,110,99,101,69,110,103,
+108,105,115,104,67,111,110,116,101,110,116,116,104,114,111,117,103,104,80,108,
+101,97,115,101,32,111,112,105,110,105,111,110,99,111,110,116,97,99,116,97,118,
+101,114,97,103,101,112,114,105,109,97,114,121,118,105,108,108,97,103,101,83,112,
+97,110,105,115,104,103,97,108,108,101,114,121,100,101,99,108,105,110,101,109,101
+,101,116,105,110,103,109,105,115,115,105,111,110,112,111,112,117,108,97,114,113,
+117,97,108,105,116,121,109,101,97,115,117,114,101,103,101,110,101,114,97,108,115
+,112,101,99,105,101,115,115,101,115,115,105,111,110,115,101,99,116,105,111,110,
+119,114,105,116,101,114,115,99,111,117,110,116,101,114,105,110,105,116,105,97,
+108,114,101,112,111,114,116,115,102,105,103,117,114,101,115,109,101,109,98,101,
+114,115,104,111,108,100,105,110,103,100,105,115,112,117,116,101,101,97,114,108,
+105,101,114,101,120,112,114,101,115,115,100,105,103,105,116,97,108,112,105,99,
+116,117,114,101,65,110,111,116,104,101,114,109,97,114,114,105,101,100,116,114,97
+,102,102,105,99,108,101,97,100,105,110,103,99,104,97,110,103,101,100,99,101,110,
+116,114,97,108,118,105,99,116,111,114,121,105,109,97,103,101,115,47,114,101,97,
+115,111,110,115,115,116,117,100,105,101,115,102,101,97,116,117,114,101,108,105,
+115,116,105,110,103,109,117,115,116,32,98,101,115,99,104,111,111,108,115,86,101,
+114,115,105,111,110,117,115,117,97,108,108,121,101,112,105,115,111,100,101,112,
+108,97,121,105,110,103,103,114,111,119,105,110,103,111,98,118,105,111,117,115,
+111,118,101,114,108,97,121,112,114,101,115,101,110,116,97,99,116,105,111,110,115
+,60,47,117,108,62,13,10,119,114,97,112,112,101,114,97,108,114,101,97,100,121,99,
+101,114,116,97,105,110,114,101,97,108,105,116,121,115,116,111,114,97,103,101,97,
+110,111,116,104,101,114,100,101,115,107,116,111,112,111,102,102,101,114,101,100,
+112,97,116,116,101,114,110,117,110,117,115,117,97,108,68,105,103,105,116,97,108,
+99,97,112,105,116,97,108,87,101,98,115,105,116,101,102,97,105,108,117,114,101,99
+,111,110,110,101,99,116,114,101,100,117,99,101,100,65,110,100,114,111,105,100,
+100,101,99,97,100,101,115,114,101,103,117,108,97,114,32,38,97,109,112,59,32,97,
+110,105,109,97,108,115,114,101,108,101,97,115,101,65,117,116,111,109,97,116,103,
+101,116,116,105,110,103,109,101,116,104,111,100,115,110,111,116,104,105,110,103,
+80,111,112,117,108,97,114,99,97,112,116,105,111,110,108,101,116,116,101,114,115,
+99,97,112,116,117,114,101,115,99,105,101,110,99,101,108,105,99,101,110,115,101,
+99,104,97,110,103,101,115,69,110,103,108,97,110,100,61,49,38,97,109,112,59,72,
+105,115,116,111,114,121,32,61,32,110,101,119,32,67,101,110,116,114,97,108,117,
+112,100,97,116,101,100,83,112,101,99,105,97,108,78,101,116,119,111,114,107,114,
+101,113,117,105,114,101,99,111,109,109,101,110,116,119,97,114,110,105,110,103,67
+,111,108,108,101,103,101,116,111,111,108,98,97,114,114,101,109,97,105,110,115,98
+,101,99,97,117,115,101,101,108,101,99,116,101,100,68,101,117,116,115,99,104,102,
+105,110,97,110,99,101,119,111,114,107,101,114,115,113,117,105,99,107,108,121,98,
+101,116,119,101,101,110,101,120,97,99,116,108,121,115,101,116,116,105,110,103,
+100,105,115,101,97,115,101,83,111,99,105,101,116,121,119,101,97,112,111,110,115,
+101,120,104,105,98,105,116,38,108,116,59,33,45,45,67,111,110,116,114,111,108,99,
+108,97,115,115,101,115,99,111,118,101,114,101,100,111,117,116,108,105,110,101,97
+,116,116,97,99,107,115,100,101,118,105,99,101,115,40,119,105,110,100,111,119,112
+,117,114,112,111,115,101,116,105,116,108,101,61,34,77,111,98,105,108,101,32,107,
+105,108,108,105,110,103,115,104,111,119,105,110,103,73,116,97,108,105,97,110,100
+,114,111,112,112,101,100,104,101,97,118,105,108,121,101,102,102,101,99,116,115,
+45,49,39,93,41,59,10,99,111,110,102,105,114,109,67,117,114,114,101,110,116,97,
+100,118,97,110,99,101,115,104,97,114,105,110,103,111,112,101,110,105,110,103,100
+,114,97,119,105,110,103,98,105,108,108,105,111,110,111,114,100,101,114,101,100,
+71,101,114,109,97,110,121,114,101,108,97,116,101,100,60,47,102,111,114,109,62,
+105,110,99,108,117,100,101,119,104,101,116,104,101,114,100,101,102,105,110,101,
+100,83,99,105,101,110,99,101,99,97,116,97,108,111,103,65,114,116,105,99,108,101,
+98,117,116,116,111,110,115,108,97,114,103,101,115,116,117,110,105,102,111,114,
+109,106,111,117,114,110,101,121,115,105,100,101,98,97,114,67,104,105,99,97,103,
+111,104,111,108,105,100,97,121,71,101,110,101,114,97,108,112,97,115,115,97,103,
+101,44,38,113,117,111,116,59,97,110,105,109,97,116,101,102,101,101,108,105,110,
+103,97,114,114,105,118,101,100,112,97,115,115,105,110,103,110,97,116,117,114,97,
+108,114,111,117,103,104,108,121,46,10,10,84,104,101,32,98,117,116,32,110,111,116
+,100,101,110,115,105,116,121,66,114,105,116,97,105,110,67,104,105,110,101,115,
+101,108,97,99,107,32,111,102,116,114,105,98,117,116,101,73,114,101,108,97,110,
+100,34,32,100,97,116,97,45,102,97,99,116,111,114,115,114,101,99,101,105,118,101,
+116,104,97,116,32,105,115,76,105,98,114,97,114,121,104,117,115,98,97,110,100,105
+,110,32,102,97,99,116,97,102,102,97,105,114,115,67,104,97,114,108,101,115,114,97
+,100,105,99,97,108,98,114,111,117,103,104,116,102,105,110,100,105,110,103,108,97
+,110,100,105,110,103,58,108,97,110,103,61,34,114,101,116,117,114,110,32,108,101,
+97,100,101,114,115,112,108,97,110,110,101,100,112,114,101,109,105,117,109,112,97
+,99,107,97,103,101,65,109,101,114,105,99,97,69,100,105,116,105,111,110,93,38,113
+,117,111,116,59,77,101,115,115,97,103,101,110,101,101,100,32,116,111,118,97,108,
+117,101,61,34,99,111,109,112,108,101,120,108,111,111,107,105,110,103,115,116,97,
+116,105,111,110,98,101,108,105,101,118,101,115,109,97,108,108,101,114,45,109,111
+,98,105,108,101,114,101,99,111,114,100,115,119,97,110,116,32,116,111,107,105,110
+,100,32,111,102,70,105,114,101,102,111,120,121,111,117,32,97,114,101,115,105,109
+,105,108,97,114,115,116,117,100,105,101,100,109,97,120,105,109,117,109,104,101,
+97,100,105,110,103,114,97,112,105,100,108,121,99,108,105,109,97,116,101,107,105,
+110,103,100,111,109,101,109,101,114,103,101,100,97,109,111,117,110,116,115,102,
+111,117,110,100,101,100,112,105,111,110,101,101,114,102,111,114,109,117,108,97,
+100,121,110,97,115,116,121,104,111,119,32,116,111,32,83,117,112,112,111,114,116,
+114,101,118,101,110,117,101,101,99,111,110,111,109,121,82,101,115,117,108,116,
+115,98,114,111,116,104,101,114,115,111,108,100,105,101,114,108,97,114,103,101,
+108,121,99,97,108,108,105,110,103,46,38,113,117,111,116,59,65,99,99,111,117,110,
+116,69,100,119,97,114,100,32,115,101,103,109,101,110,116,82,111,98,101,114,116,
+32,101,102,102,111,114,116,115,80,97,99,105,102,105,99,108,101,97,114,110,101,
+100,117,112,32,119,105,116,104,104,101,105,103,104,116,58,119,101,32,104,97,118,
+101,65,110,103,101,108,101,115,110,97,116,105,111,110,115,95,115,101,97,114,99,
+104,97,112,112,108,105,101,100,97,99,113,117,105,114,101,109,97,115,115,105,118,
+101,103,114,97,110,116,101,100,58,32,102,97,108,115,101,116,114,101,97,116,101,
+100,98,105,103,103,101,115,116,98,101,110,101,102,105,116,100,114,105,118,105,
+110,103,83,116,117,100,105,101,115,109,105,110,105,109,117,109,112,101,114,104,
+97,112,115,109,111,114,110,105,110,103,115,101,108,108,105,110,103,105,115,32,
+117,115,101,100,114,101,118,101,114,115,101,118,97,114,105,97,110,116,32,114,111
+,108,101,61,34,109,105,115,115,105,110,103,97,99,104,105,101,118,101,112,114,111
+,109,111,116,101,115,116,117,100,101,110,116,115,111,109,101,111,110,101,101,120
+,116,114,101,109,101,114,101,115,116,111,114,101,98,111,116,116,111,109,58,101,
+118,111,108,118,101,100,97,108,108,32,116,104,101,115,105,116,101,109,97,112,101
+,110,103,108,105,115,104,119,97,121,32,116,111,32,32,65,117,103,117,115,116,115,
+121,109,98,111,108,115,67,111,109,112,97,110,121,109,97,116,116,101,114,115,109,
+117,115,105,99,97,108,97,103,97,105,110,115,116,115,101,114,118,105,110,103,125,
+41,40,41,59,13,10,112,97,121,109,101,110,116,116,114,111,117,98,108,101,99,111,
+110,99,101,112,116,99,111,109,112,97,114,101,112,97,114,101,110,116,115,112,108,
+97,121,101,114,115,114,101,103,105,111,110,115,109,111,110,105,116,111,114,32,39
+,39,84,104,101,32,119,105,110,110,105,110,103,101,120,112,108,111,114,101,97,100
+,97,112,116,101,100,71,97,108,108,101,114,121,112,114,111,100,117,99,101,97,98,
+105,108,105,116,121,101,110,104,97,110,99,101,99,97,114,101,101,114,115,41,46,32
+,84,104,101,32,99,111,108,108,101,99,116,83,101,97,114,99,104,32,97,110,99,105,
+101,110,116,101,120,105,115,116,101,100,102,111,111,116,101,114,32,104,97,110,
+100,108,101,114,112,114,105,110,116,101,100,99,111,110,115,111,108,101,69,97,115
+,116,101,114,110,101,120,112,111,114,116,115,119,105,110,100,111,119,115,67,104,
+97,110,110,101,108,105,108,108,101,103,97,108,110,101,117,116,114,97,108,115,117
+,103,103,101,115,116,95,104,101,97,100,101,114,115,105,103,110,105,110,103,46,
+104,116,109,108,34,62,115,101,116,116,108,101,100,119,101,115,116,101,114,110,99
+,97,117,115,105,110,103,45,119,101,98,107,105,116,99,108,97,105,109,101,100,74,
+117,115,116,105,99,101,99,104,97,112,116,101,114,118,105,99,116,105,109,115,84,
+104,111,109,97,115,32,109,111,122,105,108,108,97,112,114,111,109,105,115,101,112
+,97,114,116,105,101,115,101,100,105,116,105,111,110,111,117,116,115,105,100,101,
+58,102,97,108,115,101,44,104,117,110,100,114,101,100,79,108,121,109,112,105,99,
+95,98,117,116,116,111,110,97,117,116,104,111,114,115,114,101,97,99,104,101,100,
+99,104,114,111,110,105,99,100,101,109,97,110,100,115,115,101,99,111,110,100,115,
+112,114,111,116,101,99,116,97,100,111,112,116,101,100,112,114,101,112,97,114,101
+,110,101,105,116,104,101,114,103,114,101,97,116,108,121,103,114,101,97,116,101,
+114,111,118,101,114,97,108,108,105,109,112,114,111,118,101,99,111,109,109,97,110
+,100,115,112,101,99,105,97,108,115,101,97,114,99,104,46,119,111,114,115,104,105,
+112,102,117,110,100,105,110,103,116,104,111,117,103,104,116,104,105,103,104,101,
+115,116,105,110,115,116,101,97,100,117,116,105,108,105,116,121,113,117,97,114,
+116,101,114,67,117,108,116,117,114,101,116,101,115,116,105,110,103,99,108,101,97
+,114,108,121,101,120,112,111,115,101,100,66,114,111,119,115,101,114,108,105,98,
+101,114,97,108,125,32,99,97,116,99,104,80,114,111,106,101,99,116,101,120,97,109,
+112,108,101,104,105,100,101,40,41,59,70,108,111,114,105,100,97,97,110,115,119,
+101,114,115,97,108,108,111,119,101,100,69,109,112,101,114,111,114,100,101,102,
+101,110,115,101,115,101,114,105,111,117,115,102,114,101,101,100,111,109,83,101,
+118,101,114,97,108,45,98,117,116,116,111,110,70,117,114,116,104,101,114,111,117,
+116,32,111,102,32,33,61,32,110,117,108,108,116,114,97,105,110,101,100,68,101,110
+,109,97,114,107,118,111,105,100,40,48,41,47,97,108,108,46,106,115,112,114,101,
+118,101,110,116,82,101,113,117,101,115,116,83,116,101,112,104,101,110,10,10,87,
+104,101,110,32,111,98,115,101,114,118,101,60,47,104,50,62,13,10,77,111,100,101,
+114,110,32,112,114,111,118,105,100,101,34,32,97,108,116,61,34,98,111,114,100,101
+,114,115,46,10,10,70,111,114,32,10,10,77,97,110,121,32,97,114,116,105,115,116,
+115,112,111,119,101,114,101,100,112,101,114,102,111,114,109,102,105,99,116,105,
+111,110,116,121,112,101,32,111,102,109,101,100,105,99,97,108,116,105,99,107,101,
+116,115,111,112,112,111,115,101,100,67,111,117,110,99,105,108,119,105,116,110,
+101,115,115,106,117,115,116,105,99,101,71,101,111,114,103,101,32,66,101,108,103,
+105,117,109,46,46,46,60,47,97,62,116,119,105,116,116,101,114,110,111,116,97,98,
+108,121,119,97,105,116,105,110,103,119,97,114,102,97,114,101,32,79,116,104,101,
+114,32,114,97,110,107,105,110,103,112,104,114,97,115,101,115,109,101,110,116,105
+,111,110,115,117,114,118,105,118,101,115,99,104,111,108,97,114,60,47,112,62,13,
+10,32,67,111,117,110,116,114,121,105,103,110,111,114,101,100,108,111,115,115,32,
+111,102,106,117,115,116,32,97,115,71,101,111,114,103,105,97,115,116,114,97,110,
+103,101,60,104,101,97,100,62,60,115,116,111,112,112,101,100,49,39,93,41,59,13,10
+,105,115,108,97,110,100,115,110,111,116,97,98,108,101,98,111,114,100,101,114,58,
+108,105,115,116,32,111,102,99,97,114,114,105,101,100,49,48,48,44,48,48,48,60,47,
+104,51,62,10,32,115,101,118,101,114,97,108,98,101,99,111,109,101,115,115,101,108
+,101,99,116,32,119,101,100,100,105,110,103,48,48,46,104,116,109,108,109,111,110,
+97,114,99,104,111,102,102,32,116,104,101,116,101,97,99,104,101,114,104,105,103,
+104,108,121,32,98,105,111,108,111,103,121,108,105,102,101,32,111,102,111,114,32,
+101,118,101,110,114,105,115,101,32,111,102,38,114,97,113,117,111,59,112,108,117,
+115,111,110,101,104,117,110,116,105,110,103,40,116,104,111,117,103,104,68,111,
+117,103,108,97,115,106,111,105,110,105,110,103,99,105,114,99,108,101,115,70,111,
+114,32,116,104,101,65,110,99,105,101,110,116,86,105,101,116,110,97,109,118,101,
+104,105,99,108,101,115,117,99,104,32,97,115,99,114,121,115,116,97,108,118,97,108
+,117,101,32,61,87,105,110,100,111,119,115,101,110,106,111,121,101,100,97,32,115,
+109,97,108,108,97,115,115,117,109,101,100,60,97,32,105,100,61,34,102,111,114,101
+,105,103,110,32,65,108,108,32,114,105,104,111,119,32,116,104,101,68,105,115,112,
+108,97,121,114,101,116,105,114,101,100,104,111,119,101,118,101,114,104,105,100,
+100,101,110,59,98,97,116,116,108,101,115,115,101,101,107,105,110,103,99,97,98,
+105,110,101,116,119,97,115,32,110,111,116,108,111,111,107,32,97,116,99,111,110,
+100,117,99,116,103,101,116,32,116,104,101,74,97,110,117,97,114,121,104,97,112,
+112,101,110,115,116,117,114,110,105,110,103,97,58,104,111,118,101,114,79,110,108
+,105,110,101,32,70,114,101,110,99,104,32,108,97,99,107,105,110,103,116,121,112,
+105,99,97,108,101,120,116,114,97,99,116,101,110,101,109,105,101,115,101,118,101,
+110,32,105,102,103,101,110,101,114,97,116,100,101,99,105,100,101,100,97,114,101,
+32,110,111,116,47,115,101,97,114,99,104,98,101,108,105,101,102,115,45,105,109,97
+,103,101,58,108,111,99,97,116,101,100,115,116,97,116,105,99,46,108,111,103,105,
+110,34,62,99,111,110,118,101,114,116,118,105,111,108,101,110,116,101,110,116,101
+,114,101,100,102,105,114,115,116,34,62,99,105,114,99,117,105,116,70,105,110,108,
+97,110,100,99,104,101,109,105,115,116,115,104,101,32,119,97,115,49,48,112,120,59
+,34,62,97,115,32,115,117,99,104,100,105,118,105,100,101,100,60,47,115,112,97,110
+,62,119,105,108,108,32,98,101,108,105,110,101,32,111,102,97,32,103,114,101,97,
+116,109,121,115,116,101,114,121,47,105,110,100,101,120,46,102,97,108,108,105,110
+,103,100,117,101,32,116,111,32,114,97,105,108,119,97,121,99,111,108,108,101,103,
+101,109,111,110,115,116,101,114,100,101,115,99,101,110,116,105,116,32,119,105,
+116,104,110,117,99,108,101,97,114,74,101,119,105,115,104,32,112,114,111,116,101,
+115,116,66,114,105,116,105,115,104,102,108,111,119,101,114,115,112,114,101,100,
+105,99,116,114,101,102,111,114,109,115,98,117,116,116,111,110,32,119,104,111,32,
+119,97,115,108,101,99,116,117,114,101,105,110,115,116,97,110,116,115,117,105,99,
+105,100,101,103,101,110,101,114,105,99,112,101,114,105,111,100,115,109,97,114,
+107,101,116,115,83,111,99,105,97,108,32,102,105,115,104,105,110,103,99,111,109,
+98,105,110,101,103,114,97,112,104,105,99,119,105,110,110,101,114,115,60,98,114,
+32,47,62,60,98,121,32,116,104,101,32,78,97,116,117,114,97,108,80,114,105,118,97,
+99,121,99,111,111,107,105,101,115,111,117,116,99,111,109,101,114,101,115,111,108
+,118,101,83,119,101,100,105,115,104,98,114,105,101,102,108,121,80,101,114,115,
+105,97,110,115,111,32,109,117,99,104,67,101,110,116,117,114,121,100,101,112,105,
+99,116,115,99,111,108,117,109,110,115,104,111,117,115,105,110,103,115,99,114,105
+,112,116,115,110,101,120,116,32,116,111,98,101,97,114,105,110,103,109,97,112,112
+,105,110,103,114,101,118,105,115,101,100,106,81,117,101,114,121,40,45,119,105,
+100,116,104,58,116,105,116,108,101,34,62,116,111,111,108,116,105,112,83,101,99,
+116,105,111,110,100,101,115,105,103,110,115,84,117,114,107,105,115,104,121,111,
+117,110,103,101,114,46,109,97,116,99,104,40,125,41,40,41,59,10,10,98,117,114,110
+,105,110,103,111,112,101,114,97,116,101,100,101,103,114,101,101,115,115,111,117,
+114,99,101,61,82,105,99,104,97,114,100,99,108,111,115,101,108,121,112,108,97,115
+,116,105,99,101,110,116,114,105,101,115,60,47,116,114,62,13,10,99,111,108,111,
+114,58,35,117,108,32,105,100,61,34,112,111,115,115,101,115,115,114,111,108,108,
+105,110,103,112,104,121,115,105,99,115,102,97,105,108,105,110,103,101,120,101,99
+,117,116,101,99,111,110,116,101,115,116,108,105,110,107,32,116,111,68,101,102,97
+,117,108,116,60,98,114,32,47,62,10,58,32,116,114,117,101,44,99,104,97,114,116,
+101,114,116,111,117,114,105,115,109,99,108,97,115,115,105,99,112,114,111,99,101,
+101,100,101,120,112,108,97,105,110,60,47,104,49,62,13,10,111,110,108,105,110,101
+,46,63,120,109,108,32,118,101,104,101,108,112,105,110,103,100,105,97,109,111,110
+,100,117,115,101,32,116,104,101,97,105,114,108,105,110,101,101,110,100,32,45,45,
+62,41,46,97,116,116,114,40,114,101,97,100,101,114,115,104,111,115,116,105,110,
+103,35,102,102,102,102,102,102,114,101,97,108,105,122,101,86,105,110,99,101,110,
+116,115,105,103,110,97,108,115,32,115,114,99,61,34,47,80,114,111,100,117,99,116,
+100,101,115,112,105,116,101,100,105,118,101,114,115,101,116,101,108,108,105,110,
+103,80,117,98,108,105,99,32,104,101,108,100,32,105,110,74,111,115,101,112,104,32
+,116,104,101,97,116,114,101,97,102,102,101,99,116,115,60,115,116,121,108,101,62,
+97,32,108,97,114,103,101,100,111,101,115,110,39,116,108,97,116,101,114,44,32,69,
+108,101,109,101,110,116,102,97,118,105,99,111,110,99,114,101,97,116,111,114,72,
+117,110,103,97,114,121,65,105,114,112,111,114,116,115,101,101,32,116,104,101,115
+,111,32,116,104,97,116,77,105,99,104,97,101,108,83,121,115,116,101,109,115,80,
+114,111,103,114,97,109,115,44,32,97,110,100,32,32,119,105,100,116,104,61,101,38,
+113,117,111,116,59,116,114,97,100,105,110,103,108,101,102,116,34,62,10,112,101,
+114,115,111,110,115,71,111,108,100,101,110,32,65,102,102,97,105,114,115,103,114,
+97,109,109,97,114,102,111,114,109,105,110,103,100,101,115,116,114,111,121,105,
+100,101,97,32,111,102,99,97,115,101,32,111,102,111,108,100,101,115,116,32,116,
+104,105,115,32,105,115,46,115,114,99,32,61,32,99,97,114,116,111,111,110,114,101,
+103,105,115,116,114,67,111,109,109,111,110,115,77,117,115,108,105,109,115,87,104
+,97,116,32,105,115,105,110,32,109,97,110,121,109,97,114,107,105,110,103,114,101,
+118,101,97,108,115,73,110,100,101,101,100,44,101,113,117,97,108,108,121,47,115,
+104,111,119,95,97,111,117,116,100,111,111,114,101,115,99,97,112,101,40,65,117,
+115,116,114,105,97,103,101,110,101,116,105,99,115,121,115,116,101,109,44,73,110,
+32,116,104,101,32,115,105,116,116,105,110,103,72,101,32,97,108,115,111,73,115,
+108,97,110,100,115,65,99,97,100,101,109,121,10,9,9,60,33,45,45,68,97,110,105,101
+,108,32,98,105,110,100,105,110,103,98,108,111,99,107,34,62,105,109,112,111,115,
+101,100,117,116,105,108,105,122,101,65,98,114,97,104,97,109,40,101,120,99,101,
+112,116,123,119,105,100,116,104,58,112,117,116,116,105,110,103,41,46,104,116,109
+,108,40,124,124,32,91,93,59,10,68,65,84,65,91,32,42,107,105,116,99,104,101,110,
+109,111,117,110,116,101,100,97,99,116,117,97,108,32,100,105,97,108,101,99,116,
+109,97,105,110,108,121,32,95,98,108,97,110,107,39,105,110,115,116,97,108,108,101
+,120,112,101,114,116,115,105,102,40,116,121,112,101,73,116,32,97,108,115,111,38,
+99,111,112,121,59,32,34,62,84,101,114,109,115,98,111,114,110,32,105,110,79,112,
+116,105,111,110,115,101,97,115,116,101,114,110,116,97,108,107,105,110,103,99,111
+,110,99,101,114,110,103,97,105,110,101,100,32,111,110,103,111,105,110,103,106,
+117,115,116,105,102,121,99,114,105,116,105,99,115,102,97,99,116,111,114,121,105,
+116,115,32,111,119,110,97,115,115,97,117,108,116,105,110,118,105,116,101,100,108
+,97,115,116,105,110,103,104,105,115,32,111,119,110,104,114,101,102,61,34,47,34,
+32,114,101,108,61,34,100,101,118,101,108,111,112,99,111,110,99,101,114,116,100,
+105,97,103,114,97,109,100,111,108,108,97,114,115,99,108,117,115,116,101,114,112,
+104,112,63,105,100,61,97,108,99,111,104,111,108,41,59,125,41,40,41,59,117,115,
+105,110,103,32,97,62,60,115,112,97,110,62,118,101,115,115,101,108,115,114,101,
+118,105,118,97,108,65,100,100,114,101,115,115,97,109,97,116,101,117,114,97,110,
+100,114,111,105,100,97,108,108,101,103,101,100,105,108,108,110,101,115,115,119,
+97,108,107,105,110,103,99,101,110,116,101,114,115,113,117,97,108,105,102,121,109
+,97,116,99,104,101,115,117,110,105,102,105,101,100,101,120,116,105,110,99,116,68
+,101,102,101,110,115,101,100,105,101,100,32,105,110,10,9,60,33,45,45,32,99,117,
+115,116,111,109,115,108,105,110,107,105,110,103,76,105,116,116,108,101,32,66,111
+,111,107,32,111,102,101,118,101,110,105,110,103,109,105,110,46,106,115,63,97,114
+,101,32,116,104,101,107,111,110,116,97,107,116,116,111,100,97,121,39,115,46,104,
+116,109,108,34,32,116,97,114,103,101,116,61,119,101,97,114,105,110,103,65,108,
+108,32,82,105,103,59,10,125,41,40,41,59,114,97,105,115,105,110,103,32,65,108,115
+,111,44,32,99,114,117,99,105,97,108,97,98,111,117,116,34,62,100,101,99,108,97,
+114,101,45,45,62,10,60,115,99,102,105,114,101,102,111,120,97,115,32,109,117,99,
+104,97,112,112,108,105,101,115,105,110,100,101,120,44,32,115,44,32,98,117,116,32
+,116,121,112,101,32,61,32,10,13,10,60,33,45,45,116,111,119,97,114,100,115,82,101
+,99,111,114,100,115,80,114,105,118,97,116,101,70,111,114,101,105,103,110,80,114,
+101,109,105,101,114,99,104,111,105,99,101,115,86,105,114,116,117,97,108,114,101,
+116,117,114,110,115,67,111,109,109,101,110,116,80,111,119,101,114,101,100,105,
+110,108,105,110,101,59,112,111,118,101,114,116,121,99,104,97,109,98,101,114,76,
+105,118,105,110,103,32,118,111,108,117,109,101,115,65,110,116,104,111,110,121,
+108,111,103,105,110,34,32,82,101,108,97,116,101,100,69,99,111,110,111,109,121,
+114,101,97,99,104,101,115,99,117,116,116,105,110,103,103,114,97,118,105,116,121,
+108,105,102,101,32,105,110,67,104,97,112,116,101,114,45,115,104,97,100,111,119,
+78,111,116,97,98,108,101,60,47,116,100,62,13,10,32,114,101,116,117,114,110,115,
+116,97,100,105,117,109,119,105,100,103,101,116,115,118,97,114,121,105,110,103,
+116,114,97,118,101,108,115,104,101,108,100,32,98,121,119,104,111,32,97,114,101,
+119,111,114,107,32,105,110,102,97,99,117,108,116,121,97,110,103,117,108,97,114,
+119,104,111,32,104,97,100,97,105,114,112,111,114,116,116,111,119,110,32,111,102,
+10,10,83,111,109,101,32,39,99,108,105,99,107,39,99,104,97,114,103,101,115,107,
+101,121,119,111,114,100,105,116,32,119,105,108,108,99,105,116,121,32,111,102,40,
+116,104,105,115,41,59,65,110,100,114,101,119,32,117,110,105,113,117,101,32,99,
+104,101,99,107,101,100,111,114,32,109,111,114,101,51,48,48,112,120,59,32,114,101
+,116,117,114,110,59,114,115,105,111,110,61,34,112,108,117,103,105,110,115,119,
+105,116,104,105,110,32,104,101,114,115,101,108,102,83,116,97,116,105,111,110,70,
+101,100,101,114,97,108,118,101,110,116,117,114,101,112,117,98,108,105,115,104,
+115,101,110,116,32,116,111,116,101,110,115,105,111,110,97,99,116,114,101,115,115
+,99,111,109,101,32,116,111,102,105,110,103,101,114,115,68,117,107,101,32,111,102
+,112,101,111,112,108,101,44,101,120,112,108,111,105,116,119,104,97,116,32,105,
+115,104,97,114,109,111,110,121,97,32,109,97,106,111,114,34,58,34,104,116,116,112
+,105,110,32,104,105,115,32,109,101,110,117,34,62,10,109,111,110,116,104,108,121,
+111,102,102,105,99,101,114,99,111,117,110,99,105,108,103,97,105,110,105,110,103,
+101,118,101,110,32,105,110,83,117,109,109,97,114,121,100,97,116,101,32,111,102,
+108,111,121,97,108,116,121,102,105,116,110,101,115,115,97,110,100,32,119,97,115,
+101,109,112,101,114,111,114,115,117,112,114,101,109,101,83,101,99,111,110,100,32
+,104,101,97,114,105,110,103,82,117,115,115,105,97,110,108,111,110,103,101,115,
+116,65,108,98,101,114,116,97,108,97,116,101,114,97,108,115,101,116,32,111,102,32
+,115,109,97,108,108,34,62,46,97,112,112,101,110,100,100,111,32,119,105,116,104,
+102,101,100,101,114,97,108,98,97,110,107,32,111,102,98,101,110,101,97,116,104,68
+,101,115,112,105,116,101,67,97,112,105,116,97,108,103,114,111,117,110,100,115,41
+,44,32,97,110,100,32,112,101,114,99,101,110,116,105,116,32,102,114,111,109,99,
+108,111,115,105,110,103,99,111,110,116,97,105,110,73,110,115,116,101,97,100,102,
+105,102,116,101,101,110,97,115,32,119,101,108,108,46,121,97,104,111,111,46,114,
+101,115,112,111,110,100,102,105,103,104,116,101,114,111,98,115,99,117,114,101,
+114,101,102,108,101,99,116,111,114,103,97,110,105,99,61,32,77,97,116,104,46,101,
+100,105,116,105,110,103,111,110,108,105,110,101,32,112,97,100,100,105,110,103,97
+,32,119,104,111,108,101,111,110,101,114,114,111,114,121,101,97,114,32,111,102,
+101,110,100,32,111,102,32,98,97,114,114,105,101,114,119,104,101,110,32,105,116,
+104,101,97,100,101,114,32,104,111,109,101,32,111,102,114,101,115,117,109,101,100
+,114,101,110,97,109,101,100,115,116,114,111,110,103,62,104,101,97,116,105,110,
+103,114,101,116,97,105,110,115,99,108,111,117,100,102,114,119,97,121,32,111,102,
+32,77,97,114,99,104,32,49,107,110,111,119,105,110,103,105,110,32,112,97,114,116,
+66,101,116,119,101,101,110,108,101,115,115,111,110,115,99,108,111,115,101,115,
+116,118,105,114,116,117,97,108,108,105,110,107,115,34,62,99,114,111,115,115,101,
+100,69,78,68,32,45,45,62,102,97,109,111,117,115,32,97,119,97,114,100,101,100,76,
+105,99,101,110,115,101,72,101,97,108,116,104,32,102,97,105,114,108,121,32,119,
+101,97,108,116,104,121,109,105,110,105,109,97,108,65,102,114,105,99,97,110,99,
+111,109,112,101,116,101,108,97,98,101,108,34,62,115,105,110,103,105,110,103,102,
+97,114,109,101,114,115,66,114,97,115,105,108,41,100,105,115,99,117,115,115,114,
+101,112,108,97,99,101,71,114,101,103,111,114,121,102,111,110,116,32,99,111,112,
+117,114,115,117,101,100,97,112,112,101,97,114,115,109,97,107,101,32,117,112,114,
+111,117,110,100,101,100,98,111,116,104,32,111,102,98,108,111,99,107,101,100,115,
+97,119,32,116,104,101,111,102,102,105,99,101,115,99,111,108,111,117,114,115,105,
+102,40,100,111,99,117,119,104,101,110,32,104,101,101,110,102,111,114,99,101,112,
+117,115,104,40,102,117,65,117,103,117,115,116,32,85,84,70,45,56,34,62,70,97,110,
+116,97,115,121,105,110,32,109,111,115,116,105,110,106,117,114,101,100,85,115,117
+,97,108,108,121,102,97,114,109,105,110,103,99,108,111,115,117,114,101,111,98,106
+,101,99,116,32,100,101,102,101,110,99,101,117,115,101,32,111,102,32,77,101,100,
+105,99,97,108,60,98,111,100,121,62,10,101,118,105,100,101,110,116,98,101,32,117,
+115,101,100,107,101,121,67,111,100,101,115,105,120,116,101,101,110,73,115,108,97
+,109,105,99,35,48,48,48,48,48,48,101,110,116,105,114,101,32,119,105,100,101,108,
+121,32,97,99,116,105,118,101,32,40,116,121,112,101,111,102,111,110,101,32,99,97,
+110,99,111,108,111,114,32,61,115,112,101,97,107,101,114,101,120,116,101,110,100,
+115,80,104,121,115,105,99,115,116,101,114,114,97,105,110,60,116,98,111,100,121,
+62,102,117,110,101,114,97,108,118,105,101,119,105,110,103,109,105,100,100,108,
+101,32,99,114,105,99,107,101,116,112,114,111,112,104,101,116,115,104,105,102,116
+,101,100,100,111,99,116,111,114,115,82,117,115,115,101,108,108,32,116,97,114,103
+,101,116,99,111,109,112,97,99,116,97,108,103,101,98,114,97,115,111,99,105,97,108
+,45,98,117,108,107,32,111,102,109,97,110,32,97,110,100,60,47,116,100,62,10,32,
+104,101,32,108,101,102,116,41,46,118,97,108,40,41,102,97,108,115,101,41,59,108,
+111,103,105,99,97,108,98,97,110,107,105,110,103,104,111,109,101,32,116,111,110,
+97,109,105,110,103,32,65,114,105,122,111,110,97,99,114,101,100,105,116,115,41,59
+,10,125,41,59,10,102,111,117,110,100,101,114,105,110,32,116,117,114,110,67,111,
+108,108,105,110,115,98,101,102,111,114,101,32,66,117,116,32,116,104,101,99,104,
+97,114,103,101,100,84,105,116,108,101,34,62,67,97,112,116,97,105,110,115,112,101
+,108,108,101,100,103,111,100,100,101,115,115,84,97,103,32,45,45,62,65,100,100,
+105,110,103,58,98,117,116,32,119,97,115,82,101,99,101,110,116,32,112,97,116,105,
+101,110,116,98,97,99,107,32,105,110,61,102,97,108,115,101,38,76,105,110,99,111,
+108,110,119,101,32,107,110,111,119,67,111,117,110,116,101,114,74,117,100,97,105,
+115,109,115,99,114,105,112,116,32,97,108,116,101,114,101,100,39,93,41,59,10,32,
+32,104,97,115,32,116,104,101,117,110,99,108,101,97,114,69,118,101,110,116,39,44,
+98,111,116,104,32,105,110,110,111,116,32,97,108,108,10,10,60,33,45,45,32,112,108
+,97,99,105,110,103,104,97,114,100,32,116,111,32,99,101,110,116,101,114,115,111,
+114,116,32,111,102,99,108,105,101,110,116,115,115,116,114,101,101,116,115,66,101
+,114,110,97,114,100,97,115,115,101,114,116,115,116,101,110,100,32,116,111,102,97
+,110,116,97,115,121,100,111,119,110,32,105,110,104,97,114,98,111,117,114,70,114,
+101,101,100,111,109,106,101,119,101,108,114,121,47,97,98,111,117,116,46,46,115,
+101,97,114,99,104,108,101,103,101,110,100,115,105,115,32,109,97,100,101,109,111,
+100,101,114,110,32,111,110,108,121,32,111,110,111,110,108,121,32,116,111,105,109
+,97,103,101,34,32,108,105,110,101,97,114,32,112,97,105,110,116,101,114,97,110,
+100,32,110,111,116,114,97,114,101,108,121,32,97,99,114,111,110,121,109,100,101,
+108,105,118,101,114,115,104,111,114,116,101,114,48,48,38,97,109,112,59,97,115,32
+,109,97,110,121,119,105,100,116,104,61,34,47,42,32,60,33,91,67,116,105,116,108,
+101,32,61,111,102,32,116,104,101,32,108,111,119,101,115,116,32,112,105,99,107,
+101,100,32,101,115,99,97,112,101,100,117,115,101,115,32,111,102,112,101,111,112,
+108,101,115,32,80,117,98,108,105,99,77,97,116,116,104,101,119,116,97,99,116,105,
+99,115,100,97,109,97,103,101,100,119,97,121,32,102,111,114,108,97,119,115,32,111
+,102,101,97,115,121,32,116,111,32,119,105,110,100,111,119,115,116,114,111,110,
+103,32,32,115,105,109,112,108,101,125,99,97,116,99,104,40,115,101,118,101,110,
+116,104,105,110,102,111,98,111,120,119,101,110,116,32,116,111,112,97,105,110,116
+,101,100,99,105,116,105,122,101,110,73,32,100,111,110,39,116,114,101,116,114,101
+,97,116,46,32,83,111,109,101,32,119,119,46,34,41,59,10,98,111,109,98,105,110,103
+,109,97,105,108,116,111,58,109,97,100,101,32,105,110,46,32,77,97,110,121,32,99,
+97,114,114,105,101,115,124,124,123,125,59,119,105,119,111,114,107,32,111,102,115
+,121,110,111,110,121,109,100,101,102,101,97,116,115,102,97,118,111,114,101,100,
+111,112,116,105,99,97,108,112,97,103,101,84,114,97,117,110,108,101,115,115,32,
+115,101,110,100,105,110,103,108,101,102,116,34,62,60,99,111,109,83,99,111,114,65
+,108,108,32,116,104,101,106,81,117,101,114,121,46,116,111,117,114,105,115,116,67
+,108,97,115,115,105,99,102,97,108,115,101,34,32,87,105,108,104,101,108,109,115,
+117,98,117,114,98,115,103,101,110,117,105,110,101,98,105,115,104,111,112,115,46,
+115,112,108,105,116,40,103,108,111,98,97,108,32,102,111,108,108,111,119,115,98,
+111,100,121,32,111,102,110,111,109,105,110,97,108,67,111,110,116,97,99,116,115,
+101,99,117,108,97,114,108,101,102,116,32,116,111,99,104,105,101,102,108,121,45,
+104,105,100,100,101,110,45,98,97,110,110,101,114,60,47,108,105,62,10,10,46,32,87
+,104,101,110,32,105,110,32,98,111,116,104,100,105,115,109,105,115,115,69,120,112
+,108,111,114,101,97,108,119,97,121,115,32,118,105,97,32,116,104,101,115,112,97,
+195,177,111,108,119,101,108,102,97,114,101,114,117,108,105,110,103,32,97,114,114
+,97,110,103,101,99,97,112,116,97,105,110,104,105,115,32,115,111,110,114,117,108,
+101,32,111,102,104,101,32,116,111,111,107,105,116,115,101,108,102,44,61,48,38,97
+,109,112,59,40,99,97,108,108,101,100,115,97,109,112,108,101,115,116,111,32,109,
+97,107,101,99,111,109,47,112,97,103,77,97,114,116,105,110,32,75,101,110,110,101,
+100,121,97,99,99,101,112,116,115,102,117,108,108,32,111,102,104,97,110,100,108,
+101,100,66,101,115,105,100,101,115,47,47,45,45,62,60,47,97,98,108,101,32,116,111
+,116,97,114,103,101,116,115,101,115,115,101,110,99,101,104,105,109,32,116,111,32
+,105,116,115,32,98,121,32,99,111,109,109,111,110,46,109,105,110,101,114,97,108,
+116,111,32,116,97,107,101,119,97,121,115,32,116,111,115,46,111,114,103,47,108,97
+,100,118,105,115,101,100,112,101,110,97,108,116,121,115,105,109,112,108,101,58,
+105,102,32,116,104,101,121,76,101,116,116,101,114,115,97,32,115,104,111,114,116,
+72,101,114,98,101,114,116,115,116,114,105,107,101,115,32,103,114,111,117,112,115
+,46,108,101,110,103,116,104,102,108,105,103,104,116,115,111,118,101,114,108,97,
+112,115,108,111,119,108,121,32,108,101,115,115,101,114,32,115,111,99,105,97,108,
+32,60,47,112,62,10,9,9,105,116,32,105,110,116,111,114,97,110,107,101,100,32,114,
+97,116,101,32,111,102,117,108,62,13,10,32,32,97,116,116,101,109,112,116,112,97,
+105,114,32,111,102,109,97,107,101,32,105,116,75,111,110,116,97,107,116,65,110,
+116,111,110,105,111,104,97,118,105,110,103,32,114,97,116,105,110,103,115,32,97,
+99,116,105,118,101,115,116,114,101,97,109,115,116,114,97,112,112,101,100,34,41,
+46,99,115,115,40,104,111,115,116,105,108,101,108,101,97,100,32,116,111,108,105,
+116,116,108,101,32,103,114,111,117,112,115,44,80,105,99,116,117,114,101,45,45,62
+,13,10,13,10,32,114,111,119,115,61,34,32,111,98,106,101,99,116,105,110,118,101,
+114,115,101,60,102,111,111,116,101,114,67,117,115,116,111,109,86,62,60,92,47,115
+,99,114,115,111,108,118,105,110,103,67,104,97,109,98,101,114,115,108,97,118,101,
+114,121,119,111,117,110,100,101,100,119,104,101,114,101,97,115,33,61,32,39,117,
+110,100,102,111,114,32,97,108,108,112,97,114,116,108,121,32,45,114,105,103,104,
+116,58,65,114,97,98,105,97,110,98,97,99,107,101,100,32,99,101,110,116,117,114,
+121,117,110,105,116,32,111,102,109,111,98,105,108,101,45,69,117,114,111,112,101,
+44,105,115,32,104,111,109,101,114,105,115,107,32,111,102,100,101,115,105,114,101
+,100,67,108,105,110,116,111,110,99,111,115,116,32,111,102,97,103,101,32,111,102,
+32,98,101,99,111,109,101,32,110,111,110,101,32,111,102,112,38,113,117,111,116,59
+,77,105,100,100,108,101,32,101,97,100,39,41,91,48,67,114,105,116,105,99,115,115,
+116,117,100,105,111,115,62,38,99,111,112,121,59,103,114,111,117,112,34,62,97,115
+,115,101,109,98,108,109,97,107,105,110,103,32,112,114,101,115,115,101,100,119,
+105,100,103,101,116,46,112,115,58,34,32,63,32,114,101,98,117,105,108,116,98,121,
+32,115,111,109,101,70,111,114,109,101,114,32,101,100,105,116,111,114,115,100,101
+,108,97,121,101,100,67,97,110,111,110,105,99,104,97,100,32,116,104,101,112,117,
+115,104,105,110,103,99,108,97,115,115,61,34,98,117,116,32,97,114,101,112,97,114,
+116,105,97,108,66,97,98,121,108,111,110,98,111,116,116,111,109,32,99,97,114,114,
+105,101,114,67,111,109,109,97,110,100,105,116,115,32,117,115,101,65,115,32,119,
+105,116,104,99,111,117,114,115,101,115,97,32,116,104,105,114,100,100,101,110,111
+,116,101,115,97,108,115,111,32,105,110,72,111,117,115,116,111,110,50,48,112,120,
+59,34,62,97,99,99,117,115,101,100,100,111,117,98,108,101,32,103,111,97,108,32,
+111,102,70,97,109,111,117,115,32,41,46,98,105,110,100,40,112,114,105,101,115,116
+,115,32,79,110,108,105,110,101,105,110,32,74,117,108,121,115,116,32,43,32,34,103
+,99,111,110,115,117,108,116,100,101,99,105,109,97,108,104,101,108,112,102,117,
+108,114,101,118,105,118,101,100,105,115,32,118,101,114,121,114,39,43,39,105,112,
+116,108,111,115,105,110,103,32,102,101,109,97,108,101,115,105,115,32,97,108,115,
+111,115,116,114,105,110,103,115,100,97,121,115,32,111,102,97,114,114,105,118,97,
+108,102,117,116,117,114,101,32,60,111,98,106,101,99,116,102,111,114,99,105,110,
+103,83,116,114,105,110,103,40,34,32,47,62,10,9,9,104,101,114,101,32,105,115,101,
+110,99,111,100,101,100,46,32,32,84,104,101,32,98,97,108,108,111,111,110,100,111,
+110,101,32,98,121,47,99,111,109,109,111,110,98,103,99,111,108,111,114,108,97,119
+,32,111,102,32,73,110,100,105,97,110,97,97,118,111,105,100,101,100,98,117,116,32
+,116,104,101,50,112,120,32,51,112,120,106,113,117,101,114,121,46,97,102,116,101,
+114,32,97,112,111,108,105,99,121,46,109,101,110,32,97,110,100,102,111,111,116,
+101,114,45,61,32,116,114,117,101,59,102,111,114,32,117,115,101,115,99,114,101,
+101,110,46,73,110,100,105,97,110,32,105,109,97,103,101,32,61,102,97,109,105,108,
+121,44,104,116,116,112,58,47,47,32,38,110,98,115,112,59,100,114,105,118,101,114,
+115,101,116,101,114,110,97,108,115,97,109,101,32,97,115,110,111,116,105,99,101,
+100,118,105,101,119,101,114,115,125,41,40,41,59,10,32,105,115,32,109,111,114,101
+,115,101,97,115,111,110,115,102,111,114,109,101,114,32,116,104,101,32,110,101,
+119,105,115,32,106,117,115,116,99,111,110,115,101,110,116,32,83,101,97,114,99,
+104,119,97,115,32,116,104,101,119,104,121,32,116,104,101,115,104,105,112,112,101
+,100,98,114,62,60,98,114,62,119,105,100,116,104,58,32,104,101,105,103,104,116,61
+,109,97,100,101,32,111,102,99,117,105,115,105,110,101,105,115,32,116,104,97,116,
+97,32,118,101,114,121,32,65,100,109,105,114,97,108,32,102,105,120,101,100,59,110
+,111,114,109,97,108,32,77,105,115,115,105,111,110,80,114,101,115,115,44,32,111,
+110,116,97,114,105,111,99,104,97,114,115,101,116,116,114,121,32,116,111,32,105,
+110,118,97,100,101,100,61,34,116,114,117,101,34,115,112,97,99,105,110,103,105,
+115,32,109,111,115,116,97,32,109,111,114,101,32,116,111,116,97,108,108,121,102,
+97,108,108,32,111,102,125,41,59,13,10,32,32,105,109,109,101,110,115,101,116,105,
+109,101,32,105,110,115,101,116,32,111,117,116,115,97,116,105,115,102,121,116,111
+,32,102,105,110,100,100,111,119,110,32,116,111,108,111,116,32,111,102,32,80,108,
+97,121,101,114,115,105,110,32,74,117,110,101,113,117,97,110,116,117,109,110,111,
+116,32,116,104,101,116,105,109,101,32,116,111,100,105,115,116,97,110,116,70,105,
+110,110,105,115,104,115,114,99,32,61,32,40,115,105,110,103,108,101,32,104,101,
+108,112,32,111,102,71,101,114,109,97,110,32,108,97,119,32,97,110,100,108,97,98,
+101,108,101,100,102,111,114,101,115,116,115,99,111,111,107,105,110,103,115,112,
+97,99,101,34,62,104,101,97,100,101,114,45,119,101,108,108,32,97,115,83,116,97,
+110,108,101,121,98,114,105,100,103,101,115,47,103,108,111,98,97,108,67,114,111,
+97,116,105,97,32,65,98,111,117,116,32,91,48,93,59,10,32,32,105,116,44,32,97,110,
+100,103,114,111,117,112,101,100,98,101,105,110,103,32,97,41,123,116,104,114,111,
+119,104,101,32,109,97,100,101,108,105,103,104,116,101,114,101,116,104,105,99,97,
+108,70,70,70,70,70,70,34,98,111,116,116,111,109,34,108,105,107,101,32,97,32,101,
+109,112,108,111,121,115,108,105,118,101,32,105,110,97,115,32,115,101,101,110,112
+,114,105,110,116,101,114,109,111,115,116,32,111,102,117,98,45,108,105,110,107,
+114,101,106,101,99,116,115,97,110,100,32,117,115,101,105,109,97,103,101,34,62,
+115,117,99,99,101,101,100,102,101,101,100,105,110,103,78,117,99,108,101,97,114,
+105,110,102,111,114,109,97,116,111,32,104,101,108,112,87,111,109,101,110,39,115,
+78,101,105,116,104,101,114,77,101,120,105,99,97,110,112,114,111,116,101,105,110,
+60,116,97,98,108,101,32,98,121,32,109,97,110,121,104,101,97,108,116,104,121,108,
+97,119,115,117,105,116,100,101,118,105,115,101,100,46,112,117,115,104,40,123,115
+,101,108,108,101,114,115,115,105,109,112,108,121,32,84,104,114,111,117,103,104,
+46,99,111,111,107,105,101,32,73,109,97,103,101,40,111,108,100,101,114,34,62,117,
+115,46,106,115,34,62,32,83,105,110,99,101,32,117,110,105,118,101,114,115,108,97,
+114,103,101,114,32,111,112,101,110,32,116,111,33,45,45,32,101,110,100,108,105,
+101,115,32,105,110,39,93,41,59,13,10,32,32,109,97,114,107,101,116,119,104,111,32
+,105,115,32,40,34,68,79,77,67,111,109,97,110,97,103,101,100,111,110,101,32,102,
+111,114,116,121,112,101,111,102,32,75,105,110,103,100,111,109,112,114,111,102,
+105,116,115,112,114,111,112,111,115,101,116,111,32,115,104,111,119,99,101,110,
+116,101,114,59,109,97,100,101,32,105,116,100,114,101,115,115,101,100,119,101,114
+,101,32,105,110,109,105,120,116,117,114,101,112,114,101,99,105,115,101,97,114,
+105,115,105,110,103,115,114,99,32,61,32,39,109,97,107,101,32,97,32,115,101,99,
+117,114,101,100,66,97,112,116,105,115,116,118,111,116,105,110,103,32,10,9,9,118,
+97,114,32,77,97,114,99,104,32,50,103,114,101,119,32,117,112,67,108,105,109,97,
+116,101,46,114,101,109,111,118,101,115,107,105,108,108,101,100,119,97,121,32,116
+,104,101,60,47,104,101,97,100,62,102,97,99,101,32,111,102,97,99,116,105,110,103,
+32,114,105,103,104,116,34,62,116,111,32,119,111,114,107,114,101,100,117,99,101,
+115,104,97,115,32,104,97,100,101,114,101,99,116,101,100,115,104,111,119,40,41,59
+,97,99,116,105,111,110,61,98,111,111,107,32,111,102,97,110,32,97,114,101,97,61,
+61,32,34,104,116,116,60,104,101,97,100,101,114,10,60,104,116,109,108,62,99,111,
+110,102,111,114,109,102,97,99,105,110,103,32,99,111,111,107,105,101,46,114,101,
+108,121,32,111,110,104,111,115,116,101,100,32,46,99,117,115,116,111,109,104,101,
+32,119,101,110,116,98,117,116,32,102,111,114,115,112,114,101,97,100,32,70,97,109
+,105,108,121,32,97,32,109,101,97,110,115,111,117,116,32,116,104,101,102,111,114,
+117,109,115,46,102,111,111,116,97,103,101,34,62,77,111,98,105,108,67,108,101,109
+,101,110,116,115,34,32,105,100,61,34,97,115,32,104,105,103,104,105,110,116,101,
+110,115,101,45,45,62,60,33,45,45,102,101,109,97,108,101,32,105,115,32,115,101,
+101,110,105,109,112,108,105,101,100,115,101,116,32,116,104,101,97,32,115,116,97,
+116,101,97,110,100,32,104,105,115,102,97,115,116,101,115,116,98,101,115,105,100,
+101,115,98,117,116,116,111,110,95,98,111,117,110,100,101,100,34,62,60,105,109,
+103,32,73,110,102,111,98,111,120,101,118,101,110,116,115,44,97,32,121,111,117,
+110,103,97,110,100,32,97,114,101,78,97,116,105,118,101,32,99,104,101,97,112,101,
+114,84,105,109,101,111,117,116,97,110,100,32,104,97,115,101,110,103,105,110,101,
+115,119,111,110,32,116,104,101,40,109,111,115,116,108,121,114,105,103,104,116,58
+,32,102,105,110,100,32,97,32,45,98,111,116,116,111,109,80,114,105,110,99,101,32,
+97,114,101,97,32,111,102,109,111,114,101,32,111,102,115,101,97,114,99,104,95,110
+,97,116,117,114,101,44,108,101,103,97,108,108,121,112,101,114,105,111,100,44,108
+,97,110,100,32,111,102,111,114,32,119,105,116,104,105,110,100,117,99,101,100,112
+,114,111,118,105,110,103,109,105,115,115,105,108,101,108,111,99,97,108,108,121,
+65,103,97,105,110,115,116,116,104,101,32,119,97,121,107,38,113,117,111,116,59,
+112,120,59,34,62,13,10,112,117,115,104,101,100,32,97,98,97,110,100,111,110,110,
+117,109,101,114,97,108,67,101,114,116,97,105,110,73,110,32,116,104,105,115,109,
+111,114,101,32,105,110,111,114,32,115,111,109,101,110,97,109,101,32,105,115,97,
+110,100,44,32,105,110,99,114,111,119,110,101,100,73,83,66,78,32,48,45,99,114,101
+,97,116,101,115,79,99,116,111,98,101,114,109,97,121,32,110,111,116,99,101,110,
+116,101,114,32,108,97,116,101,32,105,110,68,101,102,101,110,99,101,101,110,97,99
+,116,101,100,119,105,115,104,32,116,111,98,114,111,97,100,108,121,99,111,111,108
+,105,110,103,111,110,108,111,97,100,61,105,116,46,32,84,104,101,114,101,99,111,
+118,101,114,77,101,109,98,101,114,115,104,101,105,103,104,116,32,97,115,115,117,
+109,101,115,60,104,116,109,108,62,10,112,101,111,112,108,101,46,105,110,32,111,
+110,101,32,61,119,105,110,100,111,119,102,111,111,116,101,114,95,97,32,103,111,
+111,100,32,114,101,107,108,97,109,97,111,116,104,101,114,115,44,116,111,32,116,
+104,105,115,95,99,111,111,107,105,101,112,97,110,101,108,34,62,76,111,110,100,
+111,110,44,100,101,102,105,110,101,115,99,114,117,115,104,101,100,98,97,112,116,
+105,115,109,99,111,97,115,116,97,108,115,116,97,116,117,115,32,116,105,116,108,
+101,34,32,109,111,118,101,32,116,111,108,111,115,116,32,105,110,98,101,116,116,
+101,114,32,105,109,112,108,105,101,115,114,105,118,97,108,114,121,115,101,114,
+118,101,114,115,32,83,121,115,116,101,109,80,101,114,104,97,112,115,101,115,32,
+97,110,100,32,99,111,110,116,101,110,100,102,108,111,119,105,110,103,108,97,115,
+116,101,100,32,114,105,115,101,32,105,110,71,101,110,101,115,105,115,118,105,101
+,119,32,111,102,114,105,115,105,110,103,32,115,101,101,109,32,116,111,98,117,116
+,32,105,110,32,98,97,99,107,105,110,103,104,101,32,119,105,108,108,103,105,118,
+101,110,32,97,103,105,118,105,110,103,32,99,105,116,105,101,115,46,102,108,111,
+119,32,111,102,32,76,97,116,101,114,32,97,108,108,32,98,117,116,72,105,103,104,
+119,97,121,111,110,108,121,32,98,121,115,105,103,110,32,111,102,104,101,32,100,
+111,101,115,100,105,102,102,101,114,115,98,97,116,116,101,114,121,38,97,109,112,
+59,108,97,115,105,110,103,108,101,115,116,104,114,101,97,116,115,105,110,116,101
+,103,101,114,116,97,107,101,32,111,110,114,101,102,117,115,101,100,99,97,108,108
+,101,100,32,61,85,83,38,97,109,112,83,101,101,32,116,104,101,110,97,116,105,118,
+101,115,98,121,32,116,104,105,115,115,121,115,116,101,109,46,104,101,97,100,32,
+111,102,58,104,111,118,101,114,44,108,101,115,98,105,97,110,115,117,114,110,97,
+109,101,97,110,100,32,97,108,108,99,111,109,109,111,110,47,104,101,97,100,101,
+114,95,95,112,97,114,97,109,115,72,97,114,118,97,114,100,47,112,105,120,101,108,
+46,114,101,109,111,118,97,108,115,111,32,108,111,110,103,114,111,108,101,32,111,
+102,106,111,105,110,116,108,121,115,107,121,115,99,114,97,85,110,105,99,111,100,
+101,98,114,32,47,62,13,10,65,116,108,97,110,116,97,110,117,99,108,101,117,115,67
+,111,117,110,116,121,44,112,117,114,101,108,121,32,99,111,117,110,116,34,62,101,
+97,115,105,108,121,32,98,117,105,108,100,32,97,111,110,99,108,105,99,107,97,32,
+103,105,118,101,110,112,111,105,110,116,101,114,104,38,113,117,111,116,59,101,
+118,101,110,116,115,32,101,108,115,101,32,123,10,100,105,116,105,111,110,115,110
+,111,119,32,116,104,101,44,32,119,105,116,104,32,109,97,110,32,119,104,111,111,
+114,103,47,87,101,98,111,110,101,32,97,110,100,99,97,118,97,108,114,121,72,101,
+32,100,105,101,100,115,101,97,116,116,108,101,48,48,44,48,48,48,32,123,119,105,
+110,100,111,119,104,97,118,101,32,116,111,105,102,40,119,105,110,100,97,110,100,
+32,105,116,115,115,111,108,101,108,121,32,109,38,113,117,111,116,59,114,101,110,
+101,119,101,100,68,101,116,114,111,105,116,97,109,111,110,103,115,116,101,105,
+116,104,101,114,32,116,104,101,109,32,105,110,83,101,110,97,116,111,114,85,115,
+60,47,97,62,60,75,105,110,103,32,111,102,70,114,97,110,99,105,115,45,112,114,111
+,100,117,99,104,101,32,117,115,101,100,97,114,116,32,97,110,100,104,105,109,32,
+97,110,100,117,115,101,100,32,98,121,115,99,111,114,105,110,103,97,116,32,104,
+111,109,101,116,111,32,104,97,118,101,114,101,108,97,116,101,115,105,98,105,108,
+105,116,121,102,97,99,116,105,111,110,66,117,102,102,97,108,111,108,105,110,107,
+34,62,60,119,104,97,116,32,104,101,102,114,101,101,32,116,111,67,105,116,121,32,
+111,102,99,111,109,101,32,105,110,115,101,99,116,111,114,115,99,111,117,110,116,
+101,100,111,110,101,32,100,97,121,110,101,114,118,111,117,115,115,113,117,97,114
+,101,32,125,59,105,102,40,103,111,105,110,32,119,104,97,116,105,109,103,34,32,97
+,108,105,115,32,111,110,108,121,115,101,97,114,99,104,47,116,117,101,115,100,97,
+121,108,111,111,115,101,108,121,83,111,108,111,109,111,110,115,101,120,117,97,
+108,32,45,32,60,97,32,104,114,109,101,100,105,117,109,34,68,79,32,78,79,84,32,70
+,114,97,110,99,101,44,119,105,116,104,32,97,32,119,97,114,32,97,110,100,115,101,
+99,111,110,100,32,116,97,107,101,32,97,32,62,13,10,13,10,13,10,109,97,114,107,
+101,116,46,104,105,103,104,119,97,121,100,111,110,101,32,105,110,99,116,105,118,
+105,116,121,34,108,97,115,116,34,62,111,98,108,105,103,101,100,114,105,115,101,
+32,116,111,34,117,110,100,101,102,105,109,97,100,101,32,116,111,32,69,97,114,108
+,121,32,112,114,97,105,115,101,100,105,110,32,105,116,115,32,102,111,114,32,104,
+105,115,97,116,104,108,101,116,101,74,117,112,105,116,101,114,89,97,104,111,111,
+33,32,116,101,114,109,101,100,32,115,111,32,109,97,110,121,114,101,97,108,108,
+121,32,115,46,32,84,104,101,32,97,32,119,111,109,97,110,63,118,97,108,117,101,61
+,100,105,114,101,99,116,32,114,105,103,104,116,34,32,98,105,99,121,99,108,101,97
+,99,105,110,103,61,34,100,97,121,32,97,110,100,115,116,97,116,105,110,103,82,97,
+116,104,101,114,44,104,105,103,104,101,114,32,79,102,102,105,99,101,32,97,114,
+101,32,110,111,119,116,105,109,101,115,44,32,119,104,101,110,32,97,32,112,97,121
+,32,102,111,114,111,110,32,116,104,105,115,45,108,105,110,107,34,62,59,98,111,
+114,100,101,114,97,114,111,117,110,100,32,97,110,110,117,97,108,32,116,104,101,
+32,78,101,119,112,117,116,32,116,104,101,46,99,111,109,34,32,116,97,107,105,110,
+32,116,111,97,32,98,114,105,101,102,40,105,110,32,116,104,101,103,114,111,117,
+112,115,46,59,32,119,105,100,116,104,101,110,122,121,109,101,115,115,105,109,112
+,108,101,32,105,110,32,108,97,116,101,123,114,101,116,117,114,110,116,104,101,
+114,97,112,121,97,32,112,111,105,110,116,98,97,110,110,105,110,103,105,110,107,
+115,34,62,10,40,41,59,34,32,114,101,97,32,112,108,97,99,101,92,117,48,48,51,67,
+97,97,98,111,117,116,32,97,116,114,62,13,10,9,9,99,99,111,117,110,116,32,103,105
+,118,101,115,32,97,60,83,67,82,73,80,84,82,97,105,108,119,97,121,116,104,101,109
+,101,115,47,116,111,111,108,98,111,120,66,121,73,100,40,34,120,104,117,109,97,
+110,115,44,119,97,116,99,104,101,115,105,110,32,115,111,109,101,32,105,102,32,40
+,119,105,99,111,109,105,110,103,32,102,111,114,109,97,116,115,32,85,110,100,101,
+114,32,98,117,116,32,104,97,115,104,97,110,100,101,100,32,109,97,100,101,32,98,
+121,116,104,97,110,32,105,110,102,101,97,114,32,111,102,100,101,110,111,116,101,
+100,47,105,102,114,97,109,101,108,101,102,116,32,105,110,118,111,108,116,97,103,
+101,105,110,32,101,97,99,104,97,38,113,117,111,116,59,98,97,115,101,32,111,102,
+73,110,32,109,97,110,121,117,110,100,101,114,103,111,114,101,103,105,109,101,115
+,97,99,116,105,111,110,32,60,47,112,62,13,10,60,117,115,116,111,109,86,97,59,38,
+103,116,59,60,47,105,109,112,111,114,116,115,111,114,32,116,104,97,116,109,111,
+115,116,108,121,32,38,97,109,112,59,114,101,32,115,105,122,101,61,34,60,47,97,62
+,60,47,104,97,32,99,108,97,115,115,112,97,115,115,105,118,101,72,111,115,116,32,
+61,32,87,104,101,116,104,101,114,102,101,114,116,105,108,101,86,97,114,105,111,
+117,115,61,91,93,59,40,102,117,99,97,109,101,114,97,115,47,62,60,47,116,100,62,
+97,99,116,115,32,97,115,73,110,32,115,111,109,101,62,13,10,13,10,60,33,111,114,
+103,97,110,105,115,32,60,98,114,32,47,62,66,101,105,106,105,110,103,99,97,116,97
+,108,195,160,100,101,117,116,115,99,104,101,117,114,111,112,101,117,101,117,115,
+107,97,114,97,103,97,101,105,108,103,101,115,118,101,110,115,107,97,101,115,112,
+97,195,177,97,109,101,110,115,97,106,101,117,115,117,97,114,105,111,116,114,97,
+98,97,106,111,109,195,169,120,105,99,111,112,195,161,103,105,110,97,115,105,101,
+109,112,114,101,115,105,115,116,101,109,97,111,99,116,117,98,114,101,100,117,114
+,97,110,116,101,97,195,177,97,100,105,114,101,109,112,114,101,115,97,109,111,109
+,101,110,116,111,110,117,101,115,116,114,111,112,114,105,109,101,114,97,116,114,
+97,118,195,169,115,103,114,97,99,105,97,115,110,117,101,115,116,114,97,112,114,
+111,99,101,115,111,101,115,116,97,100,111,115,99,97,108,105,100,97,100,112,101,
+114,115,111,110,97,110,195,186,109,101,114,111,97,99,117,101,114,100,111,109,195
+,186,115,105,99,97,109,105,101,109,98,114,111,111,102,101,114,116,97,115,97,108,
+103,117,110,111,115,112,97,195,173,115,101,115,101,106,101,109,112,108,111,100,
+101,114,101,99,104,111,97,100,101,109,195,161,115,112,114,105,118,97,100,111,97,
+103,114,101,103,97,114,101,110,108,97,99,101,115,112,111,115,105,98,108,101,104,
+111,116,101,108,101,115,115,101,118,105,108,108,97,112,114,105,109,101,114,111,
+195,186,108,116,105,109,111,101,118,101,110,116,111,115,97,114,99,104,105,118,
+111,99,117,108,116,117,114,97,109,117,106,101,114,101,115,101,110,116,114,97,100
+,97,97,110,117,110,99,105,111,101,109,98,97,114,103,111,109,101,114,99,97,100,
+111,103,114,97,110,100,101,115,101,115,116,117,100,105,111,109,101,106,111,114,
+101,115,102,101,98,114,101,114,111,100,105,115,101,195,177,111,116,117,114,105,
+115,109,111,99,195,179,100,105,103,111,112,111,114,116,97,100,97,101,115,112,97,
+99,105,111,102,97,109,105,108,105,97,97,110,116,111,110,105,111,112,101,114,109,
+105,116,101,103,117,97,114,100,97,114,97,108,103,117,110,97,115,112,114,101,99,
+105,111,115,97,108,103,117,105,101,110,115,101,110,116,105,100,111,118,105,115,
+105,116,97,115,116,195,173,116,117,108,111,99,111,110,111,99,101,114,115,101,103
+,117,110,100,111,99,111,110,115,101,106,111,102,114,97,110,99,105,97,109,105,110
+,117,116,111,115,115,101,103,117,110,100,97,116,101,110,101,109,111,115,101,102,
+101,99,116,111,115,109,195,161,108,97,103,97,115,101,115,105,195,179,110,114,101
+,118,105,115,116,97,103,114,97,110,97,100,97,99,111,109,112,114,97,114,105,110,
+103,114,101,115,111,103,97,114,99,195,173,97,97,99,99,105,195,179,110,101,99,117
+,97,100,111,114,113,117,105,101,110,101,115,105,110,99,108,117,115,111,100,101,
+98,101,114,195,161,109,97,116,101,114,105,97,104,111,109,98,114,101,115,109,117,
+101,115,116,114,97,112,111,100,114,195,173,97,109,97,195,177,97,110,97,195,186,
+108,116,105,109,97,101,115,116,97,109,111,115,111,102,105,99,105,97,108,116,97,
+109,98,105,101,110,110,105,110,103,195,186,110,115,97,108,117,100,111,115,112,
+111,100,101,109,111,115,109,101,106,111,114,97,114,112,111,115,105,116,105,111,
+110,98,117,115,105,110,101,115,115,104,111,109,101,112,97,103,101,115,101,99,117
+,114,105,116,121,108,97,110,103,117,97,103,101,115,116,97,110,100,97,114,100,99,
+97,109,112,97,105,103,110,102,101,97,116,117,114,101,115,99,97,116,101,103,111,
+114,121,101,120,116,101,114,110,97,108,99,104,105,108,100,114,101,110,114,101,
+115,101,114,118,101,100,114,101,115,101,97,114,99,104,101,120,99,104,97,110,103,
+101,102,97,118,111,114,105,116,101,116,101,109,112,108,97,116,101,109,105,108,
+105,116,97,114,121,105,110,100,117,115,116,114,121,115,101,114,118,105,99,101,
+115,109,97,116,101,114,105,97,108,112,114,111,100,117,99,116,115,122,45,105,110,
+100,101,120,58,99,111,109,109,101,110,116,115,115,111,102,116,119,97,114,101,99,
+111,109,112,108,101,116,101,99,97,108,101,110,100,97,114,112,108,97,116,102,111,
+114,109,97,114,116,105,99,108,101,115,114,101,113,117,105,114,101,100,109,111,
+118,101,109,101,110,116,113,117,101,115,116,105,111,110,98,117,105,108,100,105,
+110,103,112,111,108,105,116,105,99,115,112,111,115,115,105,98,108,101,114,101,
+108,105,103,105,111,110,112,104,121,115,105,99,97,108,102,101,101,100,98,97,99,
+107,114,101,103,105,115,116,101,114,112,105,99,116,117,114,101,115,100,105,115,
+97,98,108,101,100,112,114,111,116,111,99,111,108,97,117,100,105,101,110,99,101,
+115,101,116,116,105,110,103,115,97,99,116,105,118,105,116,121,101,108,101,109,
+101,110,116,115,108,101,97,114,110,105,110,103,97,110,121,116,104,105,110,103,97
+,98,115,116,114,97,99,116,112,114,111,103,114,101,115,115,111,118,101,114,118,
+105,101,119,109,97,103,97,122,105,110,101,101,99,111,110,111,109,105,99,116,114,
+97,105,110,105,110,103,112,114,101,115,115,117,114,101,118,97,114,105,111,117,
+115,32,60,115,116,114,111,110,103,62,112,114,111,112,101,114,116,121,115,104,111
+,112,112,105,110,103,116,111,103,101,116,104,101,114,97,100,118,97,110,99,101,
+100,98,101,104,97,118,105,111,114,100,111,119,110,108,111,97,100,102,101,97,116,
+117,114,101,100,102,111,111,116,98,97,108,108,115,101,108,101,99,116,101,100,76,
+97,110,103,117,97,103,101,100,105,115,116,97,110,99,101,114,101,109,101,109,98,
+101,114,116,114,97,99,107,105,110,103,112,97,115,115,119,111,114,100,109,111,100
+,105,102,105,101,100,115,116,117,100,101,110,116,115,100,105,114,101,99,116,108,
+121,102,105,103,104,116,105,110,103,110,111,114,116,104,101,114,110,100,97,116,
+97,98,97,115,101,102,101,115,116,105,118,97,108,98,114,101,97,107,105,110,103,
+108,111,99,97,116,105,111,110,105,110,116,101,114,110,101,116,100,114,111,112,
+100,111,119,110,112,114,97,99,116,105,99,101,101,118,105,100,101,110,99,101,102,
+117,110,99,116,105,111,110,109,97,114,114,105,97,103,101,114,101,115,112,111,110
+,115,101,112,114,111,98,108,101,109,115,110,101,103,97,116,105,118,101,112,114,
+111,103,114,97,109,115,97,110,97,108,121,115,105,115,114,101,108,101,97,115,101,
+100,98,97,110,110,101,114,34,62,112,117,114,99,104,97,115,101,112,111,108,105,99
+,105,101,115,114,101,103,105,111,110,97,108,99,114,101,97,116,105,118,101,97,114
+,103,117,109,101,110,116,98,111,111,107,109,97,114,107,114,101,102,101,114,114,
+101,114,99,104,101,109,105,99,97,108,100,105,118,105,115,105,111,110,99,97,108,
+108,98,97,99,107,115,101,112,97,114,97,116,101,112,114,111,106,101,99,116,115,99
+,111,110,102,108,105,99,116,104,97,114,100,119,97,114,101,105,110,116,101,114,
+101,115,116,100,101,108,105,118,101,114,121,109,111,117,110,116,97,105,110,111,
+98,116,97,105,110,101,100,61,32,102,97,108,115,101,59,102,111,114,40,118,97,114,
+32,97,99,99,101,112,116,101,100,99,97,112,97,99,105,116,121,99,111,109,112,117,
+116,101,114,105,100,101,110,116,105,116,121,97,105,114,99,114,97,102,116,101,109
+,112,108,111,121,101,100,112,114,111,112,111,115,101,100,100,111,109,101,115,116
+,105,99,105,110,99,108,117,100,101,115,112,114,111,118,105,100,101,100,104,111,
+115,112,105,116,97,108,118,101,114,116,105,99,97,108,99,111,108,108,97,112,115,
+101,97,112,112,114,111,97,99,104,112,97,114,116,110,101,114,115,108,111,103,111,
+34,62,60,97,100,97,117,103,104,116,101,114,97,117,116,104,111,114,34,32,99,117,
+108,116,117,114,97,108,102,97,109,105,108,105,101,115,47,105,109,97,103,101,115,
+47,97,115,115,101,109,98,108,121,112,111,119,101,114,102,117,108,116,101,97,99,
+104,105,110,103,102,105,110,105,115,104,101,100,100,105,115,116,114,105,99,116,
+99,114,105,116,105,99,97,108,99,103,105,45,98,105,110,47,112,117,114,112,111,115
+,101,115,114,101,113,117,105,114,101,115,101,108,101,99,116,105,111,110,98,101,
+99,111,109,105,110,103,112,114,111,118,105,100,101,115,97,99,97,100,101,109,105,
+99,101,120,101,114,99,105,115,101,97,99,116,117,97,108,108,121,109,101,100,105,
+99,105,110,101,99,111,110,115,116,97,110,116,97,99,99,105,100,101,110,116,77,97,
+103,97,122,105,110,101,100,111,99,117,109,101,110,116,115,116,97,114,116,105,110
+,103,98,111,116,116,111,109,34,62,111,98,115,101,114,118,101,100,58,32,38,113,
+117,111,116,59,101,120,116,101,110,100,101,100,112,114,101,118,105,111,117,115,
+83,111,102,116,119,97,114,101,99,117,115,116,111,109,101,114,100,101,99,105,115,
+105,111,110,115,116,114,101,110,103,116,104,100,101,116,97,105,108,101,100,115,
+108,105,103,104,116,108,121,112,108,97,110,110,105,110,103,116,101,120,116,97,
+114,101,97,99,117,114,114,101,110,99,121,101,118,101,114,121,111,110,101,115,116
+,114,97,105,103,104,116,116,114,97,110,115,102,101,114,112,111,115,105,116,105,
+118,101,112,114,111,100,117,99,101,100,104,101,114,105,116,97,103,101,115,104,
+105,112,112,105,110,103,97,98,115,111,108,117,116,101,114,101,99,101,105,118,101
+,100,114,101,108,101,118,97,110,116,98,117,116,116,111,110,34,32,118,105,111,108
+,101,110,99,101,97,110,121,119,104,101,114,101,98,101,110,101,102,105,116,115,
+108,97,117,110,99,104,101,100,114,101,99,101,110,116,108,121,97,108,108,105,97,
+110,99,101,102,111,108,108,111,119,101,100,109,117,108,116,105,112,108,101,98,
+117,108,108,101,116,105,110,105,110,99,108,117,100,101,100,111,99,99,117,114,114
+,101,100,105,110,116,101,114,110,97,108,36,40,116,104,105,115,41,46,114,101,112,
+117,98,108,105,99,62,60,116,114,62,60,116,100,99,111,110,103,114,101,115,115,114
+,101,99,111,114,100,101,100,117,108,116,105,109,97,116,101,115,111,108,117,116,
+105,111,110,60,117,108,32,105,100,61,34,100,105,115,99,111,118,101,114,72,111,
+109,101,60,47,97,62,119,101,98,115,105,116,101,115,110,101,116,119,111,114,107,
+115,97,108,116,104,111,117,103,104,101,110,116,105,114,101,108,121,109,101,109,
+111,114,105,97,108,109,101,115,115,97,103,101,115,99,111,110,116,105,110,117,101
+,97,99,116,105,118,101,34,62,115,111,109,101,119,104,97,116,118,105,99,116,111,
+114,105,97,87,101,115,116,101,114,110,32,32,116,105,116,108,101,61,34,76,111,99,
+97,116,105,111,110,99,111,110,116,114,97,99,116,118,105,115,105,116,111,114,115,
+68,111,119,110,108,111,97,100,119,105,116,104,111,117,116,32,114,105,103,104,116
+,34,62,10,109,101,97,115,117,114,101,115,119,105,100,116,104,32,61,32,118,97,114
+,105,97,98,108,101,105,110,118,111,108,118,101,100,118,105,114,103,105,110,105,
+97,110,111,114,109,97,108,108,121,104,97,112,112,101,110,101,100,97,99,99,111,
+117,110,116,115,115,116,97,110,100,105,110,103,110,97,116,105,111,110,97,108,82,
+101,103,105,115,116,101,114,112,114,101,112,97,114,101,100,99,111,110,116,114,
+111,108,115,97,99,99,117,114,97,116,101,98,105,114,116,104,100,97,121,115,116,
+114,97,116,101,103,121,111,102,102,105,99,105,97,108,103,114,97,112,104,105,99,
+115,99,114,105,109,105,110,97,108,112,111,115,115,105,98,108,121,99,111,110,115,
+117,109,101,114,80,101,114,115,111,110,97,108,115,112,101,97,107,105,110,103,118
+,97,108,105,100,97,116,101,97,99,104,105,101,118,101,100,46,106,112,103,34,32,47
+,62,109,97,99,104,105,110,101,115,60,47,104,50,62,10,32,32,107,101,121,119,111,
+114,100,115,102,114,105,101,110,100,108,121,98,114,111,116,104,101,114,115,99,
+111,109,98,105,110,101,100,111,114,105,103,105,110,97,108,99,111,109,112,111,115
+,101,100,101,120,112,101,99,116,101,100,97,100,101,113,117,97,116,101,112,97,107
+,105,115,116,97,110,102,111,108,108,111,119,34,32,118,97,108,117,97,98,108,101,
+60,47,108,97,98,101,108,62,114,101,108,97,116,105,118,101,98,114,105,110,103,105
+,110,103,105,110,99,114,101,97,115,101,103,111,118,101,114,110,111,114,112,108,
+117,103,105,110,115,47,76,105,115,116,32,111,102,32,72,101,97,100,101,114,34,62,
+34,32,110,97,109,101,61,34,32,40,38,113,117,111,116,59,103,114,97,100,117,97,116
+,101,60,47,104,101,97,100,62,10,99,111,109,109,101,114,99,101,109,97,108,97,121,
+115,105,97,100,105,114,101,99,116,111,114,109,97,105,110,116,97,105,110,59,104,
+101,105,103,104,116,58,115,99,104,101,100,117,108,101,99,104,97,110,103,105,110,
+103,98,97,99,107,32,116,111,32,99,97,116,104,111,108,105,99,112,97,116,116,101,
+114,110,115,99,111,108,111,114,58,32,35,103,114,101,97,116,101,115,116,115,117,
+112,112,108,105,101,115,114,101,108,105,97,98,108,101,60,47,117,108,62,10,9,9,60
+,115,101,108,101,99,116,32,99,105,116,105,122,101,110,115,99,108,111,116,104,105
+,110,103,119,97,116,99,104,105,110,103,60,108,105,32,105,100,61,34,115,112,101,
+99,105,102,105,99,99,97,114,114,121,105,110,103,115,101,110,116,101,110,99,101,
+60,99,101,110,116,101,114,62,99,111,110,116,114,97,115,116,116,104,105,110,107,
+105,110,103,99,97,116,99,104,40,101,41,115,111,117,116,104,101,114,110,77,105,99
+,104,97,101,108,32,109,101,114,99,104,97,110,116,99,97,114,111,117,115,101,108,
+112,97,100,100,105,110,103,58,105,110,116,101,114,105,111,114,46,115,112,108,105
+,116,40,34,108,105,122,97,116,105,111,110,79,99,116,111,98,101,114,32,41,123,114
+,101,116,117,114,110,105,109,112,114,111,118,101,100,45,45,38,103,116,59,10,10,
+99,111,118,101,114,97,103,101,99,104,97,105,114,109,97,110,46,112,110,103,34,32,
+47,62,115,117,98,106,101,99,116,115,82,105,99,104,97,114,100,32,119,104,97,116,
+101,118,101,114,112,114,111,98,97,98,108,121,114,101,99,111,118,101,114,121,98,
+97,115,101,98,97,108,108,106,117,100,103,109,101,110,116,99,111,110,110,101,99,
+116,46,46,99,115,115,34,32,47,62,32,119,101,98,115,105,116,101,114,101,112,111,
+114,116,101,100,100,101,102,97,117,108,116,34,47,62,60,47,97,62,13,10,101,108,
+101,99,116,114,105,99,115,99,111,116,108,97,110,100,99,114,101,97,116,105,111,
+110,113,117,97,110,116,105,116,121,46,32,73,83,66,78,32,48,100,105,100,32,110,
+111,116,32,105,110,115,116,97,110,99,101,45,115,101,97,114,99,104,45,34,32,108,
+97,110,103,61,34,115,112,101,97,107,101,114,115,67,111,109,112,117,116,101,114,
+99,111,110,116,97,105,110,115,97,114,99,104,105,118,101,115,109,105,110,105,115,
+116,101,114,114,101,97,99,116,105,111,110,100,105,115,99,111,117,110,116,73,116,
+97,108,105,97,110,111,99,114,105,116,101,114,105,97,115,116,114,111,110,103,108,
+121,58,32,39,104,116,116,112,58,39,115,99,114,105,112,116,39,99,111,118,101,114,
+105,110,103,111,102,102,101,114,105,110,103,97,112,112,101,97,114,101,100,66,114
+,105,116,105,115,104,32,105,100,101,110,116,105,102,121,70,97,99,101,98,111,111,
+107,110,117,109,101,114,111,117,115,118,101,104,105,99,108,101,115,99,111,110,99
+,101,114,110,115,65,109,101,114,105,99,97,110,104,97,110,100,108,105,110,103,100
+,105,118,32,105,100,61,34,87,105,108,108,105,97,109,32,112,114,111,118,105,100,
+101,114,95,99,111,110,116,101,110,116,97,99,99,117,114,97,99,121,115,101,99,116,
+105,111,110,32,97,110,100,101,114,115,111,110,102,108,101,120,105,98,108,101,67,
+97,116,101,103,111,114,121,108,97,119,114,101,110,99,101,60,115,99,114,105,112,
+116,62,108,97,121,111,117,116,61,34,97,112,112,114,111,118,101,100,32,109,97,120
+,105,109,117,109,104,101,97,100,101,114,34,62,60,47,116,97,98,108,101,62,83,101,
+114,118,105,99,101,115,104,97,109,105,108,116,111,110,99,117,114,114,101,110,116
+,32,99,97,110,97,100,105,97,110,99,104,97,110,110,101,108,115,47,116,104,101,109
+,101,115,47,47,97,114,116,105,99,108,101,111,112,116,105,111,110,97,108,112,111,
+114,116,117,103,97,108,118,97,108,117,101,61,34,34,105,110,116,101,114,118,97,
+108,119,105,114,101,108,101,115,115,101,110,116,105,116,108,101,100,97,103,101,
+110,99,105,101,115,83,101,97,114,99,104,34,32,109,101,97,115,117,114,101,100,116
+,104,111,117,115,97,110,100,115,112,101,110,100,105,110,103,38,104,101,108,108,
+105,112,59,110,101,119,32,68,97,116,101,34,32,115,105,122,101,61,34,112,97,103,
+101,78,97,109,101,109,105,100,100,108,101,34,32,34,32,47,62,60,47,97,62,104,105,
+100,100,101,110,34,62,115,101,113,117,101,110,99,101,112,101,114,115,111,110,97,
+108,111,118,101,114,102,108,111,119,111,112,105,110,105,111,110,115,105,108,108,
+105,110,111,105,115,108,105,110,107,115,34,62,10,9,60,116,105,116,108,101,62,118
+,101,114,115,105,111,110,115,115,97,116,117,114,100,97,121,116,101,114,109,105,
+110,97,108,105,116,101,109,112,114,111,112,101,110,103,105,110,101,101,114,115,
+101,99,116,105,111,110,115,100,101,115,105,103,110,101,114,112,114,111,112,111,
+115,97,108,61,34,102,97,108,115,101,34,69,115,112,97,195,177,111,108,114,101,108
+,101,97,115,101,115,115,117,98,109,105,116,34,32,101,114,38,113,117,111,116,59,
+97,100,100,105,116,105,111,110,115,121,109,112,116,111,109,115,111,114,105,101,
+110,116,101,100,114,101,115,111,117,114,99,101,114,105,103,104,116,34,62,60,112,
+108,101,97,115,117,114,101,115,116,97,116,105,111,110,115,104,105,115,116,111,
+114,121,46,108,101,97,118,105,110,103,32,32,98,111,114,100,101,114,61,99,111,110
+,116,101,110,116,115,99,101,110,116,101,114,34,62,46,10,10,83,111,109,101,32,100
+,105,114,101,99,116,101,100,115,117,105,116,97,98,108,101,98,117,108,103,97,114,
+105,97,46,115,104,111,119,40,41,59,100,101,115,105,103,110,101,100,71,101,110,
+101,114,97,108,32,99,111,110,99,101,112,116,115,69,120,97,109,112,108,101,115,
+119,105,108,108,105,97,109,115,79,114,105,103,105,110,97,108,34,62,60,115,112,97
+,110,62,115,101,97,114,99,104,34,62,111,112,101,114,97,116,111,114,114,101,113,
+117,101,115,116,115,97,32,38,113,117,111,116,59,97,108,108,111,119,105,110,103,
+68,111,99,117,109,101,110,116,114,101,118,105,115,105,111,110,46,32,10,10,84,104
+,101,32,121,111,117,114,115,101,108,102,67,111,110,116,97,99,116,32,109,105,99,
+104,105,103,97,110,69,110,103,108,105,115,104,32,99,111,108,117,109,98,105,97,
+112,114,105,111,114,105,116,121,112,114,105,110,116,105,110,103,100,114,105,110,
+107,105,110,103,102,97,99,105,108,105,116,121,114,101,116,117,114,110,101,100,67
+,111,110,116,101,110,116,32,111,102,102,105,99,101,114,115,82,117,115,115,105,97
+,110,32,103,101,110,101,114,97,116,101,45,56,56,53,57,45,49,34,105,110,100,105,
+99,97,116,101,102,97,109,105,108,105,97,114,32,113,117,97,108,105,116,121,109,97
+,114,103,105,110,58,48,32,99,111,110,116,101,110,116,118,105,101,119,112,111,114
+,116,99,111,110,116,97,99,116,115,45,116,105,116,108,101,34,62,112,111,114,116,
+97,98,108,101,46,108,101,110,103,116,104,32,101,108,105,103,105,98,108,101,105,
+110,118,111,108,118,101,115,97,116,108,97,110,116,105,99,111,110,108,111,97,100,
+61,34,100,101,102,97,117,108,116,46,115,117,112,112,108,105,101,100,112,97,121,
+109,101,110,116,115,103,108,111,115,115,97,114,121,10,10,65,102,116,101,114,32,
+103,117,105,100,97,110,99,101,60,47,116,100,62,60,116,100,101,110,99,111,100,105
+,110,103,109,105,100,100,108,101,34,62,99,97,109,101,32,116,111,32,100,105,115,
+112,108,97,121,115,115,99,111,116,116,105,115,104,106,111,110,97,116,104,97,110,
+109,97,106,111,114,105,116,121,119,105,100,103,101,116,115,46,99,108,105,110,105
+,99,97,108,116,104,97,105,108,97,110,100,116,101,97,99,104,101,114,115,60,104,
+101,97,100,62,10,9,97,102,102,101,99,116,101,100,115,117,112,112,111,114,116,115
+,112,111,105,110,116,101,114,59,116,111,83,116,114,105,110,103,60,47,115,109,97,
+108,108,62,111,107,108,97,104,111,109,97,119,105,108,108,32,98,101,32,105,110,
+118,101,115,116,111,114,48,34,32,97,108,116,61,34,104,111,108,105,100,97,121,115
+,82,101,115,111,117,114,99,101,108,105,99,101,110,115,101,100,32,40,119,104,105,
+99,104,32,46,32,65,102,116,101,114,32,99,111,110,115,105,100,101,114,118,105,115
+,105,116,105,110,103,101,120,112,108,111,114,101,114,112,114,105,109,97,114,121,
+32,115,101,97,114,99,104,34,32,97,110,100,114,111,105,100,34,113,117,105,99,107,
+108,121,32,109,101,101,116,105,110,103,115,101,115,116,105,109,97,116,101,59,114
+,101,116,117,114,110,32,59,99,111,108,111,114,58,35,32,104,101,105,103,104,116,
+61,97,112,112,114,111,118,97,108,44,32,38,113,117,111,116,59,32,99,104,101,99,
+107,101,100,46,109,105,110,46,106,115,34,109,97,103,110,101,116,105,99,62,60,47,
+97,62,60,47,104,102,111,114,101,99,97,115,116,46,32,87,104,105,108,101,32,116,
+104,117,114,115,100,97,121,100,118,101,114,116,105,115,101,38,101,97,99,117,116,
+101,59,104,97,115,67,108,97,115,115,101,118,97,108,117,97,116,101,111,114,100,
+101,114,105,110,103,101,120,105,115,116,105,110,103,112,97,116,105,101,110,116,
+115,32,79,110,108,105,110,101,32,99,111,108,111,114,97,100,111,79,112,116,105,
+111,110,115,34,99,97,109,112,98,101,108,108,60,33,45,45,32,101,110,100,60,47,115
+,112,97,110,62,60,60,98,114,32,47,62,13,10,95,112,111,112,117,112,115,124,115,99
+,105,101,110,99,101,115,44,38,113,117,111,116,59,32,113,117,97,108,105,116,121,
+32,87,105,110,100,111,119,115,32,97,115,115,105,103,110,101,100,104,101,105,103,
+104,116,58,32,60,98,32,99,108,97,115,115,108,101,38,113,117,111,116,59,32,118,97
+,108,117,101,61,34,32,67,111,109,112,97,110,121,101,120,97,109,112,108,101,115,
+60,105,102,114,97,109,101,32,98,101,108,105,101,118,101,115,112,114,101,115,101,
+110,116,115,109,97,114,115,104,97,108,108,112,97,114,116,32,111,102,32,112,114,
+111,112,101,114,108,121,41,46,10,10,84,104,101,32,116,97,120,111,110,111,109,121
+,109,117,99,104,32,111,102,32,60,47,115,112,97,110,62,10,34,32,100,97,116,97,45,
+115,114,116,117,103,117,195,170,115,115,99,114,111,108,108,84,111,32,112,114,111
+,106,101,99,116,60,104,101,97,100,62,13,10,97,116,116,111,114,110,101,121,101,
+109,112,104,97,115,105,115,115,112,111,110,115,111,114,115,102,97,110,99,121,98,
+111,120,119,111,114,108,100,39,115,32,119,105,108,100,108,105,102,101,99,104,101
+,99,107,101,100,61,115,101,115,115,105,111,110,115,112,114,111,103,114,97,109,
+109,112,120,59,102,111,110,116,45,32,80,114,111,106,101,99,116,106,111,117,114,
+110,97,108,115,98,101,108,105,101,118,101,100,118,97,99,97,116,105,111,110,116,
+104,111,109,112,115,111,110,108,105,103,104,116,105,110,103,97,110,100,32,116,
+104,101,32,115,112,101,99,105,97,108,32,98,111,114,100,101,114,61,48,99,104,101,
+99,107,105,110,103,60,47,116,98,111,100,121,62,60,98,117,116,116,111,110,32,67,
+111,109,112,108,101,116,101,99,108,101,97,114,102,105,120,10,60,104,101,97,100,
+62,10,97,114,116,105,99,108,101,32,60,115,101,99,116,105,111,110,102,105,110,100
+,105,110,103,115,114,111,108,101,32,105,110,32,112,111,112,117,108,97,114,32,32,
+79,99,116,111,98,101,114,119,101,98,115,105,116,101,32,101,120,112,111,115,117,
+114,101,117,115,101,100,32,116,111,32,32,99,104,97,110,103,101,115,111,112,101,
+114,97,116,101,100,99,108,105,99,107,105,110,103,101,110,116,101,114,105,110,103
+,99,111,109,109,97,110,100,115,105,110,102,111,114,109,101,100,32,110,117,109,98
+,101,114,115,32,32,60,47,100,105,118,62,99,114,101,97,116,105,110,103,111,110,83
+,117,98,109,105,116,109,97,114,121,108,97,110,100,99,111,108,108,101,103,101,115
+,97,110,97,108,121,116,105,99,108,105,115,116,105,110,103,115,99,111,110,116,97,
+99,116,46,108,111,103,103,101,100,73,110,97,100,118,105,115,111,114,121,115,105,
+98,108,105,110,103,115,99,111,110,116,101,110,116,34,115,38,113,117,111,116,59,
+41,115,46,32,84,104,105,115,32,112,97,99,107,97,103,101,115,99,104,101,99,107,98
+,111,120,115,117,103,103,101,115,116,115,112,114,101,103,110,97,110,116,116,111,
+109,111,114,114,111,119,115,112,97,99,105,110,103,61,105,99,111,110,46,112,110,
+103,106,97,112,97,110,101,115,101,99,111,100,101,98,97,115,101,98,117,116,116,
+111,110,34,62,103,97,109,98,108,105,110,103,115,117,99,104,32,97,115,32,44,32,
+119,104,105,108,101,32,60,47,115,112,97,110,62,32,109,105,115,115,111,117,114,
+105,115,112,111,114,116,105,110,103,116,111,112,58,49,112,120,32,46,60,47,115,
+112,97,110,62,116,101,110,115,105,111,110,115,119,105,100,116,104,61,34,50,108,
+97,122,121,108,111,97,100,110,111,118,101,109,98,101,114,117,115,101,100,32,105,
+110,32,104,101,105,103,104,116,61,34,99,114,105,112,116,34,62,10,38,110,98,115,
+112,59,60,47,60,116,114,62,60,116,100,32,104,101,105,103,104,116,58,50,47,112,
+114,111,100,117,99,116,99,111,117,110,116,114,121,32,105,110,99,108,117,100,101,
+32,102,111,111,116,101,114,34,32,38,108,116,59,33,45,45,32,116,105,116,108,101,
+34,62,60,47,106,113,117,101,114,121,46,60,47,102,111,114,109,62,10,40,231,174,
+128,228,189,147,41,40,231,185,129,233,171,148,41,104,114,118,97,116,115,107,105,
+105,116,97,108,105,97,110,111,114,111,109,195,162,110,196,131,116,195,188,114,
+107,195,167,101,216,167,216,177,216,175,217,136,116,97,109,98,105,195,169,110,
+110,111,116,105,99,105,97,115,109,101,110,115,97,106,101,115,112,101,114,115,111
+,110,97,115,100,101,114,101,99,104,111,115,110,97,99,105,111,110,97,108,115,101,
+114,118,105,99,105,111,99,111,110,116,97,99,116,111,117,115,117,97,114,105,111,
+115,112,114,111,103,114,97,109,97,103,111,98,105,101,114,110,111,101,109,112,114
+,101,115,97,115,97,110,117,110,99,105,111,115,118,97,108,101,110,99,105,97,99,
+111,108,111,109,98,105,97,100,101,115,112,117,195,169,115,100,101,112,111,114,
+116,101,115,112,114,111,121,101,99,116,111,112,114,111,100,117,99,116,111,112,
+195,186,98,108,105,99,111,110,111,115,111,116,114,111,115,104,105,115,116,111,
+114,105,97,112,114,101,115,101,110,116,101,109,105,108,108,111,110,101,115,109,
+101,100,105,97,110,116,101,112,114,101,103,117,110,116,97,97,110,116,101,114,105
+,111,114,114,101,99,117,114,115,111,115,112,114,111,98,108,101,109,97,115,97,110
+,116,105,97,103,111,110,117,101,115,116,114,111,115,111,112,105,110,105,195,179,
+110,105,109,112,114,105,109,105,114,109,105,101,110,116,114,97,115,97,109,195,
+169,114,105,99,97,118,101,110,100,101,100,111,114,115,111,99,105,101,100,97,100,
+114,101,115,112,101,99,116,111,114,101,97,108,105,122,97,114,114,101,103,105,115
+,116,114,111,112,97,108,97,98,114,97,115,105,110,116,101,114,195,169,115,101,110
+,116,111,110,99,101,115,101,115,112,101,99,105,97,108,109,105,101,109,98,114,111
+,115,114,101,97,108,105,100,97,100,99,195,179,114,100,111,98,97,122,97,114,97,
+103,111,122,97,112,195,161,103,105,110,97,115,115,111,99,105,97,108,101,115,98,
+108,111,113,117,101,97,114,103,101,115,116,105,195,179,110,97,108,113,117,105,
+108,101,114,115,105,115,116,101,109,97,115,99,105,101,110,99,105,97,115,99,111,
+109,112,108,101,116,111,118,101,114,115,105,195,179,110,99,111,109,112,108,101,
+116,97,101,115,116,117,100,105,111,115,112,195,186,98,108,105,99,97,111,98,106,
+101,116,105,118,111,97,108,105,99,97,110,116,101,98,117,115,99,97,100,111,114,99
+,97,110,116,105,100,97,100,101,110,116,114,97,100,97,115,97,99,99,105,111,110,
+101,115,97,114,99,104,105,118,111,115,115,117,112,101,114,105,111,114,109,97,121
+,111,114,195,173,97,97,108,101,109,97,110,105,97,102,117,110,99,105,195,179,110,
+195,186,108,116,105,109,111,115,104,97,99,105,101,110,100,111,97,113,117,101,108
+,108,111,115,101,100,105,99,105,195,179,110,102,101,114,110,97,110,100,111,97,
+109,98,105,101,110,116,101,102,97,99,101,98,111,111,107,110,117,101,115,116,114,
+97,115,99,108,105,101,110,116,101,115,112,114,111,99,101,115,111,115,98,97,115,
+116,97,110,116,101,112,114,101,115,101,110,116,97,114,101,112,111,114,116,97,114
+,99,111,110,103,114,101,115,111,112,117,98,108,105,99,97,114,99,111,109,101,114,
+99,105,111,99,111,110,116,114,97,116,111,106,195,179,118,101,110,101,115,100,105
+,115,116,114,105,116,111,116,195,169,99,110,105,99,97,99,111,110,106,117,110,116
+,111,101,110,101,114,103,195,173,97,116,114,97,98,97,106,97,114,97,115,116,117,
+114,105,97,115,114,101,99,105,101,110,116,101,117,116,105,108,105,122,97,114,98,
+111,108,101,116,195,173,110,115,97,108,118,97,100,111,114,99,111,114,114,101,99,
+116,97,116,114,97,98,97,106,111,115,112,114,105,109,101,114,111,115,110,101,103,
+111,99,105,111,115,108,105,98,101,114,116,97,100,100,101,116,97,108,108,101,115,
+112,97,110,116,97,108,108,97,112,114,195,179,120,105,109,111,97,108,109,101,114,
+195,173,97,97,110,105,109,97,108,101,115,113,117,105,195,169,110,101,115,99,111,
+114,97,122,195,179,110,115,101,99,99,105,195,179,110,98,117,115,99,97,110,100,
+111,111,112,99,105,111,110,101,115,101,120,116,101,114,105,111,114,99,111,110,99
+,101,112,116,111,116,111,100,97,118,195,173,97,103,97,108,101,114,195,173,97,101
+,115,99,114,105,98,105,114,109,101,100,105,99,105,110,97,108,105,99,101,110,99,
+105,97,99,111,110,115,117,108,116,97,97,115,112,101,99,116,111,115,99,114,195,
+173,116,105,99,97,100,195,179,108,97,114,101,115,106,117,115,116,105,99,105,97,
+100,101,98,101,114,195,161,110,112,101,114,195,173,111,100,111,110,101,99,101,
+115,105,116,97,109,97,110,116,101,110,101,114,112,101,113,117,101,195,177,111,
+114,101,99,105,98,105,100,97,116,114,105,98,117,110,97,108,116,101,110,101,114,
+105,102,101,99,97,110,99,105,195,179,110,99,97,110,97,114,105,97,115,100,101,115
+,99,97,114,103,97,100,105,118,101,114,115,111,115,109,97,108,108,111,114,99,97,
+114,101,113,117,105,101,114,101,116,195,169,99,110,105,99,111,100,101,98,101,114
+,195,173,97,118,105,118,105,101,110,100,97,102,105,110,97,110,122,97,115,97,100,
+101,108,97,110,116,101,102,117,110,99,105,111,110,97,99,111,110,115,101,106,111,
+115,100,105,102,195,173,99,105,108,99,105,117,100,97,100,101,115,97,110,116,105,
+103,117,97,115,97,118,97,110,122,97,100,97,116,195,169,114,109,105,110,111,117,
+110,105,100,97,100,101,115,115,195,161,110,99,104,101,122,99,97,109,112,97,195,
+177,97,115,111,102,116,111,110,105,99,114,101,118,105,115,116,97,115,99,111,110,
+116,105,101,110,101,115,101,99,116,111,114,101,115,109,111,109,101,110,116,111,
+115,102,97,99,117,108,116,97,100,99,114,195,169,100,105,116,111,100,105,118,101,
+114,115,97,115,115,117,112,117,101,115,116,111,102,97,99,116,111,114,101,115,115
+,101,103,117,110,100,111,115,112,101,113,117,101,195,177,97,208,179,208,190,208,
+180,208,176,208,181,209,129,208,187,208,184,208,181,209,129,209,130,209,140,208,
+177,209,139,208,187,208,190,208,177,209,139,209,130,209,140,209,141,209,130,208,
+190,208,188,208,149,209,129,208,187,208,184,209,130,208,190,208,179,208,190,208,
+188,208,181,208,189,209,143,208,178,209,129,208,181,209,133,209,141,209,130,208,
+190,208,185,208,180,208,176,208,182,208,181,208,177,209,139,208,187,208,184,208,
+179,208,190,208,180,209,131,208,180,208,181,208,189,209,140,209,141,209,130,208,
+190,209,130,208,177,209,139,208,187,208,176,209,129,208,181,208,177,209,143,208,
+190,208,180,208,184,208,189,209,129,208,181,208,177,208,181,208,189,208,176,208,
+180,208,190,209,129,208,176,208,185,209,130,209,132,208,190,209,130,208,190,208,
+189,208,181,208,179,208,190,209,129,208,178,208,190,208,184,209,129,208,178,208,
+190,208,185,208,184,208,179,209,128,209,139,209,130,208,190,208,182,208,181,208,
+178,209,129,208,181,208,188,209,129,208,178,208,190,209,142,208,187,208,184,209,
+136,209,140,209,141,209,130,208,184,209,133,208,191,208,190,208,186,208,176,208,
+180,208,189,208,181,208,185,208,180,208,190,208,188,208,176,208,188,208,184,209,
+128,208,176,208,187,208,184,208,177,208,190,209,130,208,181,208,188,209,131,209,
+133,208,190,209,130,209,143,208,180,208,178,209,131,209,133,209,129,208,181,209,
+130,208,184,208,187,209,142,208,180,208,184,208,180,208,181,208,187,208,190,208,
+188,208,184,209,128,208,181,209,130,208,181,208,177,209,143,209,129,208,178,208,
+190,208,181,208,178,208,184,208,180,208,181,209,135,208,181,208,179,208,190,209,
+141,209,130,208,184,208,188,209,129,209,135,208,181,209,130,209,130,208,181,208,
+188,209,139,209,134,208,181,208,189,209,139,209,129,209,130,208,176,208,187,208,
+178,208,181,208,180,209,140,209,130,208,181,208,188,208,181,208,178,208,190,208,
+180,209,139,209,130,208,181,208,177,208,181,208,178,209,139,209,136,208,181,208,
+189,208,176,208,188,208,184,209,130,208,184,208,191,208,176,209,130,208,190,208,
+188,209,131,208,191,209,128,208,176,208,178,208,187,208,184,209,134,208,176,208,
+190,208,180,208,189,208,176,208,179,208,190,208,180,209,139,208,183,208,189,208,
+176,209,142,208,188,208,190,208,179,209,131,208,180,209,128,209,131,208,179,208,
+178,209,129,208,181,208,185,208,184,208,180,208,181,209,130,208,186,208,184,208,
+189,208,190,208,190,208,180,208,189,208,190,208,180,208,181,208,187,208,176,208,
+180,208,181,208,187,208,181,209,129,209,128,208,190,208,186,208,184,209,142,208,
+189,209,143,208,178,208,181,209,129,209,140,208,149,209,129,209,130,209,140,209,
+128,208,176,208,183,208,176,208,189,208,176,209,136,208,184,216,167,217,132,217,
+132,217,135,216,167,217,132,216,170,217,138,216,172,217,133,217,138,216,185,216,
+174,216,167,216,181,216,169,216,167,217,132,216,176,217,138,216,185,217,132,217,
+138,217,135,216,172,216,175,217,138,216,175,216,167,217,132,216,162,217,134,216,
+167,217,132,216,177,216,175,216,170,216,173,217,131,217,133,216,181,217,129,216,
+173,216,169,217,131,216,167,217,134,216,170,216,167,217,132,217,132,217,138,217,
+138,217,131,217,136,217,134,216,180,216,168,217,131,216,169,217,129,217,138,217,
+135,216,167,216,168,217,134,216,167,216,170,216,173,217,136,216,167,216,161,216,
+163,217,131,216,171,216,177,216,174,217,132,216,167,217,132,216,167,217,132,216,
+173,216,168,216,175,217,132,217,138,217,132,216,175,216,177,217,136,216,179,216,
+167,216,182,216,186,216,183,216,170,217,131,217,136,217,134,217,135,217,134,216,
+167,217,131,216,179,216,167,216,173,216,169,217,134,216,167,216,175,217,138,216,
+167,217,132,216,183,216,168,216,185,217,132,217,138,217,131,216,180,217,131,216,
+177,216,167,217,138,217,133,217,131,217,134,217,133,217,134,217,135,216,167,216,
+180,216,177,217,131,216,169,216,177,216,166,217,138,216,179,217,134,216,180,217,
+138,216,183,217,133,216,167,216,176,216,167,216,167,217,132,217,129,217,134,216,
+180,216,168,216,167,216,168,216,170,216,185,216,168,216,177,216,177,216,173,217,
+133,216,169,217,131,216,167,217,129,216,169,217,138,217,130,217,136,217,132,217,
+133,216,177,217,131,216,178,217,131,217,132,217,133,216,169,216,163,216,173,217,
+133,216,175,217,130,217,132,216,168,217,138,217,138,216,185,217,134,217,138,216,
+181,217,136,216,177,216,169,216,183,216,177,217,138,217,130,216,180,216,167,216,
+177,217,131,216,172,217,136,216,167,217,132,216,163,216,174,216,177,217,137,217,
+133,216,185,217,134,216,167,216,167,216,168,216,173,216,171,216,185,216,177,217,
+136,216,182,216,168,216,180,217,131,217,132,217,133,216,179,216,172,217,132,216,
+168,217,134,216,167,217,134,216,174,216,167,217,132,216,175,217,131,216,170,216,
+167,216,168,217,131,217,132,217,138,216,169,216,168,216,175,217,136,217,134,216,
+163,217,138,216,182,216,167,217,138,217,136,216,172,216,175,217,129,216,177,217,
+138,217,130,217,131,216,170,216,168,216,170,216,163,217,129,216,182,217,132,217,
+133,216,183,216,168,216,174,216,167,217,131,216,171,216,177,216,168,216,167,216,
+177,217,131,216,167,217,129,216,182,217,132,216,167,216,173,217,132,217,137,217,
+134,217,129,216,179,217,135,216,163,217,138,216,167,217,133,216,177,216,175,217,
+136,216,175,216,163,217,134,217,135,216,167,216,175,217,138,217,134,216,167,216,
+167,217,132,216,167,217,134,217,133,216,185,216,177,216,182,216,170,216,185,217,
+132,217,133,216,175,216,167,216,174,217,132,217,133,217,133,217,131,217,134,0,0,
+0,0,0,0,0,0,1,0,1,0,1,0,1,0,2,0,2,0,2,0,2,0,4,0,4,0,4,0,4,0,0,1,2,3,4,5,6,7,7,6,
+5,4,3,2,1,0,8,9,10,11,12,13,14,15,15,14,13,12,11,10,9,8,16,17,18,19,20,21,22,23,
+23,22,21,20,19,18,17,16,24,25,26,27,28,29,30,31,31,30,29,28,27,26,25,24,255,255,
+255,255,0,0,0,0,0,0,0,0,255,255,255,255,1,0,0,0,2,0,0,0,2,0,0,0,1,0,0,0,1,0,0,0,
+3,0,0,0,255,255,0,1,0,0,0,1,0,0,255,255,0,1,0,0,0,8,0,8,0,8,0,8,0,0,0,1,0,2,0,3,
+0,4,0,5,0,6,0,7,114,101,115,111,117,114,99,101,115,99,111,117,110,116,114,105,
+101,115,113,117,101,115,116,105,111,110,115,101,113,117,105,112,109,101,110,116,
+99,111,109,109,117,110,105,116,121,97,118,97,105,108,97,98,108,101,104,105,103,
+104,108,105,103,104,116,68,84,68,47,120,104,116,109,108,109,97,114,107,101,116,
+105,110,103,107,110,111,119,108,101,100,103,101,115,111,109,101,116,104,105,110,
+103,99,111,110,116,97,105,110,101,114,100,105,114,101,99,116,105,111,110,115,117
+,98,115,99,114,105,98,101,97,100,118,101,114,116,105,115,101,99,104,97,114,97,99
+,116,101,114,34,32,118,97,108,117,101,61,34,60,47,115,101,108,101,99,116,62,65,
+117,115,116,114,97,108,105,97,34,32,99,108,97,115,115,61,34,115,105,116,117,97,
+116,105,111,110,97,117,116,104,111,114,105,116,121,102,111,108,108,111,119,105,
+110,103,112,114,105,109,97,114,105,108,121,111,112,101,114,97,116,105,111,110,99
+,104,97,108,108,101,110,103,101,100,101,118,101,108,111,112,101,100,97,110,111,
+110,121,109,111,117,115,102,117,110,99,116,105,111,110,32,102,117,110,99,116,105
+,111,110,115,99,111,109,112,97,110,105,101,115,115,116,114,117,99,116,117,114,
+101,97,103,114,101,101,109,101,110,116,34,32,116,105,116,108,101,61,34,112,111,
+116,101,110,116,105,97,108,101,100,117,99,97,116,105,111,110,97,114,103,117,109,
+101,110,116,115,115,101,99,111,110,100,97,114,121,99,111,112,121,114,105,103,104
+,116,108,97,110,103,117,97,103,101,115,101,120,99,108,117,115,105,118,101,99,111
+,110,100,105,116,105,111,110,60,47,102,111,114,109,62,13,10,115,116,97,116,101,
+109,101,110,116,97,116,116,101,110,116,105,111,110,66,105,111,103,114,97,112,104
+,121,125,32,101,108,115,101,32,123,10,115,111,108,117,116,105,111,110,115,119,
+104,101,110,32,116,104,101,32,65,110,97,108,121,116,105,99,115,116,101,109,112,
+108,97,116,101,115,100,97,110,103,101,114,111,117,115,115,97,116,101,108,108,105
+,116,101,100,111,99,117,109,101,110,116,115,112,117,98,108,105,115,104,101,114,
+105,109,112,111,114,116,97,110,116,112,114,111,116,111,116,121,112,101,105,110,
+102,108,117,101,110,99,101,38,114,97,113,117,111,59,60,47,101,102,102,101,99,116
+,105,118,101,103,101,110,101,114,97,108,108,121,116,114,97,110,115,102,111,114,
+109,98,101,97,117,116,105,102,117,108,116,114,97,110,115,112,111,114,116,111,114
+,103,97,110,105,122,101,100,112,117,98,108,105,115,104,101,100,112,114,111,109,
+105,110,101,110,116,117,110,116,105,108,32,116,104,101,116,104,117,109,98,110,97
+,105,108,78,97,116,105,111,110,97,108,32,46,102,111,99,117,115,40,41,59,111,118,
+101,114,32,116,104,101,32,109,105,103,114,97,116,105,111,110,97,110,110,111,117,
+110,99,101,100,102,111,111,116,101,114,34,62,10,101,120,99,101,112,116,105,111,
+110,108,101,115,115,32,116,104,97,110,101,120,112,101,110,115,105,118,101,102,
+111,114,109,97,116,105,111,110,102,114,97,109,101,119,111,114,107,116,101,114,
+114,105,116,111,114,121,110,100,105,99,97,116,105,111,110,99,117,114,114,101,110
+,116,108,121,99,108,97,115,115,78,97,109,101,99,114,105,116,105,99,105,115,109,
+116,114,97,100,105,116,105,111,110,101,108,115,101,119,104,101,114,101,65,108,
+101,120,97,110,100,101,114,97,112,112,111,105,110,116,101,100,109,97,116,101,114
+,105,97,108,115,98,114,111,97,100,99,97,115,116,109,101,110,116,105,111,110,101,
+100,97,102,102,105,108,105,97,116,101,60,47,111,112,116,105,111,110,62,116,114,
+101,97,116,109,101,110,116,100,105,102,102,101,114,101,110,116,47,100,101,102,97
+,117,108,116,46,80,114,101,115,105,100,101,110,116,111,110,99,108,105,99,107,61,
+34,98,105,111,103,114,97,112,104,121,111,116,104,101,114,119,105,115,101,112,101
+,114,109,97,110,101,110,116,70,114,97,110,195,167,97,105,115,72,111,108,108,121,
+119,111,111,100,101,120,112,97,110,115,105,111,110,115,116,97,110,100,97,114,100
+,115,60,47,115,116,121,108,101,62,10,114,101,100,117,99,116,105,111,110,68,101,
+99,101,109,98,101,114,32,112,114,101,102,101,114,114,101,100,67,97,109,98,114,
+105,100,103,101,111,112,112,111,110,101,110,116,115,66,117,115,105,110,101,115,
+115,32,99,111,110,102,117,115,105,111,110,62,10,60,116,105,116,108,101,62,112,
+114,101,115,101,110,116,101,100,101,120,112,108,97,105,110,101,100,100,111,101,
+115,32,110,111,116,32,119,111,114,108,100,119,105,100,101,105,110,116,101,114,
+102,97,99,101,112,111,115,105,116,105,111,110,115,110,101,119,115,112,97,112,101
+,114,60,47,116,97,98,108,101,62,10,109,111,117,110,116,97,105,110,115,108,105,
+107,101,32,116,104,101,32,101,115,115,101,110,116,105,97,108,102,105,110,97,110,
+99,105,97,108,115,101,108,101,99,116,105,111,110,97,99,116,105,111,110,61,34,47,
+97,98,97,110,100,111,110,101,100,69,100,117,99,97,116,105,111,110,112,97,114,115
+,101,73,110,116,40,115,116,97,98,105,108,105,116,121,117,110,97,98,108,101,32,
+116,111,60,47,116,105,116,108,101,62,10,114,101,108,97,116,105,111,110,115,78,
+111,116,101,32,116,104,97,116,101,102,102,105,99,105,101,110,116,112,101,114,102
+,111,114,109,101,100,116,119,111,32,121,101,97,114,115,83,105,110,99,101,32,116,
+104,101,116,104,101,114,101,102,111,114,101,119,114,97,112,112,101,114,34,62,97,
+108,116,101,114,110,97,116,101,105,110,99,114,101,97,115,101,100,66,97,116,116,
+108,101,32,111,102,112,101,114,99,101,105,118,101,100,116,114,121,105,110,103,32
+,116,111,110,101,99,101,115,115,97,114,121,112,111,114,116,114,97,121,101,100,
+101,108,101,99,116,105,111,110,115,69,108,105,122,97,98,101,116,104,60,47,105,
+102,114,97,109,101,62,100,105,115,99,111,118,101,114,121,105,110,115,117,114,97,
+110,99,101,115,46,108,101,110,103,116,104,59,108,101,103,101,110,100,97,114,121,
+71,101,111,103,114,97,112,104,121,99,97,110,100,105,100,97,116,101,99,111,114,
+112,111,114,97,116,101,115,111,109,101,116,105,109,101,115,115,101,114,118,105,
+99,101,115,46,105,110,104,101,114,105,116,101,100,60,47,115,116,114,111,110,103,
+62,67,111,109,109,117,110,105,116,121,114,101,108,105,103,105,111,117,115,108,
+111,99,97,116,105,111,110,115,67,111,109,109,105,116,116,101,101,98,117,105,108,
+100,105,110,103,115,116,104,101,32,119,111,114,108,100,110,111,32,108,111,110,
+103,101,114,98,101,103,105,110,110,105,110,103,114,101,102,101,114,101,110,99,
+101,99,97,110,110,111,116,32,98,101,102,114,101,113,117,101,110,99,121,116,121,
+112,105,99,97,108,108,121,105,110,116,111,32,116,104,101,32,114,101,108,97,116,
+105,118,101,59,114,101,99,111,114,100,105,110,103,112,114,101,115,105,100,101,
+110,116,105,110,105,116,105,97,108,108,121,116,101,99,104,110,105,113,117,101,
+116,104,101,32,111,116,104,101,114,105,116,32,99,97,110,32,98,101,101,120,105,
+115,116,101,110,99,101,117,110,100,101,114,108,105,110,101,116,104,105,115,32,
+116,105,109,101,116,101,108,101,112,104,111,110,101,105,116,101,109,115,99,111,
+112,101,112,114,97,99,116,105,99,101,115,97,100,118,97,110,116,97,103,101,41,59,
+114,101,116,117,114,110,32,70,111,114,32,111,116,104,101,114,112,114,111,118,105
+,100,105,110,103,100,101,109,111,99,114,97,99,121,98,111,116,104,32,116,104,101,
+32,101,120,116,101,110,115,105,118,101,115,117,102,102,101,114,105,110,103,115,
+117,112,112,111,114,116,101,100,99,111,109,112,117,116,101,114,115,32,102,117,
+110,99,116,105,111,110,112,114,97,99,116,105,99,97,108,115,97,105,100,32,116,104
+,97,116,105,116,32,109,97,121,32,98,101,69,110,103,108,105,115,104,60,47,102,114
+,111,109,32,116,104,101,32,115,99,104,101,100,117,108,101,100,100,111,119,110,
+108,111,97,100,115,60,47,108,97,98,101,108,62,10,115,117,115,112,101,99,116,101,
+100,109,97,114,103,105,110,58,32,48,115,112,105,114,105,116,117,97,108,60,47,104
+,101,97,100,62,10,10,109,105,99,114,111,115,111,102,116,103,114,97,100,117,97,
+108,108,121,100,105,115,99,117,115,115,101,100,104,101,32,98,101,99,97,109,101,
+101,120,101,99,117,116,105,118,101,106,113,117,101,114,121,46,106,115,104,111,
+117,115,101,104,111,108,100,99,111,110,102,105,114,109,101,100,112,117,114,99,
+104,97,115,101,100,108,105,116,101,114,97,108,108,121,100,101,115,116,114,111,
+121,101,100,117,112,32,116,111,32,116,104,101,118,97,114,105,97,116,105,111,110,
+114,101,109,97,105,110,105,110,103,105,116,32,105,115,32,110,111,116,99,101,110,
+116,117,114,105,101,115,74,97,112,97,110,101,115,101,32,97,109,111,110,103,32,
+116,104,101,99,111,109,112,108,101,116,101,100,97,108,103,111,114,105,116,104,
+109,105,110,116,101,114,101,115,116,115,114,101,98,101,108,108,105,111,110,117,
+110,100,101,102,105,110,101,100,101,110,99,111,117,114,97,103,101,114,101,115,
+105,122,97,98,108,101,105,110,118,111,108,118,105,110,103,115,101,110,115,105,
+116,105,118,101,117,110,105,118,101,114,115,97,108,112,114,111,118,105,115,105,
+111,110,40,97,108,116,104,111,117,103,104,102,101,97,116,117,114,105,110,103,99,
+111,110,100,117,99,116,101,100,41,44,32,119,104,105,99,104,32,99,111,110,116,105
+,110,117,101,100,45,104,101,97,100,101,114,34,62,70,101,98,114,117,97,114,121,32
+,110,117,109,101,114,111,117,115,32,111,118,101,114,102,108,111,119,58,99,111,
+109,112,111,110,101,110,116,102,114,97,103,109,101,110,116,115,101,120,99,101,
+108,108,101,110,116,99,111,108,115,112,97,110,61,34,116,101,99,104,110,105,99,97
+,108,110,101,97,114,32,116,104,101,32,65,100,118,97,110,99,101,100,32,115,111,
+117,114,99,101,32,111,102,101,120,112,114,101,115,115,101,100,72,111,110,103,32,
+75,111,110,103,32,70,97,99,101,98,111,111,107,109,117,108,116,105,112,108,101,32
+,109,101,99,104,97,110,105,115,109,101,108,101,118,97,116,105,111,110,111,102,
+102,101,110,115,105,118,101,60,47,102,111,114,109,62,10,9,115,112,111,110,115,
+111,114,101,100,100,111,99,117,109,101,110,116,46,111,114,32,38,113,117,111,116,
+59,116,104,101,114,101,32,97,114,101,116,104,111,115,101,32,119,104,111,109,111,
+118,101,109,101,110,116,115,112,114,111,99,101,115,115,101,115,100,105,102,102,
+105,99,117,108,116,115,117,98,109,105,116,116,101,100,114,101,99,111,109,109,101
+,110,100,99,111,110,118,105,110,99,101,100,112,114,111,109,111,116,105,110,103,
+34,32,119,105,100,116,104,61,34,46,114,101,112,108,97,99,101,40,99,108,97,115,
+115,105,99,97,108,99,111,97,108,105,116,105,111,110,104,105,115,32,102,105,114,
+115,116,100,101,99,105,115,105,111,110,115,97,115,115,105,115,116,97,110,116,105
+,110,100,105,99,97,116,101,100,101,118,111,108,117,116,105,111,110,45,119,114,97
+,112,112,101,114,34,101,110,111,117,103,104,32,116,111,97,108,111,110,103,32,116
+,104,101,100,101,108,105,118,101,114,101,100,45,45,62,13,10,60,33,45,45,65,109,
+101,114,105,99,97,110,32,112,114,111,116,101,99,116,101,100,78,111,118,101,109,
+98,101,114,32,60,47,115,116,121,108,101,62,60,102,117,114,110,105,116,117,114,
+101,73,110,116,101,114,110,101,116,32,32,111,110,98,108,117,114,61,34,115,117,
+115,112,101,110,100,101,100,114,101,99,105,112,105,101,110,116,98,97,115,101,100
+,32,111,110,32,77,111,114,101,111,118,101,114,44,97,98,111,108,105,115,104,101,
+100,99,111,108,108,101,99,116,101,100,119,101,114,101,32,109,97,100,101,101,109,
+111,116,105,111,110,97,108,101,109,101,114,103,101,110,99,121,110,97,114,114,97,
+116,105,118,101,97,100,118,111,99,97,116,101,115,112,120,59,98,111,114,100,101,
+114,99,111,109,109,105,116,116,101,100,100,105,114,61,34,108,116,114,34,101,109,
+112,108,111,121,101,101,115,114,101,115,101,97,114,99,104,46,32,115,101,108,101,
+99,116,101,100,115,117,99,99,101,115,115,111,114,99,117,115,116,111,109,101,114,
+115,100,105,115,112,108,97,121,101,100,83,101,112,116,101,109,98,101,114,97,100,
+100,67,108,97,115,115,40,70,97,99,101,98,111,111,107,32,115,117,103,103,101,115,
+116,101,100,97,110,100,32,108,97,116,101,114,111,112,101,114,97,116,105,110,103,
+101,108,97,98,111,114,97,116,101,83,111,109,101,116,105,109,101,115,73,110,115,
+116,105,116,117,116,101,99,101,114,116,97,105,110,108,121,105,110,115,116,97,108
+,108,101,100,102,111,108,108,111,119,101,114,115,74,101,114,117,115,97,108,101,
+109,116,104,101,121,32,104,97,118,101,99,111,109,112,117,116,105,110,103,103,101
+,110,101,114,97,116,101,100,112,114,111,118,105,110,99,101,115,103,117,97,114,97
+,110,116,101,101,97,114,98,105,116,114,97,114,121,114,101,99,111,103,110,105,122
+,101,119,97,110,116,101,100,32,116,111,112,120,59,119,105,100,116,104,58,116,104
+,101,111,114,121,32,111,102,98,101,104,97,118,105,111,117,114,87,104,105,108,101
+,32,116,104,101,101,115,116,105,109,97,116,101,100,98,101,103,97,110,32,116,111,
+32,105,116,32,98,101,99,97,109,101,109,97,103,110,105,116,117,100,101,109,117,
+115,116,32,104,97,118,101,109,111,114,101,32,116,104,97,110,68,105,114,101,99,
+116,111,114,121,101,120,116,101,110,115,105,111,110,115,101,99,114,101,116,97,
+114,121,110,97,116,117,114,97,108,108,121,111,99,99,117,114,114,105,110,103,118,
+97,114,105,97,98,108,101,115,103,105,118,101,110,32,116,104,101,112,108,97,116,
+102,111,114,109,46,60,47,108,97,98,101,108,62,60,102,97,105,108,101,100,32,116,
+111,99,111,109,112,111,117,110,100,115,107,105,110,100,115,32,111,102,32,115,111
+,99,105,101,116,105,101,115,97,108,111,110,103,115,105,100,101,32,45,45,38,103,
+116,59,10,10,115,111,117,116,104,119,101,115,116,116,104,101,32,114,105,103,104,
+116,114,97,100,105,97,116,105,111,110,109,97,121,32,104,97,118,101,32,117,110,
+101,115,99,97,112,101,40,115,112,111,107,101,110,32,105,110,34,32,104,114,101,
+102,61,34,47,112,114,111,103,114,97,109,109,101,111,110,108,121,32,116,104,101,
+32,99,111,109,101,32,102,114,111,109,100,105,114,101,99,116,111,114,121,98,117,
+114,105,101,100,32,105,110,97,32,115,105,109,105,108,97,114,116,104,101,121,32,
+119,101,114,101,60,47,102,111,110,116,62,60,47,78,111,114,119,101,103,105,97,110
+,115,112,101,99,105,102,105,101,100,112,114,111,100,117,99,105,110,103,112,97,
+115,115,101,110,103,101,114,40,110,101,119,32,68,97,116,101,116,101,109,112,111,
+114,97,114,121,102,105,99,116,105,111,110,97,108,65,102,116,101,114,32,116,104,
+101,101,113,117,97,116,105,111,110,115,100,111,119,110,108,111,97,100,46,114,101
+,103,117,108,97,114,108,121,100,101,118,101,108,111,112,101,114,97,98,111,118,
+101,32,116,104,101,108,105,110,107,101,100,32,116,111,112,104,101,110,111,109,
+101,110,97,112,101,114,105,111,100,32,111,102,116,111,111,108,116,105,112,34,62,
+115,117,98,115,116,97,110,99,101,97,117,116,111,109,97,116,105,99,97,115,112,101
+,99,116,32,111,102,65,109,111,110,103,32,116,104,101,99,111,110,110,101,99,116,
+101,100,101,115,116,105,109,97,116,101,115,65,105,114,32,70,111,114,99,101,115,
+121,115,116,101,109,32,111,102,111,98,106,101,99,116,105,118,101,105,109,109,101
+,100,105,97,116,101,109,97,107,105,110,103,32,105,116,112,97,105,110,116,105,110
+,103,115,99,111,110,113,117,101,114,101,100,97,114,101,32,115,116,105,108,108,
+112,114,111,99,101,100,117,114,101,103,114,111,119,116,104,32,111,102,104,101,97
+,100,101,100,32,98,121,69,117,114,111,112,101,97,110,32,100,105,118,105,115,105,
+111,110,115,109,111,108,101,99,117,108,101,115,102,114,97,110,99,104,105,115,101
+,105,110,116,101,110,116,105,111,110,97,116,116,114,97,99,116,101,100,99,104,105
+,108,100,104,111,111,100,97,108,115,111,32,117,115,101,100,100,101,100,105,99,97
+,116,101,100,115,105,110,103,97,112,111,114,101,100,101,103,114,101,101,32,111,
+102,102,97,116,104,101,114,32,111,102,99,111,110,102,108,105,99,116,115,60,47,97
+,62,60,47,112,62,10,99,97,109,101,32,102,114,111,109,119,101,114,101,32,117,115,
+101,100,110,111,116,101,32,116,104,97,116,114,101,99,101,105,118,105,110,103,69,
+120,101,99,117,116,105,118,101,101,118,101,110,32,109,111,114,101,97,99,99,101,
+115,115,32,116,111,99,111,109,109,97,110,100,101,114,80,111,108,105,116,105,99,
+97,108,109,117,115,105,99,105,97,110,115,100,101,108,105,99,105,111,117,115,112,
+114,105,115,111,110,101,114,115,97,100,118,101,110,116,32,111,102,85,84,70,45,56
+,34,32,47,62,60,33,91,67,68,65,84,65,91,34,62,67,111,110,116,97,99,116,83,111,
+117,116,104,101,114,110,32,98,103,99,111,108,111,114,61,34,115,101,114,105,101,
+115,32,111,102,46,32,73,116,32,119,97,115,32,105,110,32,69,117,114,111,112,101,
+112,101,114,109,105,116,116,101,100,118,97,108,105,100,97,116,101,46,97,112,112,
+101,97,114,105,110,103,111,102,102,105,99,105,97,108,115,115,101,114,105,111,117
+,115,108,121,45,108,97,110,103,117,97,103,101,105,110,105,116,105,97,116,101,100
+,101,120,116,101,110,100,105,110,103,108,111,110,103,45,116,101,114,109,105,110,
+102,108,97,116,105,111,110,115,117,99,104,32,116,104,97,116,103,101,116,67,111,
+111,107,105,101,109,97,114,107,101,100,32,98,121,60,47,98,117,116,116,111,110,62
+,105,109,112,108,101,109,101,110,116,98,117,116,32,105,116,32,105,115,105,110,99
+,114,101,97,115,101,115,100,111,119,110,32,116,104,101,32,114,101,113,117,105,
+114,105,110,103,100,101,112,101,110,100,101,110,116,45,45,62,10,60,33,45,45,32,
+105,110,116,101,114,118,105,101,119,87,105,116,104,32,116,104,101,32,99,111,112,
+105,101,115,32,111,102,99,111,110,115,101,110,115,117,115,119,97,115,32,98,117,
+105,108,116,86,101,110,101,122,117,101,108,97,40,102,111,114,109,101,114,108,121
+,116,104,101,32,115,116,97,116,101,112,101,114,115,111,110,110,101,108,115,116,
+114,97,116,101,103,105,99,102,97,118,111,117,114,32,111,102,105,110,118,101,110,
+116,105,111,110,87,105,107,105,112,101,100,105,97,99,111,110,116,105,110,101,110
+,116,118,105,114,116,117,97,108,108,121,119,104,105,99,104,32,119,97,115,112,114
+,105,110,99,105,112,108,101,67,111,109,112,108,101,116,101,32,105,100,101,110,
+116,105,99,97,108,115,104,111,119,32,116,104,97,116,112,114,105,109,105,116,105,
+118,101,97,119,97,121,32,102,114,111,109,109,111,108,101,99,117,108,97,114,112,
+114,101,99,105,115,101,108,121,100,105,115,115,111,108,118,101,100,85,110,100,
+101,114,32,116,104,101,118,101,114,115,105,111,110,61,34,62,38,110,98,115,112,59
+,60,47,73,116,32,105,115,32,116,104,101,32,84,104,105,115,32,105,115,32,119,105,
+108,108,32,104,97,118,101,111,114,103,97,110,105,115,109,115,115,111,109,101,32,
+116,105,109,101,70,114,105,101,100,114,105,99,104,119,97,115,32,102,105,114,115,
+116,116,104,101,32,111,110,108,121,32,102,97,99,116,32,116,104,97,116,102,111,
+114,109,32,105,100,61,34,112,114,101,99,101,100,105,110,103,84,101,99,104,110,
+105,99,97,108,112,104,121,115,105,99,105,115,116,111,99,99,117,114,115,32,105,
+110,110,97,118,105,103,97,116,111,114,115,101,99,116,105,111,110,34,62,115,112,
+97,110,32,105,100,61,34,115,111,117,103,104,116,32,116,111,98,101,108,111,119,32
+,116,104,101,115,117,114,118,105,118,105,110,103,125,60,47,115,116,121,108,101,
+62,104,105,115,32,100,101,97,116,104,97,115,32,105,110,32,116,104,101,99,97,117,
+115,101,100,32,98,121,112,97,114,116,105,97,108,108,121,101,120,105,115,116,105,
+110,103,32,117,115,105,110,103,32,116,104,101,119,97,115,32,103,105,118,101,110,
+97,32,108,105,115,116,32,111,102,108,101,118,101,108,115,32,111,102,110,111,116,
+105,111,110,32,111,102,79,102,102,105,99,105,97,108,32,100,105,115,109,105,115,
+115,101,100,115,99,105,101,110,116,105,115,116,114,101,115,101,109,98,108,101,
+115,100,117,112,108,105,99,97,116,101,101,120,112,108,111,115,105,118,101,114,
+101,99,111,118,101,114,101,100,97,108,108,32,111,116,104,101,114,103,97,108,108,
+101,114,105,101,115,123,112,97,100,100,105,110,103,58,112,101,111,112,108,101,32
+,111,102,114,101,103,105,111,110,32,111,102,97,100,100,114,101,115,115,101,115,
+97,115,115,111,99,105,97,116,101,105,109,103,32,97,108,116,61,34,105,110,32,109,
+111,100,101,114,110,115,104,111,117,108,100,32,98,101,109,101,116,104,111,100,32
+,111,102,114,101,112,111,114,116,105,110,103,116,105,109,101,115,116,97,109,112,
+110,101,101,100,101,100,32,116,111,116,104,101,32,71,114,101,97,116,114,101,103,
+97,114,100,105,110,103,115,101,101,109,101,100,32,116,111,118,105,101,119,101,
+100,32,97,115,105,109,112,97,99,116,32,111,110,105,100,101,97,32,116,104,97,116,
+116,104,101,32,87,111,114,108,100,104,101,105,103,104,116,32,111,102,101,120,112
+,97,110,100,105,110,103,84,104,101,115,101,32,97,114,101,99,117,114,114,101,110,
+116,34,62,99,97,114,101,102,117,108,108,121,109,97,105,110,116,97,105,110,115,99
+,104,97,114,103,101,32,111,102,67,108,97,115,115,105,99,97,108,97,100,100,114,
+101,115,115,101,100,112,114,101,100,105,99,116,101,100,111,119,110,101,114,115,
+104,105,112,60,100,105,118,32,105,100,61,34,114,105,103,104,116,34,62,13,10,114,
+101,115,105,100,101,110,99,101,108,101,97,118,101,32,116,104,101,99,111,110,116,
+101,110,116,34,62,97,114,101,32,111,102,116,101,110,32,32,125,41,40,41,59,13,10,
+112,114,111,98,97,98,108,121,32,80,114,111,102,101,115,115,111,114,45,98,117,116
+,116,111,110,34,32,114,101,115,112,111,110,100,101,100,115,97,121,115,32,116,104
+,97,116,104,97,100,32,116,111,32,98,101,112,108,97,99,101,100,32,105,110,72,117,
+110,103,97,114,105,97,110,115,116,97,116,117,115,32,111,102,115,101,114,118,101,
+115,32,97,115,85,110,105,118,101,114,115,97,108,101,120,101,99,117,116,105,111,
+110,97,103,103,114,101,103,97,116,101,102,111,114,32,119,104,105,99,104,105,110,
+102,101,99,116,105,111,110,97,103,114,101,101,100,32,116,111,104,111,119,101,118
+,101,114,44,32,112,111,112,117,108,97,114,34,62,112,108,97,99,101,100,32,111,110
+,99,111,110,115,116,114,117,99,116,101,108,101,99,116,111,114,97,108,115,121,109
+,98,111,108,32,111,102,105,110,99,108,117,100,105,110,103,114,101,116,117,114,
+110,32,116,111,97,114,99,104,105,116,101,99,116,67,104,114,105,115,116,105,97,
+110,112,114,101,118,105,111,117,115,32,108,105,118,105,110,103,32,105,110,101,97
+,115,105,101,114,32,116,111,112,114,111,102,101,115,115,111,114,10,38,108,116,59
+,33,45,45,32,101,102,102,101,99,116,32,111,102,97,110,97,108,121,116,105,99,115,
+119,97,115,32,116,97,107,101,110,119,104,101,114,101,32,116,104,101,116,111,111,
+107,32,111,118,101,114,98,101,108,105,101,102,32,105,110,65,102,114,105,107,97,
+97,110,115,97,115,32,102,97,114,32,97,115,112,114,101,118,101,110,116,101,100,
+119,111,114,107,32,119,105,116,104,97,32,115,112,101,99,105,97,108,60,102,105,
+101,108,100,115,101,116,67,104,114,105,115,116,109,97,115,82,101,116,114,105,101
+,118,101,100,10,10,73,110,32,116,104,101,32,98,97,99,107,32,105,110,116,111,110,
+111,114,116,104,101,97,115,116,109,97,103,97,122,105,110,101,115,62,60,115,116,
+114,111,110,103,62,99,111,109,109,105,116,116,101,101,103,111,118,101,114,110,
+105,110,103,103,114,111,117,112,115,32,111,102,115,116,111,114,101,100,32,105,
+110,101,115,116,97,98,108,105,115,104,97,32,103,101,110,101,114,97,108,105,116,
+115,32,102,105,114,115,116,116,104,101,105,114,32,111,119,110,112,111,112,117,
+108,97,116,101,100,97,110,32,111,98,106,101,99,116,67,97,114,105,98,98,101,97,
+110,97,108,108,111,119,32,116,104,101,100,105,115,116,114,105,99,116,115,119,105
+,115,99,111,110,115,105,110,108,111,99,97,116,105,111,110,46,59,32,119,105,100,
+116,104,58,32,105,110,104,97,98,105,116,101,100,83,111,99,105,97,108,105,115,116
+,74,97,110,117,97,114,121,32,49,60,47,102,111,111,116,101,114,62,115,105,109,105
+,108,97,114,108,121,99,104,111,105,99,101,32,111,102,116,104,101,32,115,97,109,
+101,32,115,112,101,99,105,102,105,99,32,98,117,115,105,110,101,115,115,32,84,104
+,101,32,102,105,114,115,116,46,108,101,110,103,116,104,59,32,100,101,115,105,114
+,101,32,116,111,100,101,97,108,32,119,105,116,104,115,105,110,99,101,32,116,104,
+101,117,115,101,114,65,103,101,110,116,99,111,110,99,101,105,118,101,100,105,110
+,100,101,120,46,112,104,112,97,115,32,38,113,117,111,116,59,101,110,103,97,103,
+101,32,105,110,114,101,99,101,110,116,108,121,44,102,101,119,32,121,101,97,114,
+115,119,101,114,101,32,97,108,115,111,10,60,104,101,97,100,62,10,60,101,100,105,
+116,101,100,32,98,121,97,114,101,32,107,110,111,119,110,99,105,116,105,101,115,
+32,105,110,97,99,99,101,115,115,107,101,121,99,111,110,100,101,109,110,101,100,
+97,108,115,111,32,104,97,118,101,115,101,114,118,105,99,101,115,44,102,97,109,
+105,108,121,32,111,102,83,99,104,111,111,108,32,111,102,99,111,110,118,101,114,
+116,101,100,110,97,116,117,114,101,32,111,102,32,108,97,110,103,117,97,103,101,
+109,105,110,105,115,116,101,114,115,60,47,111,98,106,101,99,116,62,116,104,101,
+114,101,32,105,115,32,97,32,112,111,112,117,108,97,114,115,101,113,117,101,110,
+99,101,115,97,100,118,111,99,97,116,101,100,84,104,101,121,32,119,101,114,101,97
+,110,121,32,111,116,104,101,114,108,111,99,97,116,105,111,110,61,101,110,116,101
+,114,32,116,104,101,109,117,99,104,32,109,111,114,101,114,101,102,108,101,99,116
+,101,100,119,97,115,32,110,97,109,101,100,111,114,105,103,105,110,97,108,32,97,
+32,116,121,112,105,99,97,108,119,104,101,110,32,116,104,101,121,101,110,103,105,
+110,101,101,114,115,99,111,117,108,100,32,110,111,116,114,101,115,105,100,101,
+110,116,115,119,101,100,110,101,115,100,97,121,116,104,101,32,116,104,105,114,
+100,32,112,114,111,100,117,99,116,115,74,97,110,117,97,114,121,32,50,119,104,97,
+116,32,116,104,101,121,97,32,99,101,114,116,97,105,110,114,101,97,99,116,105,111
+,110,115,112,114,111,99,101,115,115,111,114,97,102,116,101,114,32,104,105,115,
+116,104,101,32,108,97,115,116,32,99,111,110,116,97,105,110,101,100,34,62,60,47,
+100,105,118,62,10,60,47,97,62,60,47,116,100,62,100,101,112,101,110,100,32,111,
+110,115,101,97,114,99,104,34,62,10,112,105,101,99,101,115,32,111,102,99,111,109,
+112,101,116,105,110,103,82,101,102,101,114,101,110,99,101,116,101,110,110,101,
+115,115,101,101,119,104,105,99,104,32,104,97,115,32,118,101,114,115,105,111,110,
+61,60,47,115,112,97,110,62,32,60,60,47,104,101,97,100,101,114,62,103,105,118,101
+,115,32,116,104,101,104,105,115,116,111,114,105,97,110,118,97,108,117,101,61,34,
+34,62,112,97,100,100,105,110,103,58,48,118,105,101,119,32,116,104,97,116,116,111
+,103,101,116,104,101,114,44,116,104,101,32,109,111,115,116,32,119,97,115,32,102,
+111,117,110,100,115,117,98,115,101,116,32,111,102,97,116,116,97,99,107,32,111,
+110,99,104,105,108,100,114,101,110,44,112,111,105,110,116,115,32,111,102,112,101
+,114,115,111,110,97,108,32,112,111,115,105,116,105,111,110,58,97,108,108,101,103
+,101,100,108,121,67,108,101,118,101,108,97,110,100,119,97,115,32,108,97,116,101,
+114,97,110,100,32,97,102,116,101,114,97,114,101,32,103,105,118,101,110,119,97,
+115,32,115,116,105,108,108,115,99,114,111,108,108,105,110,103,100,101,115,105,
+103,110,32,111,102,109,97,107,101,115,32,116,104,101,109,117,99,104,32,108,101,
+115,115,65,109,101,114,105,99,97,110,115,46,10,10,65,102,116,101,114,32,44,32,98
+,117,116,32,116,104,101,77,117,115,101,117,109,32,111,102,108,111,117,105,115,
+105,97,110,97,40,102,114,111,109,32,116,104,101,109,105,110,110,101,115,111,116,
+97,112,97,114,116,105,99,108,101,115,97,32,112,114,111,99,101,115,115,68,111,109
+,105,110,105,99,97,110,118,111,108,117,109,101,32,111,102,114,101,116,117,114,
+110,105,110,103,100,101,102,101,110,115,105,118,101,48,48,112,120,124,114,105,
+103,104,109,97,100,101,32,102,114,111,109,109,111,117,115,101,111,118,101,114,34
+,32,115,116,121,108,101,61,34,115,116,97,116,101,115,32,111,102,40,119,104,105,
+99,104,32,105,115,99,111,110,116,105,110,117,101,115,70,114,97,110,99,105,115,99
+,111,98,117,105,108,100,105,110,103,32,119,105,116,104,111,117,116,32,97,119,105
+,116,104,32,115,111,109,101,119,104,111,32,119,111,117,108,100,97,32,102,111,114
+,109,32,111,102,97,32,112,97,114,116,32,111,102,98,101,102,111,114,101,32,105,
+116,107,110,111,119,110,32,97,115,32,32,83,101,114,118,105,99,101,115,108,111,99
+,97,116,105,111,110,32,97,110,100,32,111,102,116,101,110,109,101,97,115,117,114,
+105,110,103,97,110,100,32,105,116,32,105,115,112,97,112,101,114,98,97,99,107,118
+,97,108,117,101,115,32,111,102,13,10,60,116,105,116,108,101,62,61,32,119,105,110
+,100,111,119,46,100,101,116,101,114,109,105,110,101,101,114,38,113,117,111,116,
+59,32,112,108,97,121,101,100,32,98,121,97,110,100,32,101,97,114,108,121,60,47,99
+,101,110,116,101,114,62,102,114,111,109,32,116,104,105,115,116,104,101,32,116,
+104,114,101,101,112,111,119,101,114,32,97,110,100,111,102,32,38,113,117,111,116,
+59,105,110,110,101,114,72,84,77,76,60,97,32,104,114,101,102,61,34,121,58,105,110
+,108,105,110,101,59,67,104,117,114,99,104,32,111,102,116,104,101,32,101,118,101,
+110,116,118,101,114,121,32,104,105,103,104,111,102,102,105,99,105,97,108,32,45,
+104,101,105,103,104,116,58,32,99,111,110,116,101,110,116,61,34,47,99,103,105,45,
+98,105,110,47,116,111,32,99,114,101,97,116,101,97,102,114,105,107,97,97,110,115,
+101,115,112,101,114,97,110,116,111,102,114,97,110,195,167,97,105,115,108,97,116,
+118,105,101,197,161,117,108,105,101,116,117,118,105,197,179,196,140,101,197,161,
+116,105,110,97,196,141,101,197,161,116,105,110,97,224,185,132,224,184,151,224,
+184,162,230,151,165,230,156,172,232,170,158,231,174,128,228,189,147,229,173,151,
+231,185,129,233,171,148,229,173,151,237,149,156,234,181,173,236,150,180,228,184,
+186,228,187,128,228,185,136,232,174,161,231,174,151,230,156,186,231,172,148,232,
+174,176,230,156,172,232,168,142,232,171,150,229,141,128,230,156,141,229,138,161,
+229,153,168,228,186,146,232,129,148,231,189,145,230,136,191,229,156,176,228,186,
+167,228,191,177,228,185,144,233,131,168,229,135,186,231,137,136,231,164,190,230,
+142,146,232,161,140,230,166,156,233,131,168,232,144,189,230,160,188,232,191,155,
+228,184,128,230,173,165,230,148,175,228,187,152,229,174,157,233,170,140,232,175,
+129,231,160,129,229,167,148,229,145,152,228,188,154,230,149,176,230,141,174,229,
+186,147,230,182,136,232,180,185,232,128,133,229,138,158,229,133,172,229,174,164,
+232,174,168,232,174,186,229,140,186,230,183,177,229,156,179,229,184,130,230,146,
+173,230,148,190,229,153,168,229,140,151,228,186,172,229,184,130,229,164,167,229,
+173,166,231,148,159,232,182,138,230,157,165,232,182,138,231,174,161,231,144,134,
+229,145,152,228,191,161,230,129,175,231,189,145,115,101,114,118,105,99,105,111,
+115,97,114,116,195,173,99,117,108,111,97,114,103,101,110,116,105,110,97,98,97,
+114,99,101,108,111,110,97,99,117,97,108,113,117,105,101,114,112,117,98,108,105,
+99,97,100,111,112,114,111,100,117,99,116,111,115,112,111,108,195,173,116,105,99,
+97,114,101,115,112,117,101,115,116,97,119,105,107,105,112,101,100,105,97,115,105
+,103,117,105,101,110,116,101,98,195,186,115,113,117,101,100,97,99,111,109,117,
+110,105,100,97,100,115,101,103,117,114,105,100,97,100,112,114,105,110,99,105,112
+,97,108,112,114,101,103,117,110,116,97,115,99,111,110,116,101,110,105,100,111,
+114,101,115,112,111,110,100,101,114,118,101,110,101,122,117,101,108,97,112,114,
+111,98,108,101,109,97,115,100,105,99,105,101,109,98,114,101,114,101,108,97,99,
+105,195,179,110,110,111,118,105,101,109,98,114,101,115,105,109,105,108,97,114,
+101,115,112,114,111,121,101,99,116,111,115,112,114,111,103,114,97,109,97,115,105
+,110,115,116,105,116,117,116,111,97,99,116,105,118,105,100,97,100,101,110,99,117
+,101,110,116,114,97,101,99,111,110,111,109,195,173,97,105,109,195,161,103,101,
+110,101,115,99,111,110,116,97,99,116,97,114,100,101,115,99,97,114,103,97,114,110
+,101,99,101,115,97,114,105,111,97,116,101,110,99,105,195,179,110,116,101,108,195
+,169,102,111,110,111,99,111,109,105,115,105,195,179,110,99,97,110,99,105,111,110
+,101,115,99,97,112,97,99,105,100,97,100,101,110,99,111,110,116,114,97,114,97,110
+,195,161,108,105,115,105,115,102,97,118,111,114,105,116,111,115,116,195,169,114,
+109,105,110,111,115,112,114,111,118,105,110,99,105,97,101,116,105,113,117,101,
+116,97,115,101,108,101,109,101,110,116,111,115,102,117,110,99,105,111,110,101,
+115,114,101,115,117,108,116,97,100,111,99,97,114,195,161,99,116,101,114,112,114,
+111,112,105,101,100,97,100,112,114,105,110,99,105,112,105,111,110,101,99,101,115
+,105,100,97,100,109,117,110,105,99,105,112,97,108,99,114,101,97,99,105,195,179,
+110,100,101,115,99,97,114,103,97,115,112,114,101,115,101,110,99,105,97,99,111,
+109,101,114,99,105,97,108,111,112,105,110,105,111,110,101,115,101,106,101,114,99
+,105,99,105,111,101,100,105,116,111,114,105,97,108,115,97,108,97,109,97,110,99,
+97,103,111,110,122,195,161,108,101,122,100,111,99,117,109,101,110,116,111,112,
+101,108,195,173,99,117,108,97,114,101,99,105,101,110,116,101,115,103,101,110,101
+,114,97,108,101,115,116,97,114,114,97,103,111,110,97,112,114,195,161,99,116,105,
+99,97,110,111,118,101,100,97,100,101,115,112,114,111,112,117,101,115,116,97,112,
+97,99,105,101,110,116,101,115,116,195,169,99,110,105,99,97,115,111,98,106,101,
+116,105,118,111,115,99,111,110,116,97,99,116,111,115,224,164,174,224,165,135,224
+,164,130,224,164,178,224,164,191,224,164,143,224,164,185,224,165,136,224,164,130
+,224,164,151,224,164,175,224,164,190,224,164,184,224,164,190,224,164,165,224,164
+,143,224,164,181,224,164,130,224,164,176,224,164,185,224,165,135,224,164,149,224
+,165,139,224,164,136,224,164,149,224,165,129,224,164,155,224,164,176,224,164,185
+,224,164,190,224,164,172,224,164,190,224,164,166,224,164,149,224,164,185,224,164
+,190,224,164,184,224,164,173,224,165,128,224,164,185,224,165,129,224,164,143,224
+,164,176,224,164,185,224,165,128,224,164,174,224,165,136,224,164,130,224,164,166
+,224,164,191,224,164,168,224,164,172,224,164,190,224,164,164,100,105,112,108,111
+,100,111,99,115,224,164,184,224,164,174,224,164,175,224,164,176,224,165,130,224,
+164,170,224,164,168,224,164,190,224,164,174,224,164,170,224,164,164,224,164,190,
+224,164,171,224,164,191,224,164,176,224,164,148,224,164,184,224,164,164,224,164,
+164,224,164,176,224,164,185,224,164,178,224,165,139,224,164,151,224,164,185,224,
+165,129,224,164,134,224,164,172,224,164,190,224,164,176,224,164,166,224,165,135,
+224,164,182,224,164,185,224,165,129,224,164,136,224,164,150,224,165,135,224,164,
+178,224,164,175,224,164,166,224,164,191,224,164,149,224,164,190,224,164,174,224,
+164,181,224,165,135,224,164,172,224,164,164,224,165,128,224,164,168,224,164,172,
+224,165,128,224,164,154,224,164,174,224,165,140,224,164,164,224,164,184,224,164,
+190,224,164,178,224,164,178,224,165,135,224,164,150,224,164,156,224,165,137,224,
+164,172,224,164,174,224,164,166,224,164,166,224,164,164,224,164,165,224,164,190,
+224,164,168,224,164,185,224,165,128,224,164,182,224,164,185,224,164,176,224,164,
+133,224,164,178,224,164,151,224,164,149,224,164,173,224,165,128,224,164,168,224,
+164,151,224,164,176,224,164,170,224,164,190,224,164,184,224,164,176,224,164,190,
+224,164,164,224,164,149,224,164,191,224,164,143,224,164,137,224,164,184,224,165,
+135,224,164,151,224,164,175,224,165,128,224,164,185,224,165,130,224,164,129,224,
+164,134,224,164,151,224,165,135,224,164,159,224,165,128,224,164,174,224,164,150,
+224,165,139,224,164,156,224,164,149,224,164,190,224,164,176,224,164,133,224,164,
+173,224,165,128,224,164,151,224,164,175,224,165,135,224,164,164,224,165,129,224,
+164,174,224,164,181,224,165,139,224,164,159,224,164,166,224,165,135,224,164,130,
+224,164,133,224,164,151,224,164,176,224,164,144,224,164,184,224,165,135,224,164,
+174,224,165,135,224,164,178,224,164,178,224,164,151,224,164,190,224,164,185,224,
+164,190,224,164,178,224,164,138,224,164,170,224,164,176,224,164,154,224,164,190,
+224,164,176,224,164,144,224,164,184,224,164,190,224,164,166,224,165,135,224,164,
+176,224,164,156,224,164,191,224,164,184,224,164,166,224,164,191,224,164,178,224,
+164,172,224,164,130,224,164,166,224,164,172,224,164,168,224,164,190,224,164,185,
+224,165,130,224,164,130,224,164,178,224,164,190,224,164,150,224,164,156,224,165,
+128,224,164,164,224,164,172,224,164,159,224,164,168,224,164,174,224,164,191,224,
+164,178,224,164,135,224,164,184,224,165,135,224,164,134,224,164,168,224,165,135,
+224,164,168,224,164,175,224,164,190,224,164,149,224,165,129,224,164,178,224,164,
+178,224,165,137,224,164,151,224,164,173,224,164,190,224,164,151,224,164,176,224,
+165,135,224,164,178,224,164,156,224,164,151,224,164,185,224,164,176,224,164,190,
+224,164,174,224,164,178,224,164,151,224,165,135,224,164,170,224,165,135,224,164,
+156,224,164,185,224,164,190,224,164,165,224,164,135,224,164,184,224,165,128,224,
+164,184,224,164,185,224,165,128,224,164,149,224,164,178,224,164,190,224,164,160,
+224,165,128,224,164,149,224,164,185,224,164,190,224,164,129,224,164,166,224,165,
+130,224,164,176,224,164,164,224,164,185,224,164,164,224,164,184,224,164,190,224,
+164,164,224,164,175,224,164,190,224,164,166,224,164,134,224,164,175,224,164,190,
+224,164,170,224,164,190,224,164,149,224,164,149,224,165,140,224,164,168,224,164,
+182,224,164,190,224,164,174,224,164,166,224,165,135,224,164,150,224,164,175,224,
+164,185,224,165,128,224,164,176,224,164,190,224,164,175,224,164,150,224,165,129,
+224,164,166,224,164,178,224,164,151,224,165,128,99,97,116,101,103,111,114,105,
+101,115,101,120,112,101,114,105,101,110,99,101,60,47,116,105,116,108,101,62,13,
+10,67,111,112,121,114,105,103,104,116,32,106,97,118,97,115,99,114,105,112,116,99
+,111,110,100,105,116,105,111,110,115,101,118,101,114,121,116,104,105,110,103,60,
+112,32,99,108,97,115,115,61,34,116,101,99,104,110,111,108,111,103,121,98,97,99,
+107,103,114,111,117,110,100,60,97,32,99,108,97,115,115,61,34,109,97,110,97,103,
+101,109,101,110,116,38,99,111,112,121,59,32,50,48,49,106,97,118,97,83,99,114,105
+,112,116,99,104,97,114,97,99,116,101,114,115,98,114,101,97,100,99,114,117,109,98
+,116,104,101,109,115,101,108,118,101,115,104,111,114,105,122,111,110,116,97,108,
+103,111,118,101,114,110,109,101,110,116,67,97,108,105,102,111,114,110,105,97,97,
+99,116,105,118,105,116,105,101,115,100,105,115,99,111,118,101,114,101,100,78,97,
+118,105,103,97,116,105,111,110,116,114,97,110,115,105,116,105,111,110,99,111,110
+,110,101,99,116,105,111,110,110,97,118,105,103,97,116,105,111,110,97,112,112,101
+,97,114,97,110,99,101,60,47,116,105,116,108,101,62,60,109,99,104,101,99,107,98,
+111,120,34,32,116,101,99,104,110,105,113,117,101,115,112,114,111,116,101,99,116,
+105,111,110,97,112,112,97,114,101,110,116,108,121,97,115,32,119,101,108,108,32,
+97,115,117,110,116,39,44,32,39,85,65,45,114,101,115,111,108,117,116,105,111,110,
+111,112,101,114,97,116,105,111,110,115,116,101,108,101,118,105,115,105,111,110,
+116,114,97,110,115,108,97,116,101,100,87,97,115,104,105,110,103,116,111,110,110,
+97,118,105,103,97,116,111,114,46,32,61,32,119,105,110,100,111,119,46,105,109,112
+,114,101,115,115,105,111,110,38,108,116,59,98,114,38,103,116,59,108,105,116,101,
+114,97,116,117,114,101,112,111,112,117,108,97,116,105,111,110,98,103,99,111,108,
+111,114,61,34,35,101,115,112,101,99,105,97,108,108,121,32,99,111,110,116,101,110
+,116,61,34,112,114,111,100,117,99,116,105,111,110,110,101,119,115,108,101,116,
+116,101,114,112,114,111,112,101,114,116,105,101,115,100,101,102,105,110,105,116,
+105,111,110,108,101,97,100,101,114,115,104,105,112,84,101,99,104,110,111,108,111
+,103,121,80,97,114,108,105,97,109,101,110,116,99,111,109,112,97,114,105,115,111,
+110,117,108,32,99,108,97,115,115,61,34,46,105,110,100,101,120,79,102,40,34,99,
+111,110,99,108,117,115,105,111,110,100,105,115,99,117,115,115,105,111,110,99,111
+,109,112,111,110,101,110,116,115,98,105,111,108,111,103,105,99,97,108,82,101,118
+,111,108,117,116,105,111,110,95,99,111,110,116,97,105,110,101,114,117,110,100,
+101,114,115,116,111,111,100,110,111,115,99,114,105,112,116,62,60,112,101,114,109
+,105,115,115,105,111,110,101,97,99,104,32,111,116,104,101,114,97,116,109,111,115
+,112,104,101,114,101,32,111,110,102,111,99,117,115,61,34,60,102,111,114,109,32,
+105,100,61,34,112,114,111,99,101,115,115,105,110,103,116,104,105,115,46,118,97,
+108,117,101,103,101,110,101,114,97,116,105,111,110,67,111,110,102,101,114,101,
+110,99,101,115,117,98,115,101,113,117,101,110,116,119,101,108,108,45,107,110,111
+,119,110,118,97,114,105,97,116,105,111,110,115,114,101,112,117,116,97,116,105,
+111,110,112,104,101,110,111,109,101,110,111,110,100,105,115,99,105,112,108,105,
+110,101,108,111,103,111,46,112,110,103,34,32,40,100,111,99,117,109,101,110,116,
+44,98,111,117,110,100,97,114,105,101,115,101,120,112,114,101,115,115,105,111,110
+,115,101,116,116,108,101,109,101,110,116,66,97,99,107,103,114,111,117,110,100,
+111,117,116,32,111,102,32,116,104,101,101,110,116,101,114,112,114,105,115,101,40
+,34,104,116,116,112,115,58,34,32,117,110,101,115,99,97,112,101,40,34,112,97,115,
+115,119,111,114,100,34,32,100,101,109,111,99,114,97,116,105,99,60,97,32,104,114,
+101,102,61,34,47,119,114,97,112,112,101,114,34,62,10,109,101,109,98,101,114,115,
+104,105,112,108,105,110,103,117,105,115,116,105,99,112,120,59,112,97,100,100,105
+,110,103,112,104,105,108,111,115,111,112,104,121,97,115,115,105,115,116,97,110,
+99,101,117,110,105,118,101,114,115,105,116,121,102,97,99,105,108,105,116,105,101
+,115,114,101,99,111,103,110,105,122,101,100,112,114,101,102,101,114,101,110,99,
+101,105,102,32,40,116,121,112,101,111,102,109,97,105,110,116,97,105,110,101,100,
+118,111,99,97,98,117,108,97,114,121,104,121,112,111,116,104,101,115,105,115,46,
+115,117,98,109,105,116,40,41,59,38,97,109,112,59,110,98,115,112,59,97,110,110,
+111,116,97,116,105,111,110,98,101,104,105,110,100,32,116,104,101,70,111,117,110,
+100,97,116,105,111,110,112,117,98,108,105,115,104,101,114,34,97,115,115,117,109,
+112,116,105,111,110,105,110,116,114,111,100,117,99,101,100,99,111,114,114,117,
+112,116,105,111,110,115,99,105,101,110,116,105,115,116,115,101,120,112,108,105,
+99,105,116,108,121,105,110,115,116,101,97,100,32,111,102,100,105,109,101,110,115
+,105,111,110,115,32,111,110,67,108,105,99,107,61,34,99,111,110,115,105,100,101,
+114,101,100,100,101,112,97,114,116,109,101,110,116,111,99,99,117,112,97,116,105,
+111,110,115,111,111,110,32,97,102,116,101,114,105,110,118,101,115,116,109,101,
+110,116,112,114,111,110,111,117,110,99,101,100,105,100,101,110,116,105,102,105,
+101,100,101,120,112,101,114,105,109,101,110,116,77,97,110,97,103,101,109,101,110
+,116,103,101,111,103,114,97,112,104,105,99,34,32,104,101,105,103,104,116,61,34,
+108,105,110,107,32,114,101,108,61,34,46,114,101,112,108,97,99,101,40,47,100,101,
+112,114,101,115,115,105,111,110,99,111,110,102,101,114,101,110,99,101,112,117,
+110,105,115,104,109,101,110,116,101,108,105,109,105,110,97,116,101,100,114,101,
+115,105,115,116,97,110,99,101,97,100,97,112,116,97,116,105,111,110,111,112,112,
+111,115,105,116,105,111,110,119,101,108,108,32,107,110,111,119,110,115,117,112,
+112,108,101,109,101,110,116,100,101,116,101,114,109,105,110,101,100,104,49,32,99
+,108,97,115,115,61,34,48,112,120,59,109,97,114,103,105,110,109,101,99,104,97,110
+,105,99,97,108,115,116,97,116,105,115,116,105,99,115,99,101,108,101,98,114,97,
+116,101,100,71,111,118,101,114,110,109,101,110,116,10,10,68,117,114,105,110,103,
+32,116,100,101,118,101,108,111,112,101,114,115,97,114,116,105,102,105,99,105,97,
+108,101,113,117,105,118,97,108,101,110,116,111,114,105,103,105,110,97,116,101,
+100,67,111,109,109,105,115,115,105,111,110,97,116,116,97,99,104,109,101,110,116,
+60,115,112,97,110,32,105,100,61,34,116,104,101,114,101,32,119,101,114,101,78,101
+,100,101,114,108,97,110,100,115,98,101,121,111,110,100,32,116,104,101,114,101,
+103,105,115,116,101,114,101,100,106,111,117,114,110,97,108,105,115,116,102,114,
+101,113,117,101,110,116,108,121,97,108,108,32,111,102,32,116,104,101,108,97,110,
+103,61,34,101,110,34,32,60,47,115,116,121,108,101,62,13,10,97,98,115,111,108,117
+,116,101,59,32,115,117,112,112,111,114,116,105,110,103,101,120,116,114,101,109,
+101,108,121,32,109,97,105,110,115,116,114,101,97,109,60,47,115,116,114,111,110,
+103,62,32,112,111,112,117,108,97,114,105,116,121,101,109,112,108,111,121,109,101
+,110,116,60,47,116,97,98,108,101,62,13,10,32,99,111,108,115,112,97,110,61,34,60,
+47,102,111,114,109,62,10,32,32,99,111,110,118,101,114,115,105,111,110,97,98,111,
+117,116,32,116,104,101,32,60,47,112,62,60,47,100,105,118,62,105,110,116,101,103,
+114,97,116,101,100,34,32,108,97,110,103,61,34,101,110,80,111,114,116,117,103,117
+,101,115,101,115,117,98,115,116,105,116,117,116,101,105,110,100,105,118,105,100,
+117,97,108,105,109,112,111,115,115,105,98,108,101,109,117,108,116,105,109,101,
+100,105,97,97,108,109,111,115,116,32,97,108,108,112,120,32,115,111,108,105,100,
+32,35,97,112,97,114,116,32,102,114,111,109,115,117,98,106,101,99,116,32,116,111,
+105,110,32,69,110,103,108,105,115,104,99,114,105,116,105,99,105,122,101,100,101,
+120,99,101,112,116,32,102,111,114,103,117,105,100,101,108,105,110,101,115,111,
+114,105,103,105,110,97,108,108,121,114,101,109,97,114,107,97,98,108,101,116,104,
+101,32,115,101,99,111,110,100,104,50,32,99,108,97,115,115,61,34,60,97,32,116,105
+,116,108,101,61,34,40,105,110,99,108,117,100,105,110,103,112,97,114,97,109,101,
+116,101,114,115,112,114,111,104,105,98,105,116,101,100,61,32,34,104,116,116,112,
+58,47,47,100,105,99,116,105,111,110,97,114,121,112,101,114,99,101,112,116,105,
+111,110,114,101,118,111,108,117,116,105,111,110,102,111,117,110,100,97,116,105,
+111,110,112,120,59,104,101,105,103,104,116,58,115,117,99,99,101,115,115,102,117,
+108,115,117,112,112,111,114,116,101,114,115,109,105,108,108,101,110,110,105,117,
+109,104,105,115,32,102,97,116,104,101,114,116,104,101,32,38,113,117,111,116,59,
+110,111,45,114,101,112,101,97,116,59,99,111,109,109,101,114,99,105,97,108,105,
+110,100,117,115,116,114,105,97,108,101,110,99,111,117,114,97,103,101,100,97,109,
+111,117,110,116,32,111,102,32,117,110,111,102,102,105,99,105,97,108,101,102,102,
+105,99,105,101,110,99,121,82,101,102,101,114,101,110,99,101,115,99,111,111,114,
+100,105,110,97,116,101,100,105,115,99,108,97,105,109,101,114,101,120,112,101,100
+,105,116,105,111,110,100,101,118,101,108,111,112,105,110,103,99,97,108,99,117,
+108,97,116,101,100,115,105,109,112,108,105,102,105,101,100,108,101,103,105,116,
+105,109,97,116,101,115,117,98,115,116,114,105,110,103,40,48,34,32,99,108,97,115,
+115,61,34,99,111,109,112,108,101,116,101,108,121,105,108,108,117,115,116,114,97,
+116,101,102,105,118,101,32,121,101,97,114,115,105,110,115,116,114,117,109,101,
+110,116,80,117,98,108,105,115,104,105,110,103,49,34,32,99,108,97,115,115,61,34,
+112,115,121,99,104,111,108,111,103,121,99,111,110,102,105,100,101,110,99,101,110
+,117,109,98,101,114,32,111,102,32,97,98,115,101,110,99,101,32,111,102,102,111,99
+,117,115,101,100,32,111,110,106,111,105,110,101,100,32,116,104,101,115,116,114,
+117,99,116,117,114,101,115,112,114,101,118,105,111,117,115,108,121,62,60,47,105,
+102,114,97,109,101,62,111,110,99,101,32,97,103,97,105,110,98,117,116,32,114,97,
+116,104,101,114,105,109,109,105,103,114,97,110,116,115,111,102,32,99,111,117,114
+,115,101,44,97,32,103,114,111,117,112,32,111,102,76,105,116,101,114,97,116,117,
+114,101,85,110,108,105,107,101,32,116,104,101,60,47,97,62,38,110,98,115,112,59,
+10,102,117,110,99,116,105,111,110,32,105,116,32,119,97,115,32,116,104,101,67,111
+,110,118,101,110,116,105,111,110,97,117,116,111,109,111,98,105,108,101,80,114,
+111,116,101,115,116,97,110,116,97,103,103,114,101,115,115,105,118,101,97,102,116
+,101,114,32,116,104,101,32,83,105,109,105,108,97,114,108,121,44,34,32,47,62,60,
+47,100,105,118,62,99,111,108,108,101,99,116,105,111,110,13,10,102,117,110,99,116
+,105,111,110,118,105,115,105,98,105,108,105,116,121,116,104,101,32,117,115,101,
+32,111,102,118,111,108,117,110,116,101,101,114,115,97,116,116,114,97,99,116,105,
+111,110,117,110,100,101,114,32,116,104,101,32,116,104,114,101,97,116,101,110,101
+,100,42,60,33,91,67,68,65,84,65,91,105,109,112,111,114,116,97,110,99,101,105,110
+,32,103,101,110,101,114,97,108,116,104,101,32,108,97,116,116,101,114,60,47,102,
+111,114,109,62,10,60,47,46,105,110,100,101,120,79,102,40,39,105,32,61,32,48,59,
+32,105,32,60,100,105,102,102,101,114,101,110,99,101,100,101,118,111,116,101,100,
+32,116,111,116,114,97,100,105,116,105,111,110,115,115,101,97,114,99,104,32,102,
+111,114,117,108,116,105,109,97,116,101,108,121,116,111,117,114,110,97,109,101,
+110,116,97,116,116,114,105,98,117,116,101,115,115,111,45,99,97,108,108,101,100,
+32,125,10,60,47,115,116,121,108,101,62,101,118,97,108,117,97,116,105,111,110,101
+,109,112,104,97,115,105,122,101,100,97,99,99,101,115,115,105,98,108,101,60,47,
+115,101,99,116,105,111,110,62,115,117,99,99,101,115,115,105,111,110,97,108,111,
+110,103,32,119,105,116,104,77,101,97,110,119,104,105,108,101,44,105,110,100,117,
+115,116,114,105,101,115,60,47,97,62,60,98,114,32,47,62,104,97,115,32,98,101,99,
+111,109,101,97,115,112,101,99,116,115,32,111,102,84,101,108,101,118,105,115,105,
+111,110,115,117,102,102,105,99,105,101,110,116,98,97,115,107,101,116,98,97,108,
+108,98,111,116,104,32,115,105,100,101,115,99,111,110,116,105,110,117,105,110,103
+,97,110,32,97,114,116,105,99,108,101,60,105,109,103,32,97,108,116,61,34,97,100,
+118,101,110,116,117,114,101,115,104,105,115,32,109,111,116,104,101,114,109,97,
+110,99,104,101,115,116,101,114,112,114,105,110,99,105,112,108,101,115,112,97,114
+,116,105,99,117,108,97,114,99,111,109,109,101,110,116,97,114,121,101,102,102,101
+,99,116,115,32,111,102,100,101,99,105,100,101,100,32,116,111,34,62,60,115,116,
+114,111,110,103,62,112,117,98,108,105,115,104,101,114,115,74,111,117,114,110,97,
+108,32,111,102,100,105,102,102,105,99,117,108,116,121,102,97,99,105,108,105,116,
+97,116,101,97,99,99,101,112,116,97,98,108,101,115,116,121,108,101,46,99,115,115,
+34,9,102,117,110,99,116,105,111,110,32,105,110,110,111,118,97,116,105,111,110,62
+,67,111,112,121,114,105,103,104,116,115,105,116,117,97,116,105,111,110,115,119,
+111,117,108,100,32,104,97,118,101,98,117,115,105,110,101,115,115,101,115,68,105,
+99,116,105,111,110,97,114,121,115,116,97,116,101,109,101,110,116,115,111,102,116
+,101,110,32,117,115,101,100,112,101,114,115,105,115,116,101,110,116,105,110,32,
+74,97,110,117,97,114,121,99,111,109,112,114,105,115,105,110,103,60,47,116,105,
+116,108,101,62,10,9,100,105,112,108,111,109,97,116,105,99,99,111,110,116,97,105,
+110,105,110,103,112,101,114,102,111,114,109,105,110,103,101,120,116,101,110,115,
+105,111,110,115,109,97,121,32,110,111,116,32,98,101,99,111,110,99,101,112,116,32
+,111,102,32,111,110,99,108,105,99,107,61,34,73,116,32,105,115,32,97,108,115,111,
+102,105,110,97,110,99,105,97,108,32,109,97,107,105,110,103,32,116,104,101,76,117
+,120,101,109,98,111,117,114,103,97,100,100,105,116,105,111,110,97,108,97,114,101
+,32,99,97,108,108,101,100,101,110,103,97,103,101,100,32,105,110,34,115,99,114,
+105,112,116,34,41,59,98,117,116,32,105,116,32,119,97,115,101,108,101,99,116,114,
+111,110,105,99,111,110,115,117,98,109,105,116,61,34,10,60,33,45,45,32,69,110,100
+,32,101,108,101,99,116,114,105,99,97,108,111,102,102,105,99,105,97,108,108,121,
+115,117,103,103,101,115,116,105,111,110,116,111,112,32,111,102,32,116,104,101,
+117,110,108,105,107,101,32,116,104,101,65,117,115,116,114,97,108,105,97,110,79,
+114,105,103,105,110,97,108,108,121,114,101,102,101,114,101,110,99,101,115,10,60,
+47,104,101,97,100,62,13,10,114,101,99,111,103,110,105,115,101,100,105,110,105,
+116,105,97,108,105,122,101,108,105,109,105,116,101,100,32,116,111,65,108,101,120
+,97,110,100,114,105,97,114,101,116,105,114,101,109,101,110,116,65,100,118,101,
+110,116,117,114,101,115,102,111,117,114,32,121,101,97,114,115,10,10,38,108,116,
+59,33,45,45,32,105,110,99,114,101,97,115,105,110,103,100,101,99,111,114,97,116,
+105,111,110,104,51,32,99,108,97,115,115,61,34,111,114,105,103,105,110,115,32,111
+,102,111,98,108,105,103,97,116,105,111,110,114,101,103,117,108,97,116,105,111,
+110,99,108,97,115,115,105,102,105,101,100,40,102,117,110,99,116,105,111,110,40,
+97,100,118,97,110,116,97,103,101,115,98,101,105,110,103,32,116,104,101,32,104,
+105,115,116,111,114,105,97,110,115,60,98,97,115,101,32,104,114,101,102,114,101,
+112,101,97,116,101,100,108,121,119,105,108,108,105,110,103,32,116,111,99,111,109
+,112,97,114,97,98,108,101,100,101,115,105,103,110,97,116,101,100,110,111,109,105
+,110,97,116,105,111,110,102,117,110,99,116,105,111,110,97,108,105,110,115,105,
+100,101,32,116,104,101,114,101,118,101,108,97,116,105,111,110,101,110,100,32,111
+,102,32,116,104,101,115,32,102,111,114,32,116,104,101,32,97,117,116,104,111,114,
+105,122,101,100,114,101,102,117,115,101,100,32,116,111,116,97,107,101,32,112,108
+,97,99,101,97,117,116,111,110,111,109,111,117,115,99,111,109,112,114,111,109,105
+,115,101,112,111,108,105,116,105,99,97,108,32,114,101,115,116,97,117,114,97,110,
+116,116,119,111,32,111,102,32,116,104,101,70,101,98,114,117,97,114,121,32,50,113
+,117,97,108,105,116,121,32,111,102,115,119,102,111,98,106,101,99,116,46,117,110,
+100,101,114,115,116,97,110,100,110,101,97,114,108,121,32,97,108,108,119,114,105,
+116,116,101,110,32,98,121,105,110,116,101,114,118,105,101,119,115,34,32,119,105,
+100,116,104,61,34,49,119,105,116,104,100,114,97,119,97,108,102,108,111,97,116,58
+,108,101,102,116,105,115,32,117,115,117,97,108,108,121,99,97,110,100,105,100,97,
+116,101,115,110,101,119,115,112,97,112,101,114,115,109,121,115,116,101,114,105,
+111,117,115,68,101,112,97,114,116,109,101,110,116,98,101,115,116,32,107,110,111,
+119,110,112,97,114,108,105,97,109,101,110,116,115,117,112,112,114,101,115,115,
+101,100,99,111,110,118,101,110,105,101,110,116,114,101,109,101,109,98,101,114,
+101,100,100,105,102,102,101,114,101,110,116,32,115,121,115,116,101,109,97,116,
+105,99,104,97,115,32,108,101,100,32,116,111,112,114,111,112,97,103,97,110,100,97
+,99,111,110,116,114,111,108,108,101,100,105,110,102,108,117,101,110,99,101,115,
+99,101,114,101,109,111,110,105,97,108,112,114,111,99,108,97,105,109,101,100,80,
+114,111,116,101,99,116,105,111,110,108,105,32,99,108,97,115,115,61,34,83,99,105,
+101,110,116,105,102,105,99,99,108,97,115,115,61,34,110,111,45,116,114,97,100,101
+,109,97,114,107,115,109,111,114,101,32,116,104,97,110,32,119,105,100,101,115,112
+,114,101,97,100,76,105,98,101,114,97,116,105,111,110,116,111,111,107,32,112,108,
+97,99,101,100,97,121,32,111,102,32,116,104,101,97,115,32,108,111,110,103,32,97,
+115,105,109,112,114,105,115,111,110,101,100,65,100,100,105,116,105,111,110,97,
+108,10,60,104,101,97,100,62,10,60,109,76,97,98,111,114,97,116,111,114,121,78,111
+,118,101,109,98,101,114,32,50,101,120,99,101,112,116,105,111,110,115,73,110,100,
+117,115,116,114,105,97,108,118,97,114,105,101,116,121,32,111,102,102,108,111,97,
+116,58,32,108,101,102,68,117,114,105,110,103,32,116,104,101,97,115,115,101,115,
+115,109,101,110,116,104,97,118,101,32,98,101,101,110,32,100,101,97,108,115,32,
+119,105,116,104,83,116,97,116,105,115,116,105,99,115,111,99,99,117,114,114,101,
+110,99,101,47,117,108,62,60,47,100,105,118,62,99,108,101,97,114,102,105,120,34,
+62,116,104,101,32,112,117,98,108,105,99,109,97,110,121,32,121,101,97,114,115,119
+,104,105,99,104,32,119,101,114,101,111,118,101,114,32,116,105,109,101,44,115,121
+,110,111,110,121,109,111,117,115,99,111,110,116,101,110,116,34,62,10,112,114,101
+,115,117,109,97,98,108,121,104,105,115,32,102,97,109,105,108,121,117,115,101,114
+,65,103,101,110,116,46,117,110,101,120,112,101,99,116,101,100,105,110,99,108,117
+,100,105,110,103,32,99,104,97,108,108,101,110,103,101,100,97,32,109,105,110,111,
+114,105,116,121,117,110,100,101,102,105,110,101,100,34,98,101,108,111,110,103,
+115,32,116,111,116,97,107,101,110,32,102,114,111,109,105,110,32,79,99,116,111,98
+,101,114,112,111,115,105,116,105,111,110,58,32,115,97,105,100,32,116,111,32,98,
+101,114,101,108,105,103,105,111,117,115,32,70,101,100,101,114,97,116,105,111,110
+,32,114,111,119,115,112,97,110,61,34,111,110,108,121,32,97,32,102,101,119,109,
+101,97,110,116,32,116,104,97,116,108,101,100,32,116,111,32,116,104,101,45,45,62,
+13,10,60,100,105,118,32,60,102,105,101,108,100,115,101,116,62,65,114,99,104,98,
+105,115,104,111,112,32,99,108,97,115,115,61,34,110,111,98,101,105,110,103,32,117
+,115,101,100,97,112,112,114,111,97,99,104,101,115,112,114,105,118,105,108,101,
+103,101,115,110,111,115,99,114,105,112,116,62,10,114,101,115,117,108,116,115,32,
+105,110,109,97,121,32,98,101,32,116,104,101,69,97,115,116,101,114,32,101,103,103
+,109,101,99,104,97,110,105,115,109,115,114,101,97,115,111,110,97,98,108,101,80,
+111,112,117,108,97,116,105,111,110,67,111,108,108,101,99,116,105,111,110,115,101
+,108,101,99,116,101,100,34,62,110,111,115,99,114,105,112,116,62,13,47,105,110,
+100,101,120,46,112,104,112,97,114,114,105,118,97,108,32,111,102,45,106,115,115,
+100,107,39,41,41,59,109,97,110,97,103,101,100,32,116,111,105,110,99,111,109,112,
+108,101,116,101,99,97,115,117,97,108,116,105,101,115,99,111,109,112,108,101,116,
+105,111,110,67,104,114,105,115,116,105,97,110,115,83,101,112,116,101,109,98,101,
+114,32,97,114,105,116,104,109,101,116,105,99,112,114,111,99,101,100,117,114,101,
+115,109,105,103,104,116,32,104,97,118,101,80,114,111,100,117,99,116,105,111,110,
+105,116,32,97,112,112,101,97,114,115,80,104,105,108,111,115,111,112,104,121,102,
+114,105,101,110,100,115,104,105,112,108,101,97,100,105,110,103,32,116,111,103,
+105,118,105,110,103,32,116,104,101,116,111,119,97,114,100,32,116,104,101,103,117
+,97,114,97,110,116,101,101,100,100,111,99,117,109,101,110,116,101,100,99,111,108
+,111,114,58,35,48,48,48,118,105,100,101,111,32,103,97,109,101,99,111,109,109,105
+,115,115,105,111,110,114,101,102,108,101,99,116,105,110,103,99,104,97,110,103,
+101,32,116,104,101,97,115,115,111,99,105,97,116,101,100,115,97,110,115,45,115,
+101,114,105,102,111,110,107,101,121,112,114,101,115,115,59,32,112,97,100,100,105
+,110,103,58,72,101,32,119,97,115,32,116,104,101,117,110,100,101,114,108,121,105,
+110,103,116,121,112,105,99,97,108,108,121,32,44,32,97,110,100,32,116,104,101,32,
+115,114,99,69,108,101,109,101,110,116,115,117,99,99,101,115,115,105,118,101,115,
+105,110,99,101,32,116,104,101,32,115,104,111,117,108,100,32,98,101,32,110,101,
+116,119,111,114,107,105,110,103,97,99,99,111,117,110,116,105,110,103,117,115,101
+,32,111,102,32,116,104,101,108,111,119,101,114,32,116,104,97,110,115,104,111,119
+,115,32,116,104,97,116,60,47,115,112,97,110,62,10,9,9,99,111,109,112,108,97,105,
+110,116,115,99,111,110,116,105,110,117,111,117,115,113,117,97,110,116,105,116,
+105,101,115,97,115,116,114,111,110,111,109,101,114,104,101,32,100,105,100,32,110
+,111,116,100,117,101,32,116,111,32,105,116,115,97,112,112,108,105,101,100,32,116
+,111,97,110,32,97,118,101,114,97,103,101,101,102,102,111,114,116,115,32,116,111,
+116,104,101,32,102,117,116,117,114,101,97,116,116,101,109,112,116,32,116,111,84,
+104,101,114,101,102,111,114,101,44,99,97,112,97,98,105,108,105,116,121,82,101,
+112,117,98,108,105,99,97,110,119,97,115,32,102,111,114,109,101,100,69,108,101,99
+,116,114,111,110,105,99,107,105,108,111,109,101,116,101,114,115,99,104,97,108,
+108,101,110,103,101,115,112,117,98,108,105,115,104,105,110,103,116,104,101,32,
+102,111,114,109,101,114,105,110,100,105,103,101,110,111,117,115,100,105,114,101,
+99,116,105,111,110,115,115,117,98,115,105,100,105,97,114,121,99,111,110,115,112,
+105,114,97,99,121,100,101,116,97,105,108,115,32,111,102,97,110,100,32,105,110,32
+,116,104,101,97,102,102,111,114,100,97,98,108,101,115,117,98,115,116,97,110,99,
+101,115,114,101,97,115,111,110,32,102,111,114,99,111,110,118,101,110,116,105,111
+,110,105,116,101,109,116,121,112,101,61,34,97,98,115,111,108,117,116,101,108,121
+,115,117,112,112,111,115,101,100,108,121,114,101,109,97,105,110,101,100,32,97,97
+,116,116,114,97,99,116,105,118,101,116,114,97,118,101,108,108,105,110,103,115,
+101,112,97,114,97,116,101,108,121,102,111,99,117,115,101,115,32,111,110,101,108,
+101,109,101,110,116,97,114,121,97,112,112,108,105,99,97,98,108,101,102,111,117,
+110,100,32,116,104,97,116,115,116,121,108,101,115,104,101,101,116,109,97,110,117
+,115,99,114,105,112,116,115,116,97,110,100,115,32,102,111,114,32,110,111,45,114,
+101,112,101,97,116,40,115,111,109,101,116,105,109,101,115,67,111,109,109,101,114
+,99,105,97,108,105,110,32,65,109,101,114,105,99,97,117,110,100,101,114,116,97,
+107,101,110,113,117,97,114,116,101,114,32,111,102,97,110,32,101,120,97,109,112,
+108,101,112,101,114,115,111,110,97,108,108,121,105,110,100,101,120,46,112,104,
+112,63,60,47,98,117,116,116,111,110,62,10,112,101,114,99,101,110,116,97,103,101,
+98,101,115,116,45,107,110,111,119,110,99,114,101,97,116,105,110,103,32,97,34,32,
+100,105,114,61,34,108,116,114,76,105,101,117,116,101,110,97,110,116,10,60,100,
+105,118,32,105,100,61,34,116,104,101,121,32,119,111,117,108,100,97,98,105,108,
+105,116,121,32,111,102,109,97,100,101,32,117,112,32,111,102,110,111,116,101,100,
+32,116,104,97,116,99,108,101,97,114,32,116,104,97,116,97,114,103,117,101,32,116,
+104,97,116,116,111,32,97,110,111,116,104,101,114,99,104,105,108,100,114,101,110,
+39,115,112,117,114,112,111,115,101,32,111,102,102,111,114,109,117,108,97,116,101
+,100,98,97,115,101,100,32,117,112,111,110,116,104,101,32,114,101,103,105,111,110
+,115,117,98,106,101,99,116,32,111,102,112,97,115,115,101,110,103,101,114,115,112
+,111,115,115,101,115,115,105,111,110,46,10,10,73,110,32,116,104,101,32,66,101,
+102,111,114,101,32,116,104,101,97,102,116,101,114,119,97,114,100,115,99,117,114,
+114,101,110,116,108,121,32,97,99,114,111,115,115,32,116,104,101,115,99,105,101,
+110,116,105,102,105,99,99,111,109,109,117,110,105,116,121,46,99,97,112,105,116,
+97,108,105,115,109,105,110,32,71,101,114,109,97,110,121,114,105,103,104,116,45,
+119,105,110,103,116,104,101,32,115,121,115,116,101,109,83,111,99,105,101,116,121
+,32,111,102,112,111,108,105,116,105,99,105,97,110,100,105,114,101,99,116,105,111
+,110,58,119,101,110,116,32,111,110,32,116,111,114,101,109,111,118,97,108,32,111,
+102,32,78,101,119,32,89,111,114,107,32,97,112,97,114,116,109,101,110,116,115,105
+,110,100,105,99,97,116,105,111,110,100,117,114,105,110,103,32,116,104,101,117,
+110,108,101,115,115,32,116,104,101,104,105,115,116,111,114,105,99,97,108,104,97,
+100,32,98,101,101,110,32,97,100,101,102,105,110,105,116,105,118,101,105,110,103,
+114,101,100,105,101,110,116,97,116,116,101,110,100,97,110,99,101,67,101,110,116,
+101,114,32,102,111,114,112,114,111,109,105,110,101,110,99,101,114,101,97,100,121
+,83,116,97,116,101,115,116,114,97,116,101,103,105,101,115,98,117,116,32,105,110,
+32,116,104,101,97,115,32,112,97,114,116,32,111,102,99,111,110,115,116,105,116,
+117,116,101,99,108,97,105,109,32,116,104,97,116,108,97,98,111,114,97,116,111,114
+,121,99,111,109,112,97,116,105,98,108,101,102,97,105,108,117,114,101,32,111,102,
+44,32,115,117,99,104,32,97,115,32,98,101,103,97,110,32,119,105,116,104,117,115,
+105,110,103,32,116,104,101,32,116,111,32,112,114,111,118,105,100,101,102,101,97,
+116,117,114,101,32,111,102,102,114,111,109,32,119,104,105,99,104,47,34,32,99,108
+,97,115,115,61,34,103,101,111,108,111,103,105,99,97,108,115,101,118,101,114,97,
+108,32,111,102,100,101,108,105,98,101,114,97,116,101,105,109,112,111,114,116,97,
+110,116,32,104,111,108,100,115,32,116,104,97,116,105,110,103,38,113,117,111,116,
+59,32,118,97,108,105,103,110,61,116,111,112,116,104,101,32,71,101,114,109,97,110
+,111,117,116,115,105,100,101,32,111,102,110,101,103,111,116,105,97,116,101,100,
+104,105,115,32,99,97,114,101,101,114,115,101,112,97,114,97,116,105,111,110,105,
+100,61,34,115,101,97,114,99,104,119,97,115,32,99,97,108,108,101,100,116,104,101,
+32,102,111,117,114,116,104,114,101,99,114,101,97,116,105,111,110,111,116,104,101
+,114,32,116,104,97,110,112,114,101,118,101,110,116,105,111,110,119,104,105,108,
+101,32,116,104,101,32,101,100,117,99,97,116,105,111,110,44,99,111,110,110,101,99
+,116,105,110,103,97,99,99,117,114,97,116,101,108,121,119,101,114,101,32,98,117,
+105,108,116,119,97,115,32,107,105,108,108,101,100,97,103,114,101,101,109,101,110
+,116,115,109,117,99,104,32,109,111,114,101,32,68,117,101,32,116,111,32,116,104,
+101,119,105,100,116,104,58,32,49,48,48,115,111,109,101,32,111,116,104,101,114,75
+,105,110,103,100,111,109,32,111,102,116,104,101,32,101,110,116,105,114,101,102,
+97,109,111,117,115,32,102,111,114,116,111,32,99,111,110,110,101,99,116,111,98,
+106,101,99,116,105,118,101,115,116,104,101,32,70,114,101,110,99,104,112,101,111,
+112,108,101,32,97,110,100,102,101,97,116,117,114,101,100,34,62,105,115,32,115,97
+,105,100,32,116,111,115,116,114,117,99,116,117,114,97,108,114,101,102,101,114,
+101,110,100,117,109,109,111,115,116,32,111,102,116,101,110,97,32,115,101,112,97,
+114,97,116,101,45,62,10,60,100,105,118,32,105,100,32,79,102,102,105,99,105,97,
+108,32,119,111,114,108,100,119,105,100,101,46,97,114,105,97,45,108,97,98,101,108
+,116,104,101,32,112,108,97,110,101,116,97,110,100,32,105,116,32,119,97,115,100,
+34,32,118,97,108,117,101,61,34,108,111,111,107,105,110,103,32,97,116,98,101,110,
+101,102,105,99,105,97,108,97,114,101,32,105,110,32,116,104,101,109,111,110,105,
+116,111,114,105,110,103,114,101,112,111,114,116,101,100,108,121,116,104,101,32,
+109,111,100,101,114,110,119,111,114,107,105,110,103,32,111,110,97,108,108,111,
+119,101,100,32,116,111,119,104,101,114,101,32,116,104,101,32,105,110,110,111,118
+,97,116,105,118,101,60,47,97,62,60,47,100,105,118,62,115,111,117,110,100,116,114
+,97,99,107,115,101,97,114,99,104,70,111,114,109,116,101,110,100,32,116,111,32,98
+,101,105,110,112,117,116,32,105,100,61,34,111,112,101,110,105,110,103,32,111,102
+,114,101,115,116,114,105,99,116,101,100,97,100,111,112,116,101,100,32,98,121,97,
+100,100,114,101,115,115,105,110,103,116,104,101,111,108,111,103,105,97,110,109,
+101,116,104,111,100,115,32,111,102,118,97,114,105,97,110,116,32,111,102,67,104,
+114,105,115,116,105,97,110,32,118,101,114,121,32,108,97,114,103,101,97,117,116,
+111,109,111,116,105,118,101,98,121,32,102,97,114,32,116,104,101,114,97,110,103,
+101,32,102,114,111,109,112,117,114,115,117,105,116,32,111,102,102,111,108,108,
+111,119,32,116,104,101,98,114,111,117,103,104,116,32,116,111,105,110,32,69,110,
+103,108,97,110,100,97,103,114,101,101,32,116,104,97,116,97,99,99,117,115,101,100
+,32,111,102,99,111,109,101,115,32,102,114,111,109,112,114,101,118,101,110,116,
+105,110,103,100,105,118,32,115,116,121,108,101,61,104,105,115,32,111,114,32,104,
+101,114,116,114,101,109,101,110,100,111,117,115,102,114,101,101,100,111,109,32,
+111,102,99,111,110,99,101,114,110,105,110,103,48,32,49,101,109,32,49,101,109,59,
+66,97,115,107,101,116,98,97,108,108,47,115,116,121,108,101,46,99,115,115,97,110,
+32,101,97,114,108,105,101,114,101,118,101,110,32,97,102,116,101,114,47,34,32,116
+,105,116,108,101,61,34,46,99,111,109,47,105,110,100,101,120,116,97,107,105,110,
+103,32,116,104,101,112,105,116,116,115,98,117,114,103,104,99,111,110,116,101,110
+,116,34,62,13,60,115,99,114,105,112,116,62,40,102,116,117,114,110,101,100,32,111
+,117,116,104,97,118,105,110,103,32,116,104,101,60,47,115,112,97,110,62,13,10,32,
+111,99,99,97,115,105,111,110,97,108,98,101,99,97,117,115,101,32,105,116,115,116,
+97,114,116,101,100,32,116,111,112,104,121,115,105,99,97,108,108,121,62,60,47,100
+,105,118,62,10,32,32,99,114,101,97,116,101,100,32,98,121,67,117,114,114,101,110,
+116,108,121,44,32,98,103,99,111,108,111,114,61,34,116,97,98,105,110,100,101,120,
+61,34,100,105,115,97,115,116,114,111,117,115,65,110,97,108,121,116,105,99,115,32
+,97,108,115,111,32,104,97,115,32,97,62,60,100,105,118,32,105,100,61,34,60,47,115
+,116,121,108,101,62,10,60,99,97,108,108,101,100,32,102,111,114,115,105,110,103,
+101,114,32,97,110,100,46,115,114,99,32,61,32,34,47,47,118,105,111,108,97,116,105
+,111,110,115,116,104,105,115,32,112,111,105,110,116,99,111,110,115,116,97,110,
+116,108,121,105,115,32,108,111,99,97,116,101,100,114,101,99,111,114,100,105,110,
+103,115,100,32,102,114,111,109,32,116,104,101,110,101,100,101,114,108,97,110,100
+,115,112,111,114,116,117,103,117,195,170,115,215,162,215,145,215,168,215,153,215
+,170,217,129,216,167,216,177,216,179,219,140,100,101,115,97,114,114,111,108,108,
+111,99,111,109,101,110,116,97,114,105,111,101,100,117,99,97,99,105,195,179,110,
+115,101,112,116,105,101,109,98,114,101,114,101,103,105,115,116,114,97,100,111,
+100,105,114,101,99,99,105,195,179,110,117,98,105,99,97,99,105,195,179,110,112,
+117,98,108,105,99,105,100,97,100,114,101,115,112,117,101,115,116,97,115,114,101,
+115,117,108,116,97,100,111,115,105,109,112,111,114,116,97,110,116,101,114,101,
+115,101,114,118,97,100,111,115,97,114,116,195,173,99,117,108,111,115,100,105,102
+,101,114,101,110,116,101,115,115,105,103,117,105,101,110,116,101,115,114,101,112
+,195,186,98,108,105,99,97,115,105,116,117,97,99,105,195,179,110,109,105,110,105,
+115,116,101,114,105,111,112,114,105,118,97,99,105,100,97,100,100,105,114,101,99,
+116,111,114,105,111,102,111,114,109,97,99,105,195,179,110,112,111,98,108,97,99,
+105,195,179,110,112,114,101,115,105,100,101,110,116,101,99,111,110,116,101,110,
+105,100,111,115,97,99,99,101,115,111,114,105,111,115,116,101,99,104,110,111,114,
+97,116,105,112,101,114,115,111,110,97,108,101,115,99,97,116,101,103,111,114,195,
+173,97,101,115,112,101,99,105,97,108,101,115,100,105,115,112,111,110,105,98,108,
+101,97,99,116,117,97,108,105,100,97,100,114,101,102,101,114,101,110,99,105,97,
+118,97,108,108,97,100,111,108,105,100,98,105,98,108,105,111,116,101,99,97,114,
+101,108,97,99,105,111,110,101,115,99,97,108,101,110,100,97,114,105,111,112,111,
+108,195,173,116,105,99,97,115,97,110,116,101,114,105,111,114,101,115,100,111,99,
+117,109,101,110,116,111,115,110,97,116,117,114,97,108,101,122,97,109,97,116,101,
+114,105,97,108,101,115,100,105,102,101,114,101,110,99,105,97,101,99,111,110,195,
+179,109,105,99,97,116,114,97,110,115,112,111,114,116,101,114,111,100,114,195,173
+,103,117,101,122,112,97,114,116,105,99,105,112,97,114,101,110,99,117,101,110,116
+,114,97,110,100,105,115,99,117,115,105,195,179,110,101,115,116,114,117,99,116,
+117,114,97,102,117,110,100,97,99,105,195,179,110,102,114,101,99,117,101,110,116,
+101,115,112,101,114,109,97,110,101,110,116,101,116,111,116,97,108,109,101,110,
+116,101,208,188,208,190,208,182,208,189,208,190,208,177,209,131,208,180,208,181,
+209,130,208,188,208,190,208,182,208,181,209,130,208,178,209,128,208,181,208,188,
+209,143,209,130,208,176,208,186,208,182,208,181,209,135,209,130,208,190,208,177,
+209,139,208,177,208,190,208,187,208,181,208,181,208,190,209,135,208,181,208,189,
+209,140,209,141,209,130,208,190,208,179,208,190,208,186,208,190,208,179,208,180,
+208,176,208,191,208,190,209,129,208,187,208,181,208,178,209,129,208,181,208,179,
+208,190,209,129,208,176,208,185,209,130,208,181,209,135,208,181,209,128,208,181,
+208,183,208,188,208,190,208,179,209,131,209,130,209,129,208,176,208,185,209,130,
+208,176,208,182,208,184,208,183,208,189,208,184,208,188,208,181,208,182,208,180,
+209,131,208,177,209,131,208,180,209,131,209,130,208,159,208,190,208,184,209,129,
+208,186,208,183,208,180,208,181,209,129,209,140,208,178,208,184,208,180,208,181,
+208,190,209,129,208,178,209,143,208,183,208,184,208,189,209,131,208,182,208,189,
+208,190,209,129,208,178,208,190,208,181,208,185,208,187,209,142,208,180,208,181,
+208,185,208,191,208,190,209,128,208,189,208,190,208,188,208,189,208,190,208,179,
+208,190,208,180,208,181,209,130,208,181,208,185,209,129,208,178,208,190,208,184,
+209,133,208,191,209,128,208,176,208,178,208,176,209,130,208,176,208,186,208,190,
+208,185,208,188,208,181,209,129,209,130,208,190,208,184,208,188,208,181,208,181,
+209,130,208,182,208,184,208,183,208,189,209,140,208,190,208,180,208,189,208,190,
+208,185,208,187,209,131,209,135,209,136,208,181,208,191,208,181,209,128,208,181,
+208,180,209,135,208,176,209,129,209,130,208,184,209,135,208,176,209,129,209,130,
+209,140,209,128,208,176,208,177,208,190,209,130,208,189,208,190,208,178,209,139,
+209,133,208,191,209,128,208,176,208,178,208,190,209,129,208,190,208,177,208,190,
+208,185,208,191,208,190,209,130,208,190,208,188,208,188,208,181,208,189,208,181,
+208,181,209,135,208,184,209,129,208,187,208,181,208,189,208,190,208,178,209,139,
+208,181,209,131,209,129,208,187,209,131,208,179,208,190,208,186,208,190,208,187,
+208,190,208,189,208,176,208,183,208,176,208,180,209,130,208,176,208,186,208,190,
+208,181,209,130,208,190,208,179,208,180,208,176,208,191,208,190,209,135,209,130,
+208,184,208,159,208,190,209,129,208,187,208,181,209,130,208,176,208,186,208,184,
+208,181,208,189,208,190,208,178,209,139,208,185,209,129,209,130,208,190,208,184,
+209,130,209,130,208,176,208,186,208,184,209,133,209,129,209,128,208,176,208,183,
+209,131,208,161,208,176,208,189,208,186,209,130,209,132,208,190,209,128,209,131,
+208,188,208,154,208,190,208,179,208,180,208,176,208,186,208,189,208,184,208,179,
+208,184,209,129,208,187,208,190,208,178,208,176,208,189,208,176,209,136,208,181,
+208,185,208,189,208,176,208,185,209,130,208,184,209,129,208,178,208,190,208,184,
+208,188,209,129,208,178,209,143,208,183,209,140,208,187,209,142,208,177,208,190,
+208,185,209,135,208,176,209,129,209,130,208,190,209,129,209,128,208,181,208,180,
+208,184,208,154,209,128,208,190,208,188,208,181,208,164,208,190,209,128,209,131,
+208,188,209,128,209,139,208,189,208,186,208,181,209,129,209,130,208,176,208,187,
+208,184,208,191,208,190,208,184,209,129,208,186,209,130,209,139,209,129,209,143,
+209,135,208,188,208,181,209,129,209,143,209,134,209,134,208,181,208,189,209,130,
+209,128,209,130,209,128,209,131,208,180,208,176,209,129,208,176,208,188,209,139,
+209,133,209,128,209,139,208,189,208,186,208,176,208,157,208,190,208,178,209,139,
+208,185,209,135,208,176,209,129,208,190,208,178,208,188,208,181,209,129,209,130,
+208,176,209,132,208,184,208,187,209,140,208,188,208,188,208,176,209,128,209,130,
+208,176,209,129,209,130,209,128,208,176,208,189,208,188,208,181,209,129,209,130,
+208,181,209,130,208,181,208,186,209,129,209,130,208,189,208,176,209,136,208,184,
+209,133,208,188,208,184,208,189,209,131,209,130,208,184,208,188,208,181,208,189,
+208,184,208,184,208,188,208,181,209,142,209,130,208,189,208,190,208,188,208,181,
+209,128,208,179,208,190,209,128,208,190,208,180,209,129,208,176,208,188,208,190,
+208,188,209,141,209,130,208,190,208,188,209,131,208,186,208,190,208,189,209,134,
+208,181,209,129,208,178,208,190,208,181,208,188,208,186,208,176,208,186,208,190,
+208,185,208,144,209,128,209,133,208,184,208,178,217,133,217,134,216,170,216,175,
+217,137,216,165,216,177,216,179,216,167,217,132,216,177,216,179,216,167,217,132,
+216,169,216,167,217,132,216,185,216,167,217,133,217,131,216,170,216,168,217,135,
+216,167,216,168,216,177,216,167,217,133,216,172,216,167,217,132,217,138,217,136,
+217,133,216,167,217,132,216,181,217,136,216,177,216,172,216,175,217,138,216,175,
+216,169,216,167,217,132,216,185,216,182,217,136,216,165,216,182,216,167,217,129,
+216,169,216,167,217,132,217,130,216,179,217,133,216,167,217,132,216,185,216,167,
+216,168,216,170,216,173,217,133,217,138,217,132,217,133,217,132,217,129,216,167,
+216,170,217,133,217,132,216,170,217,130,217,137,216,170,216,185,216,175,217,138,
+217,132,216,167,217,132,216,180,216,185,216,177,216,163,216,174,216,168,216,167,
+216,177,216,170,216,183,217,136,217,138,216,177,216,185,217,132,217,138,217,131,
+217,133,216,165,216,177,217,129,216,167,217,130,216,183,217,132,216,168,216,167,
+216,170,216,167,217,132,217,132,216,186,216,169,216,170,216,177,216,170,217,138,
+216,168,216,167,217,132,217,134,216,167,216,179,216,167,217,132,216,180,217,138,
+216,174,217,133,217,134,216,170,216,175,217,138,216,167,217,132,216,185,216,177,
+216,168,216,167,217,132,217,130,216,181,216,181,216,167,217,129,217,132,216,167,
+217,133,216,185,217,132,217,138,217,135,216,167,216,170,216,173,216,175,217,138,
+216,171,216,167,217,132,217,132,217,135,217,133,216,167,217,132,216,185,217,133,
+217,132,217,133,217,131,216,170,216,168,216,169,217,138,217,133,217,131,217,134,
+217,131,216,167,217,132,216,183,217,129,217,132,217,129,217,138,216,175,217,138,
+217,136,216,165,216,175,216,167,216,177,216,169,216,170,216,167,216,177,217,138,
+216,174,216,167,217,132,216,181,216,173,216,169,216,170,216,179,216,172,217,138,
+217,132,216,167,217,132,217,136,217,130,216,170,216,185,217,134,216,175,217,133,
+216,167,217,133,216,175,217,138,217,134,216,169,216,170,216,181,217,133,217,138,
+217,133,216,163,216,177,216,180,217,138,217,129,216,167,217,132,216,176,217,138,
+217,134,216,185,216,177,216,168,217,138,216,169,216,168,217,136,216,167,216,168,
+216,169,216,163,217,132,216,185,216,167,216,168,216,167,217,132,216,179,217,129,
+216,177,217,133,216,180,216,167,217,131,217,132,216,170,216,185,216,167,217,132,
+217,137,216,167,217,132,216,163,217,136,217,132,216,167,217,132,216,179,217,134,
+216,169,216,172,216,167,217,133,216,185,216,169,216,167,217,132,216,181,216,173,
+217,129,216,167,217,132,216,175,217,138,217,134,217,131,217,132,217,133,216,167,
+216,170,216,167,217,132,216,174,216,167,216,181,216,167,217,132,217,133,217,132,
+217,129,216,163,216,185,216,182,216,167,216,161,217,131,216,170,216,167,216,168,
+216,169,216,167,217,132,216,174,217,138,216,177,216,177,216,179,216,167,216,166,
+217,132,216,167,217,132,217,130,217,132,216,168,216,167,217,132,216,163,216,175,
+216,168,217,133,217,130,216,167,216,183,216,185,217,133,216,177,216,167,216,179,
+217,132,217,133,217,134,216,183,217,130,216,169,216,167,217,132,217,131,216,170,
+216,168,216,167,217,132,216,177,216,172,217,132,216,167,216,180,216,170,216,177,
+217,131,216,167,217,132,217,130,216,175,217,133,217,138,216,185,216,183,217,138,
+217,131,115,66,121,84,97,103,78,97,109,101,40,46,106,112,103,34,32,97,108,116,61
+,34,49,112,120,32,115,111,108,105,100,32,35,46,103,105,102,34,32,97,108,116,61,
+34,116,114,97,110,115,112,97,114,101,110,116,105,110,102,111,114,109,97,116,105,
+111,110,97,112,112,108,105,99,97,116,105,111,110,34,32,111,110,99,108,105,99,107
+,61,34,101,115,116,97,98,108,105,115,104,101,100,97,100,118,101,114,116,105,115,
+105,110,103,46,112,110,103,34,32,97,108,116,61,34,101,110,118,105,114,111,110,
+109,101,110,116,112,101,114,102,111,114,109,97,110,99,101,97,112,112,114,111,112
+,114,105,97,116,101,38,97,109,112,59,109,100,97,115,104,59,105,109,109,101,100,
+105,97,116,101,108,121,60,47,115,116,114,111,110,103,62,60,47,114,97,116,104,101
+,114,32,116,104,97,110,116,101,109,112,101,114,97,116,117,114,101,100,101,118,
+101,108,111,112,109,101,110,116,99,111,109,112,101,116,105,116,105,111,110,112,
+108,97,99,101,104,111,108,100,101,114,118,105,115,105,98,105,108,105,116,121,58,
+99,111,112,121,114,105,103,104,116,34,62,48,34,32,104,101,105,103,104,116,61,34,
+101,118,101,110,32,116,104,111,117,103,104,114,101,112,108,97,99,101,109,101,110
+,116,100,101,115,116,105,110,97,116,105,111,110,67,111,114,112,111,114,97,116,
+105,111,110,60,117,108,32,99,108,97,115,115,61,34,65,115,115,111,99,105,97,116,
+105,111,110,105,110,100,105,118,105,100,117,97,108,115,112,101,114,115,112,101,
+99,116,105,118,101,115,101,116,84,105,109,101,111,117,116,40,117,114,108,40,104,
+116,116,112,58,47,47,109,97,116,104,101,109,97,116,105,99,115,109,97,114,103,105
+,110,45,116,111,112,58,101,118,101,110,116,117,97,108,108,121,32,100,101,115,99,
+114,105,112,116,105,111,110,41,32,110,111,45,114,101,112,101,97,116,99,111,108,
+108,101,99,116,105,111,110,115,46,74,80,71,124,116,104,117,109,98,124,112,97,114
+,116,105,99,105,112,97,116,101,47,104,101,97,100,62,60,98,111,100,121,102,108,
+111,97,116,58,108,101,102,116,59,60,108,105,32,99,108,97,115,115,61,34,104,117,
+110,100,114,101,100,115,32,111,102,10,10,72,111,119,101,118,101,114,44,32,99,111
+,109,112,111,115,105,116,105,111,110,99,108,101,97,114,58,98,111,116,104,59,99,
+111,111,112,101,114,97,116,105,111,110,119,105,116,104,105,110,32,116,104,101,32
+,108,97,98,101,108,32,102,111,114,61,34,98,111,114,100,101,114,45,116,111,112,58
+,78,101,119,32,90,101,97,108,97,110,100,114,101,99,111,109,109,101,110,100,101,
+100,112,104,111,116,111,103,114,97,112,104,121,105,110,116,101,114,101,115,116,
+105,110,103,38,108,116,59,115,117,112,38,103,116,59,99,111,110,116,114,111,118,
+101,114,115,121,78,101,116,104,101,114,108,97,110,100,115,97,108,116,101,114,110
+,97,116,105,118,101,109,97,120,108,101,110,103,116,104,61,34,115,119,105,116,122
+,101,114,108,97,110,100,68,101,118,101,108,111,112,109,101,110,116,101,115,115,
+101,110,116,105,97,108,108,121,10,10,65,108,116,104,111,117,103,104,32,60,47,116
+,101,120,116,97,114,101,97,62,116,104,117,110,100,101,114,98,105,114,100,114,101
+,112,114,101,115,101,110,116,101,100,38,97,109,112,59,110,100,97,115,104,59,115,
+112,101,99,117,108,97,116,105,111,110,99,111,109,109,117,110,105,116,105,101,115
+,108,101,103,105,115,108,97,116,105,111,110,101,108,101,99,116,114,111,110,105,
+99,115,10,9,60,100,105,118,32,105,100,61,34,105,108,108,117,115,116,114,97,116,
+101,100,101,110,103,105,110,101,101,114,105,110,103,116,101,114,114,105,116,111,
+114,105,101,115,97,117,116,104,111,114,105,116,105,101,115,100,105,115,116,114,
+105,98,117,116,101,100,54,34,32,104,101,105,103,104,116,61,34,115,97,110,115,45,
+115,101,114,105,102,59,99,97,112,97,98,108,101,32,111,102,32,100,105,115,97,112,
+112,101,97,114,101,100,105,110,116,101,114,97,99,116,105,118,101,108,111,111,107
+,105,110,103,32,102,111,114,105,116,32,119,111,117,108,100,32,98,101,65,102,103,
+104,97,110,105,115,116,97,110,119,97,115,32,99,114,101,97,116,101,100,77,97,116,
+104,46,102,108,111,111,114,40,115,117,114,114,111,117,110,100,105,110,103,99,97,
+110,32,97,108,115,111,32,98,101,111,98,115,101,114,118,97,116,105,111,110,109,97
+,105,110,116,101,110,97,110,99,101,101,110,99,111,117,110,116,101,114,101,100,60
+,104,50,32,99,108,97,115,115,61,34,109,111,114,101,32,114,101,99,101,110,116,105
+,116,32,104,97,115,32,98,101,101,110,105,110,118,97,115,105,111,110,32,111,102,
+41,46,103,101,116,84,105,109,101,40,41,102,117,110,100,97,109,101,110,116,97,108
+,68,101,115,112,105,116,101,32,116,104,101,34,62,60,100,105,118,32,105,100,61,34
+,105,110,115,112,105,114,97,116,105,111,110,101,120,97,109,105,110,97,116,105,
+111,110,112,114,101,112,97,114,97,116,105,111,110,101,120,112,108,97,110,97,116,
+105,111,110,60,105,110,112,117,116,32,105,100,61,34,60,47,97,62,60,47,115,112,97
+,110,62,118,101,114,115,105,111,110,115,32,111,102,105,110,115,116,114,117,109,
+101,110,116,115,98,101,102,111,114,101,32,116,104,101,32,32,61,32,39,104,116,116
+,112,58,47,47,68,101,115,99,114,105,112,116,105,111,110,114,101,108,97,116,105,
+118,101,108,121,32,46,115,117,98,115,116,114,105,110,103,40,101,97,99,104,32,111
+,102,32,116,104,101,101,120,112,101,114,105,109,101,110,116,115,105,110,102,108,
+117,101,110,116,105,97,108,105,110,116,101,103,114,97,116,105,111,110,109,97,110
+,121,32,112,101,111,112,108,101,100,117,101,32,116,111,32,116,104,101,32,99,111,
+109,98,105,110,97,116,105,111,110,100,111,32,110,111,116,32,104,97,118,101,77,
+105,100,100,108,101,32,69,97,115,116,60,110,111,115,99,114,105,112,116,62,60,99,
+111,112,121,114,105,103,104,116,34,32,112,101,114,104,97,112,115,32,116,104,101,
+105,110,115,116,105,116,117,116,105,111,110,105,110,32,68,101,99,101,109,98,101,
+114,97,114,114,97,110,103,101,109,101,110,116,109,111,115,116,32,102,97,109,111,
+117,115,112,101,114,115,111,110,97,108,105,116,121,99,114,101,97,116,105,111,110
+,32,111,102,108,105,109,105,116,97,116,105,111,110,115,101,120,99,108,117,115,
+105,118,101,108,121,115,111,118,101,114,101,105,103,110,116,121,45,99,111,110,
+116,101,110,116,34,62,10,60,116,100,32,99,108,97,115,115,61,34,117,110,100,101,
+114,103,114,111,117,110,100,112,97,114,97,108,108,101,108,32,116,111,100,111,99,
+116,114,105,110,101,32,111,102,111,99,99,117,112,105,101,100,32,98,121,116,101,
+114,109,105,110,111,108,111,103,121,82,101,110,97,105,115,115,97,110,99,101,97,
+32,110,117,109,98,101,114,32,111,102,115,117,112,112,111,114,116,32,102,111,114,
+101,120,112,108,111,114,97,116,105,111,110,114,101,99,111,103,110,105,116,105,
+111,110,112,114,101,100,101,99,101,115,115,111,114,60,105,109,103,32,115,114,99,
+61,34,47,60,104,49,32,99,108,97,115,115,61,34,112,117,98,108,105,99,97,116,105,
+111,110,109,97,121,32,97,108,115,111,32,98,101,115,112,101,99,105,97,108,105,122
+,101,100,60,47,102,105,101,108,100,115,101,116,62,112,114,111,103,114,101,115,
+115,105,118,101,109,105,108,108,105,111,110,115,32,111,102,115,116,97,116,101,
+115,32,116,104,97,116,101,110,102,111,114,99,101,109,101,110,116,97,114,111,117,
+110,100,32,116,104,101,32,111,110,101,32,97,110,111,116,104,101,114,46,112,97,
+114,101,110,116,78,111,100,101,97,103,114,105,99,117,108,116,117,114,101,65,108,
+116,101,114,110,97,116,105,118,101,114,101,115,101,97,114,99,104,101,114,115,116
+,111,119,97,114,100,115,32,116,104,101,77,111,115,116,32,111,102,32,116,104,101,
+109,97,110,121,32,111,116,104,101,114,32,40,101,115,112,101,99,105,97,108,108,
+121,60,116,100,32,119,105,100,116,104,61,34,59,119,105,100,116,104,58,49,48,48,
+37,105,110,100,101,112,101,110,100,101,110,116,60,104,51,32,99,108,97,115,115,61
+,34,32,111,110,99,104,97,110,103,101,61,34,41,46,97,100,100,67,108,97,115,115,40
+,105,110,116,101,114,97,99,116,105,111,110,79,110,101,32,111,102,32,116,104,101,
+32,100,97,117,103,104,116,101,114,32,111,102,97,99,99,101,115,115,111,114,105,
+101,115,98,114,97,110,99,104,101,115,32,111,102,13,10,60,100,105,118,32,105,100,
+61,34,116,104,101,32,108,97,114,103,101,115,116,100,101,99,108,97,114,97,116,105
+,111,110,114,101,103,117,108,97,116,105,111,110,115,73,110,102,111,114,109,97,
+116,105,111,110,116,114,97,110,115,108,97,116,105,111,110,100,111,99,117,109,101
+,110,116,97,114,121,105,110,32,111,114,100,101,114,32,116,111,34,62,10,60,104,
+101,97,100,62,10,60,34,32,104,101,105,103,104,116,61,34,49,97,99,114,111,115,115
+,32,116,104,101,32,111,114,105,101,110,116,97,116,105,111,110,41,59,60,47,115,99
+,114,105,112,116,62,105,109,112,108,101,109,101,110,116,101,100,99,97,110,32,98,
+101,32,115,101,101,110,116,104,101,114,101,32,119,97,115,32,97,100,101,109,111,
+110,115,116,114,97,116,101,99,111,110,116,97,105,110,101,114,34,62,99,111,110,
+110,101,99,116,105,111,110,115,116,104,101,32,66,114,105,116,105,115,104,119,97,
+115,32,119,114,105,116,116,101,110,33,105,109,112,111,114,116,97,110,116,59,112,
+120,59,32,109,97,114,103,105,110,45,102,111,108,108,111,119,101,100,32,98,121,97
+,98,105,108,105,116,121,32,116,111,32,99,111,109,112,108,105,99,97,116,101,100,
+100,117,114,105,110,103,32,116,104,101,32,105,109,109,105,103,114,97,116,105,111
+,110,97,108,115,111,32,99,97,108,108,101,100,60,104,52,32,99,108,97,115,115,61,
+34,100,105,115,116,105,110,99,116,105,111,110,114,101,112,108,97,99,101,100,32,
+98,121,103,111,118,101,114,110,109,101,110,116,115,108,111,99,97,116,105,111,110
+,32,111,102,105,110,32,78,111,118,101,109,98,101,114,119,104,101,116,104,101,114
+,32,116,104,101,60,47,112,62,10,60,47,100,105,118,62,97,99,113,117,105,115,105,
+116,105,111,110,99,97,108,108,101,100,32,116,104,101,32,112,101,114,115,101,99,
+117,116,105,111,110,100,101,115,105,103,110,97,116,105,111,110,123,102,111,110,
+116,45,115,105,122,101,58,97,112,112,101,97,114,101,100,32,105,110,105,110,118,
+101,115,116,105,103,97,116,101,101,120,112,101,114,105,101,110,99,101,100,109,
+111,115,116,32,108,105,107,101,108,121,119,105,100,101,108,121,32,117,115,101,
+100,100,105,115,99,117,115,115,105,111,110,115,112,114,101,115,101,110,99,101,32
+,111,102,32,40,100,111,99,117,109,101,110,116,46,101,120,116,101,110,115,105,118
+,101,108,121,73,116,32,104,97,115,32,98,101,101,110,105,116,32,100,111,101,115,
+32,110,111,116,99,111,110,116,114,97,114,121,32,116,111,105,110,104,97,98,105,
+116,97,110,116,115,105,109,112,114,111,118,101,109,101,110,116,115,99,104,111,
+108,97,114,115,104,105,112,99,111,110,115,117,109,112,116,105,111,110,105,110,
+115,116,114,117,99,116,105,111,110,102,111,114,32,101,120,97,109,112,108,101,111
+,110,101,32,111,114,32,109,111,114,101,112,120,59,32,112,97,100,100,105,110,103,
+116,104,101,32,99,117,114,114,101,110,116,97,32,115,101,114,105,101,115,32,111,
+102,97,114,101,32,117,115,117,97,108,108,121,114,111,108,101,32,105,110,32,116,
+104,101,112,114,101,118,105,111,117,115,108,121,32,100,101,114,105,118,97,116,
+105,118,101,115,101,118,105,100,101,110,99,101,32,111,102,101,120,112,101,114,
+105,101,110,99,101,115,99,111,108,111,114,115,99,104,101,109,101,115,116,97,116,
+101,100,32,116,104,97,116,99,101,114,116,105,102,105,99,97,116,101,60,47,97,62,
+60,47,100,105,118,62,10,32,115,101,108,101,99,116,101,100,61,34,104,105,103,104,
+32,115,99,104,111,111,108,114,101,115,112,111,110,115,101,32,116,111,99,111,109,
+102,111,114,116,97,98,108,101,97,100,111,112,116,105,111,110,32,111,102,116,104,
+114,101,101,32,121,101,97,114,115,116,104,101,32,99,111,117,110,116,114,121,105,
+110,32,70,101,98,114,117,97,114,121,115,111,32,116,104,97,116,32,116,104,101,112
+,101,111,112,108,101,32,119,104,111,32,112,114,111,118,105,100,101,100,32,98,121
+,60,112,97,114,97,109,32,110,97,109,101,97,102,102,101,99,116,101,100,32,98,121,
+105,110,32,116,101,114,109,115,32,111,102,97,112,112,111,105,110,116,109,101,110
+,116,73,83,79,45,56,56,53,57,45,49,34,119,97,115,32,98,111,114,110,32,105,110,
+104,105,115,116,111,114,105,99,97,108,32,114,101,103,97,114,100,101,100,32,97,
+115,109,101,97,115,117,114,101,109,101,110,116,105,115,32,98,97,115,101,100,32,
+111,110,32,97,110,100,32,111,116,104,101,114,32,58,32,102,117,110,99,116,105,111
+,110,40,115,105,103,110,105,102,105,99,97,110,116,99,101,108,101,98,114,97,116,
+105,111,110,116,114,97,110,115,109,105,116,116,101,100,47,106,115,47,106,113,117
+,101,114,121,46,105,115,32,107,110,111,119,110,32,97,115,116,104,101,111,114,101
+,116,105,99,97,108,32,116,97,98,105,110,100,101,120,61,34,105,116,32,99,111,117,
+108,100,32,98,101,60,110,111,115,99,114,105,112,116,62,10,104,97,118,105,110,103
+,32,98,101,101,110,13,10,60,104,101,97,100,62,13,10,60,32,38,113,117,111,116,59,
+84,104,101,32,99,111,109,112,105,108,97,116,105,111,110,104,101,32,104,97,100,32
+,98,101,101,110,112,114,111,100,117,99,101,100,32,98,121,112,104,105,108,111,115
+,111,112,104,101,114,99,111,110,115,116,114,117,99,116,101,100,105,110,116,101,
+110,100,101,100,32,116,111,97,109,111,110,103,32,111,116,104,101,114,99,111,109,
+112,97,114,101,100,32,116,111,116,111,32,115,97,121,32,116,104,97,116,69,110,103
+,105,110,101,101,114,105,110,103,97,32,100,105,102,102,101,114,101,110,116,114,
+101,102,101,114,114,101,100,32,116,111,100,105,102,102,101,114,101,110,99,101,
+115,98,101,108,105,101,102,32,116,104,97,116,112,104,111,116,111,103,114,97,112,
+104,115,105,100,101,110,116,105,102,121,105,110,103,72,105,115,116,111,114,121,
+32,111,102,32,82,101,112,117,98,108,105,99,32,111,102,110,101,99,101,115,115,97,
+114,105,108,121,112,114,111,98,97,98,105,108,105,116,121,116,101,99,104,110,105,
+99,97,108,108,121,108,101,97,118,105,110,103,32,116,104,101,115,112,101,99,116,
+97,99,117,108,97,114,102,114,97,99,116,105,111,110,32,111,102,101,108,101,99,116
+,114,105,99,105,116,121,104,101,97,100,32,111,102,32,116,104,101,114,101,115,116
+,97,117,114,97,110,116,115,112,97,114,116,110,101,114,115,104,105,112,101,109,
+112,104,97,115,105,115,32,111,110,109,111,115,116,32,114,101,99,101,110,116,115,
+104,97,114,101,32,119,105,116,104,32,115,97,121,105,110,103,32,116,104,97,116,
+102,105,108,108,101,100,32,119,105,116,104,100,101,115,105,103,110,101,100,32,
+116,111,105,116,32,105,115,32,111,102,116,101,110,34,62,60,47,105,102,114,97,109
+,101,62,97,115,32,102,111,108,108,111,119,115,58,109,101,114,103,101,100,32,119,
+105,116,104,116,104,114,111,117,103,104,32,116,104,101,99,111,109,109,101,114,99
+,105,97,108,32,112,111,105,110,116,101,100,32,111,117,116,111,112,112,111,114,
+116,117,110,105,116,121,118,105,101,119,32,111,102,32,116,104,101,114,101,113,
+117,105,114,101,109,101,110,116,100,105,118,105,115,105,111,110,32,111,102,112,
+114,111,103,114,97,109,109,105,110,103,104,101,32,114,101,99,101,105,118,101,100
+,115,101,116,73,110,116,101,114,118,97,108,34,62,60,47,115,112,97,110,62,60,47,
+105,110,32,78,101,119,32,89,111,114,107,97,100,100,105,116,105,111,110,97,108,32
+,99,111,109,112,114,101,115,115,105,111,110,10,10,60,100,105,118,32,105,100,61,
+34,105,110,99,111,114,112,111,114,97,116,101,59,60,47,115,99,114,105,112,116,62,
+60,97,116,116,97,99,104,69,118,101,110,116,98,101,99,97,109,101,32,116,104,101,
+32,34,32,116,97,114,103,101,116,61,34,95,99,97,114,114,105,101,100,32,111,117,
+116,83,111,109,101,32,111,102,32,116,104,101,115,99,105,101,110,99,101,32,97,110
+,100,116,104,101,32,116,105,109,101,32,111,102,67,111,110,116,97,105,110,101,114
+,34,62,109,97,105,110,116,97,105,110,105,110,103,67,104,114,105,115,116,111,112,
+104,101,114,77,117,99,104,32,111,102,32,116,104,101,119,114,105,116,105,110,103,
+115,32,111,102,34,32,104,101,105,103,104,116,61,34,50,115,105,122,101,32,111,102
+,32,116,104,101,118,101,114,115,105,111,110,32,111,102,32,109,105,120,116,117,
+114,101,32,111,102,32,98,101,116,119,101,101,110,32,116,104,101,69,120,97,109,
+112,108,101,115,32,111,102,101,100,117,99,97,116,105,111,110,97,108,99,111,109,
+112,101,116,105,116,105,118,101,32,111,110,115,117,98,109,105,116,61,34,100,105,
+114,101,99,116,111,114,32,111,102,100,105,115,116,105,110,99,116,105,118,101,47,
+68,84,68,32,88,72,84,77,76,32,114,101,108,97,116,105,110,103,32,116,111,116,101,
+110,100,101,110,99,121,32,116,111,112,114,111,118,105,110,99,101,32,111,102,119,
+104,105,99,104,32,119,111,117,108,100,100,101,115,112,105,116,101,32,116,104,101
+,115,99,105,101,110,116,105,102,105,99,32,108,101,103,105,115,108,97,116,117,114
+,101,46,105,110,110,101,114,72,84,77,76,32,97,108,108,101,103,97,116,105,111,110
+,115,65,103,114,105,99,117,108,116,117,114,101,119,97,115,32,117,115,101,100,32,
+105,110,97,112,112,114,111,97,99,104,32,116,111,105,110,116,101,108,108,105,103,
+101,110,116,121,101,97,114,115,32,108,97,116,101,114,44,115,97,110,115,45,115,
+101,114,105,102,100,101,116,101,114,109,105,110,105,110,103,80,101,114,102,111,
+114,109,97,110,99,101,97,112,112,101,97,114,97,110,99,101,115,44,32,119,104,105,
+99,104,32,105,115,32,102,111,117,110,100,97,116,105,111,110,115,97,98,98,114,101
+,118,105,97,116,101,100,104,105,103,104,101,114,32,116,104,97,110,115,32,102,114
+,111,109,32,116,104,101,32,105,110,100,105,118,105,100,117,97,108,32,99,111,109,
+112,111,115,101,100,32,111,102,115,117,112,112,111,115,101,100,32,116,111,99,108
+,97,105,109,115,32,116,104,97,116,97,116,116,114,105,98,117,116,105,111,110,102,
+111,110,116,45,115,105,122,101,58,49,101,108,101,109,101,110,116,115,32,111,102,
+72,105,115,116,111,114,105,99,97,108,32,104,105,115,32,98,114,111,116,104,101,
+114,97,116,32,116,104,101,32,116,105,109,101,97,110,110,105,118,101,114,115,97,
+114,121,103,111,118,101,114,110,101,100,32,98,121,114,101,108,97,116,101,100,32,
+116,111,32,117,108,116,105,109,97,116,101,108,121,32,105,110,110,111,118,97,116,
+105,111,110,115,105,116,32,105,115,32,115,116,105,108,108,99,97,110,32,111,110,
+108,121,32,98,101,100,101,102,105,110,105,116,105,111,110,115,116,111,71,77,84,
+83,116,114,105,110,103,65,32,110,117,109,98,101,114,32,111,102,105,109,103,32,99
+,108,97,115,115,61,34,69,118,101,110,116,117,97,108,108,121,44,119,97,115,32,99,
+104,97,110,103,101,100,111,99,99,117,114,114,101,100,32,105,110,110,101,105,103,
+104,98,111,114,105,110,103,100,105,115,116,105,110,103,117,105,115,104,119,104,
+101,110,32,104,101,32,119,97,115,105,110,116,114,111,100,117,99,105,110,103,116,
+101,114,114,101,115,116,114,105,97,108,77,97,110,121,32,111,102,32,116,104,101,
+97,114,103,117,101,115,32,116,104,97,116,97,110,32,65,109,101,114,105,99,97,110,
+99,111,110,113,117,101,115,116,32,111,102,119,105,100,101,115,112,114,101,97,100
+,32,119,101,114,101,32,107,105,108,108,101,100,115,99,114,101,101,110,32,97,110,
+100,32,73,110,32,111,114,100,101,114,32,116,111,101,120,112,101,99,116,101,100,
+32,116,111,100,101,115,99,101,110,100,97,110,116,115,97,114,101,32,108,111,99,97
+,116,101,100,108,101,103,105,115,108,97,116,105,118,101,103,101,110,101,114,97,
+116,105,111,110,115,32,98,97,99,107,103,114,111,117,110,100,109,111,115,116,32,
+112,101,111,112,108,101,121,101,97,114,115,32,97,102,116,101,114,116,104,101,114
+,101,32,105,115,32,110,111,116,104,101,32,104,105,103,104,101,115,116,102,114,
+101,113,117,101,110,116,108,121,32,116,104,101,121,32,100,111,32,110,111,116,97,
+114,103,117,101,100,32,116,104,97,116,115,104,111,119,101,100,32,116,104,97,116,
+112,114,101,100,111,109,105,110,97,110,116,116,104,101,111,108,111,103,105,99,97
+,108,98,121,32,116,104,101,32,116,105,109,101,99,111,110,115,105,100,101,114,105
+,110,103,115,104,111,114,116,45,108,105,118,101,100,60,47,115,112,97,110,62,60,
+47,97,62,99,97,110,32,98,101,32,117,115,101,100,118,101,114,121,32,108,105,116,
+116,108,101,111,110,101,32,111,102,32,116,104,101,32,104,97,100,32,97,108,114,
+101,97,100,121,105,110,116,101,114,112,114,101,116,101,100,99,111,109,109,117,
+110,105,99,97,116,101,102,101,97,116,117,114,101,115,32,111,102,103,111,118,101,
+114,110,109,101,110,116,44,60,47,110,111,115,99,114,105,112,116,62,101,110,116,
+101,114,101,100,32,116,104,101,34,32,104,101,105,103,104,116,61,34,51,73,110,100
+,101,112,101,110,100,101,110,116,112,111,112,117,108,97,116,105,111,110,115,108,
+97,114,103,101,45,115,99,97,108,101,46,32,65,108,116,104,111,117,103,104,32,117,
+115,101,100,32,105,110,32,116,104,101,100,101,115,116,114,117,99,116,105,111,110
+,112,111,115,115,105,98,105,108,105,116,121,115,116,97,114,116,105,110,103,32,
+105,110,116,119,111,32,111,114,32,109,111,114,101,101,120,112,114,101,115,115,
+105,111,110,115,115,117,98,111,114,100,105,110,97,116,101,108,97,114,103,101,114
+,32,116,104,97,110,104,105,115,116,111,114,121,32,97,110,100,60,47,111,112,116,
+105,111,110,62,13,10,67,111,110,116,105,110,101,110,116,97,108,101,108,105,109,
+105,110,97,116,105,110,103,119,105,108,108,32,110,111,116,32,98,101,112,114,97,
+99,116,105,99,101,32,111,102,105,110,32,102,114,111,110,116,32,111,102,115,105,
+116,101,32,111,102,32,116,104,101,101,110,115,117,114,101,32,116,104,97,116,116,
+111,32,99,114,101,97,116,101,32,97,109,105,115,115,105,115,115,105,112,112,105,
+112,111,116,101,110,116,105,97,108,108,121,111,117,116,115,116,97,110,100,105,
+110,103,98,101,116,116,101,114,32,116,104,97,110,119,104,97,116,32,105,115,32,
+110,111,119,115,105,116,117,97,116,101,100,32,105,110,109,101,116,97,32,110,97,
+109,101,61,34,84,114,97,100,105,116,105,111,110,97,108,115,117,103,103,101,115,
+116,105,111,110,115,84,114,97,110,115,108,97,116,105,111,110,116,104,101,32,102,
+111,114,109,32,111,102,97,116,109,111,115,112,104,101,114,105,99,105,100,101,111
+,108,111,103,105,99,97,108,101,110,116,101,114,112,114,105,115,101,115,99,97,108
+,99,117,108,97,116,105,110,103,101,97,115,116,32,111,102,32,116,104,101,114,101,
+109,110,97,110,116,115,32,111,102,112,108,117,103,105,110,115,112,97,103,101,47,
+105,110,100,101,120,46,112,104,112,63,114,101,109,97,105,110,101,100,32,105,110,
+116,114,97,110,115,102,111,114,109,101,100,72,101,32,119,97,115,32,97,108,115,
+111,119,97,115,32,97,108,114,101,97,100,121,115,116,97,116,105,115,116,105,99,97
+,108,105,110,32,102,97,118,111,114,32,111,102,77,105,110,105,115,116,114,121,32,
+111,102,109,111,118,101,109,101,110,116,32,111,102,102,111,114,109,117,108,97,
+116,105,111,110,105,115,32,114,101,113,117,105,114,101,100,60,108,105,110,107,32
+,114,101,108,61,34,84,104,105,115,32,105,115,32,116,104,101,32,60,97,32,104,114,
+101,102,61,34,47,112,111,112,117,108,97,114,105,122,101,100,105,110,118,111,108,
+118,101,100,32,105,110,97,114,101,32,117,115,101,100,32,116,111,97,110,100,32,
+115,101,118,101,114,97,108,109,97,100,101,32,98,121,32,116,104,101,115,101,101,
+109,115,32,116,111,32,98,101,108,105,107,101,108,121,32,116,104,97,116,80,97,108
+,101,115,116,105,110,105,97,110,110,97,109,101,100,32,97,102,116,101,114,105,116
+,32,104,97,100,32,98,101,101,110,109,111,115,116,32,99,111,109,109,111,110,116,
+111,32,114,101,102,101,114,32,116,111,98,117,116,32,116,104,105,115,32,105,115,
+99,111,110,115,101,99,117,116,105,118,101,116,101,109,112,111,114,97,114,105,108
+,121,73,110,32,103,101,110,101,114,97,108,44,99,111,110,118,101,110,116,105,111,
+110,115,116,97,107,101,115,32,112,108,97,99,101,115,117,98,100,105,118,105,115,
+105,111,110,116,101,114,114,105,116,111,114,105,97,108,111,112,101,114,97,116,
+105,111,110,97,108,112,101,114,109,97,110,101,110,116,108,121,119,97,115,32,108,
+97,114,103,101,108,121,111,117,116,98,114,101,97,107,32,111,102,105,110,32,116,
+104,101,32,112,97,115,116,102,111,108,108,111,119,105,110,103,32,97,32,120,109,
+108,110,115,58,111,103,61,34,62,60,97,32,99,108,97,115,115,61,34,99,108,97,115,
+115,61,34,116,101,120,116,67,111,110,118,101,114,115,105,111,110,32,109,97,121,
+32,98,101,32,117,115,101,100,109,97,110,117,102,97,99,116,117,114,101,97,102,116
+,101,114,32,98,101,105,110,103,99,108,101,97,114,102,105,120,34,62,10,113,117,
+101,115,116,105,111,110,32,111,102,119,97,115,32,101,108,101,99,116,101,100,116,
+111,32,98,101,99,111,109,101,32,97,98,101,99,97,117,115,101,32,111,102,32,115,
+111,109,101,32,112,101,111,112,108,101,105,110,115,112,105,114,101,100,32,98,121
+,115,117,99,99,101,115,115,102,117,108,32,97,32,116,105,109,101,32,119,104,101,
+110,109,111,114,101,32,99,111,109,109,111,110,97,109,111,110,103,115,116,32,116,
+104,101,97,110,32,111,102,102,105,99,105,97,108,119,105,100,116,104,58,49,48,48,
+37,59,116,101,99,104,110,111,108,111,103,121,44,119,97,115,32,97,100,111,112,116
+,101,100,116,111,32,107,101,101,112,32,116,104,101,115,101,116,116,108,101,109,
+101,110,116,115,108,105,118,101,32,98,105,114,116,104,115,105,110,100,101,120,46
+,104,116,109,108,34,67,111,110,110,101,99,116,105,99,117,116,97,115,115,105,103,
+110,101,100,32,116,111,38,97,109,112,59,116,105,109,101,115,59,97,99,99,111,117,
+110,116,32,102,111,114,97,108,105,103,110,61,114,105,103,104,116,116,104,101,32,
+99,111,109,112,97,110,121,97,108,119,97,121,115,32,98,101,101,110,114,101,116,
+117,114,110,101,100,32,116,111,105,110,118,111,108,118,101,109,101,110,116,66,
+101,99,97,117,115,101,32,116,104,101,116,104,105,115,32,112,101,114,105,111,100,
+34,32,110,97,109,101,61,34,113,34,32,99,111,110,102,105,110,101,100,32,116,111,
+97,32,114,101,115,117,108,116,32,111,102,118,97,108,117,101,61,34,34,32,47,62,
+105,115,32,97,99,116,117,97,108,108,121,69,110,118,105,114,111,110,109,101,110,
+116,13,10,60,47,104,101,97,100,62,13,10,67,111,110,118,101,114,115,101,108,121,
+44,62,10,60,100,105,118,32,105,100,61,34,48,34,32,119,105,100,116,104,61,34,49,
+105,115,32,112,114,111,98,97,98,108,121,104,97,118,101,32,98,101,99,111,109,101,
+99,111,110,116,114,111,108,108,105,110,103,116,104,101,32,112,114,111,98,108,101
+,109,99,105,116,105,122,101,110,115,32,111,102,112,111,108,105,116,105,99,105,97
+,110,115,114,101,97,99,104,101,100,32,116,104,101,97,115,32,101,97,114,108,121,
+32,97,115,58,110,111,110,101,59,32,111,118,101,114,60,116,97,98,108,101,32,99,
+101,108,108,118,97,108,105,100,105,116,121,32,111,102,100,105,114,101,99,116,108
+,121,32,116,111,111,110,109,111,117,115,101,100,111,119,110,119,104,101,114,101,
+32,105,116,32,105,115,119,104,101,110,32,105,116,32,119,97,115,109,101,109,98,
+101,114,115,32,111,102,32,114,101,108,97,116,105,111,110,32,116,111,97,99,99,111
+,109,109,111,100,97,116,101,97,108,111,110,103,32,119,105,116,104,32,73,110,32,
+116,104,101,32,108,97,116,101,116,104,101,32,69,110,103,108,105,115,104,100,101,
+108,105,99,105,111,117,115,34,62,116,104,105,115,32,105,115,32,110,111,116,116,
+104,101,32,112,114,101,115,101,110,116,105,102,32,116,104,101,121,32,97,114,101,
+97,110,100,32,102,105,110,97,108,108,121,97,32,109,97,116,116,101,114,32,111,102
+,13,10,9,60,47,100,105,118,62,13,10,13,10,60,47,115,99,114,105,112,116,62,102,97
+,115,116,101,114,32,116,104,97,110,109,97,106,111,114,105,116,121,32,111,102,97,
+102,116,101,114,32,119,104,105,99,104,99,111,109,112,97,114,97,116,105,118,101,
+116,111,32,109,97,105,110,116,97,105,110,105,109,112,114,111,118,101,32,116,104,
+101,97,119,97,114,100,101,100,32,116,104,101,101,114,34,32,99,108,97,115,115,61,
+34,102,114,97,109,101,98,111,114,100,101,114,114,101,115,116,111,114,97,116,105,
+111,110,105,110,32,116,104,101,32,115,97,109,101,97,110,97,108,121,115,105,115,
+32,111,102,116,104,101,105,114,32,102,105,114,115,116,68,117,114,105,110,103,32,
+116,104,101,32,99,111,110,116,105,110,101,110,116,97,108,115,101,113,117,101,110
+,99,101,32,111,102,102,117,110,99,116,105,111,110,40,41,123,102,111,110,116,45,
+115,105,122,101,58,32,119,111,114,107,32,111,110,32,116,104,101,60,47,115,99,114
+,105,112,116,62,10,60,98,101,103,105,110,115,32,119,105,116,104,106,97,118,97,
+115,99,114,105,112,116,58,99,111,110,115,116,105,116,117,101,110,116,119,97,115,
+32,102,111,117,110,100,101,100,101,113,117,105,108,105,98,114,105,117,109,97,115
+,115,117,109,101,32,116,104,97,116,105,115,32,103,105,118,101,110,32,98,121,110,
+101,101,100,115,32,116,111,32,98,101,99,111,111,114,100,105,110,97,116,101,115,
+116,104,101,32,118,97,114,105,111,117,115,97,114,101,32,112,97,114,116,32,111,
+102,111,110,108,121,32,105,110,32,116,104,101,115,101,99,116,105,111,110,115,32,
+111,102,105,115,32,97,32,99,111,109,109,111,110,116,104,101,111,114,105,101,115,
+32,111,102,100,105,115,99,111,118,101,114,105,101,115,97,115,115,111,99,105,97,
+116,105,111,110,101,100,103,101,32,111,102,32,116,104,101,115,116,114,101,110,
+103,116,104,32,111,102,112,111,115,105,116,105,111,110,32,105,110,112,114,101,
+115,101,110,116,45,100,97,121,117,110,105,118,101,114,115,97,108,108,121,116,111
+,32,102,111,114,109,32,116,104,101,98,117,116,32,105,110,115,116,101,97,100,99,
+111,114,112,111,114,97,116,105,111,110,97,116,116,97,99,104,101,100,32,116,111,
+105,115,32,99,111,109,109,111,110,108,121,114,101,97,115,111,110,115,32,102,111,
+114,32,38,113,117,111,116,59,116,104,101,32,99,97,110,32,98,101,32,109,97,100,
+101,119,97,115,32,97,98,108,101,32,116,111,119,104,105,99,104,32,109,101,97,110,
+115,98,117,116,32,100,105,100,32,110,111,116,111,110,77,111,117,115,101,79,118,
+101,114,97,115,32,112,111,115,115,105,98,108,101,111,112,101,114,97,116,101,100,
+32,98,121,99,111,109,105,110,103,32,102,114,111,109,116,104,101,32,112,114,105,
+109,97,114,121,97,100,100,105,116,105,111,110,32,111,102,102,111,114,32,115,101,
+118,101,114,97,108,116,114,97,110,115,102,101,114,114,101,100,97,32,112,101,114,
+105,111,100,32,111,102,97,114,101,32,97,98,108,101,32,116,111,104,111,119,101,
+118,101,114,44,32,105,116,115,104,111,117,108,100,32,104,97,118,101,109,117,99,
+104,32,108,97,114,103,101,114,10,9,60,47,115,99,114,105,112,116,62,97,100,111,
+112,116,101,100,32,116,104,101,112,114,111,112,101,114,116,121,32,111,102,100,
+105,114,101,99,116,101,100,32,98,121,101,102,102,101,99,116,105,118,101,108,121,
+119,97,115,32,98,114,111,117,103,104,116,99,104,105,108,100,114,101,110,32,111,
+102,80,114,111,103,114,97,109,109,105,110,103,108,111,110,103,101,114,32,116,104
+,97,110,109,97,110,117,115,99,114,105,112,116,115,119,97,114,32,97,103,97,105,
+110,115,116,98,121,32,109,101,97,110,115,32,111,102,97,110,100,32,109,111,115,
+116,32,111,102,115,105,109,105,108,97,114,32,116,111,32,112,114,111,112,114,105,
+101,116,97,114,121,111,114,105,103,105,110,97,116,105,110,103,112,114,101,115,
+116,105,103,105,111,117,115,103,114,97,109,109,97,116,105,99,97,108,101,120,112,
+101,114,105,101,110,99,101,46,116,111,32,109,97,107,101,32,116,104,101,73,116,32
+,119,97,115,32,97,108,115,111,105,115,32,102,111,117,110,100,32,105,110,99,111,
+109,112,101,116,105,116,111,114,115,105,110,32,116,104,101,32,85,46,83,46,114,
+101,112,108,97,99,101,32,116,104,101,98,114,111,117,103,104,116,32,116,104,101,
+99,97,108,99,117,108,97,116,105,111,110,102,97,108,108,32,111,102,32,116,104,101
+,116,104,101,32,103,101,110,101,114,97,108,112,114,97,99,116,105,99,97,108,108,
+121,105,110,32,104,111,110,111,114,32,111,102,114,101,108,101,97,115,101,100,32,
+105,110,114,101,115,105,100,101,110,116,105,97,108,97,110,100,32,115,111,109,101
+,32,111,102,107,105,110,103,32,111,102,32,116,104,101,114,101,97,99,116,105,111,
+110,32,116,111,49,115,116,32,69,97,114,108,32,111,102,99,117,108,116,117,114,101
+,32,97,110,100,112,114,105,110,99,105,112,97,108,108,121,60,47,116,105,116,108,
+101,62,10,32,32,116,104,101,121,32,99,97,110,32,98,101,98,97,99,107,32,116,111,
+32,116,104,101,115,111,109,101,32,111,102,32,104,105,115,101,120,112,111,115,117
+,114,101,32,116,111,97,114,101,32,115,105,109,105,108,97,114,102,111,114,109,32,
+111,102,32,116,104,101,97,100,100,70,97,118,111,114,105,116,101,99,105,116,105,
+122,101,110,115,104,105,112,112,97,114,116,32,105,110,32,116,104,101,112,101,111
+,112,108,101,32,119,105,116,104,105,110,32,112,114,97,99,116,105,99,101,116,111,
+32,99,111,110,116,105,110,117,101,38,97,109,112,59,109,105,110,117,115,59,97,112
+,112,114,111,118,101,100,32,98,121,32,116,104,101,32,102,105,114,115,116,32,97,
+108,108,111,119,101,100,32,116,104,101,97,110,100,32,102,111,114,32,116,104,101,
+102,117,110,99,116,105,111,110,105,110,103,112,108,97,121,105,110,103,32,116,104
+,101,115,111,108,117,116,105,111,110,32,116,111,104,101,105,103,104,116,61,34,48
+,34,32,105,110,32,104,105,115,32,98,111,111,107,109,111,114,101,32,116,104,97,
+110,32,97,102,111,108,108,111,119,115,32,116,104,101,99,114,101,97,116,101,100,
+32,116,104,101,112,114,101,115,101,110,99,101,32,105,110,38,110,98,115,112,59,60
+,47,116,100,62,110,97,116,105,111,110,97,108,105,115,116,116,104,101,32,105,100,
+101,97,32,111,102,97,32,99,104,97,114,97,99,116,101,114,119,101,114,101,32,102,
+111,114,99,101,100,32,99,108,97,115,115,61,34,98,116,110,100,97,121,115,32,111,
+102,32,116,104,101,102,101,97,116,117,114,101,100,32,105,110,115,104,111,119,105
+,110,103,32,116,104,101,105,110,116,101,114,101,115,116,32,105,110,105,110,32,
+112,108,97,99,101,32,111,102,116,117,114,110,32,111,102,32,116,104,101,116,104,
+101,32,104,101,97,100,32,111,102,76,111,114,100,32,111,102,32,116,104,101,112,
+111,108,105,116,105,99,97,108,108,121,104,97,115,32,105,116,115,32,111,119,110,
+69,100,117,99,97,116,105,111,110,97,108,97,112,112,114,111,118,97,108,32,111,102
+,115,111,109,101,32,111,102,32,116,104,101,101,97,99,104,32,111,116,104,101,114,
+44,98,101,104,97,118,105,111,114,32,111,102,97,110,100,32,98,101,99,97,117,115,
+101,97,110,100,32,97,110,111,116,104,101,114,97,112,112,101,97,114,101,100,32,
+111,110,114,101,99,111,114,100,101,100,32,105,110,98,108,97,99,107,38,113,117,
+111,116,59,109,97,121,32,105,110,99,108,117,100,101,116,104,101,32,119,111,114,
+108,100,39,115,99,97,110,32,108,101,97,100,32,116,111,114,101,102,101,114,115,32
+,116,111,32,97,98,111,114,100,101,114,61,34,48,34,32,103,111,118,101,114,110,109
+,101,110,116,32,119,105,110,110,105,110,103,32,116,104,101,114,101,115,117,108,
+116,101,100,32,105,110,32,119,104,105,108,101,32,116,104,101,32,87,97,115,104,
+105,110,103,116,111,110,44,116,104,101,32,115,117,98,106,101,99,116,99,105,116,
+121,32,105,110,32,116,104,101,62,60,47,100,105,118,62,13,10,9,9,114,101,102,108,
+101,99,116,32,116,104,101,116,111,32,99,111,109,112,108,101,116,101,98,101,99,97
+,109,101,32,109,111,114,101,114,97,100,105,111,97,99,116,105,118,101,114,101,106
+,101,99,116,101,100,32,98,121,119,105,116,104,111,117,116,32,97,110,121,104,105,
+115,32,102,97,116,104,101,114,44,119,104,105,99,104,32,99,111,117,108,100,99,111
+,112,121,32,111,102,32,116,104,101,116,111,32,105,110,100,105,99,97,116,101,97,
+32,112,111,108,105,116,105,99,97,108,97,99,99,111,117,110,116,115,32,111,102,99,
+111,110,115,116,105,116,117,116,101,115,119,111,114,107,101,100,32,119,105,116,
+104,101,114,60,47,97,62,60,47,108,105,62,111,102,32,104,105,115,32,108,105,102,
+101,97,99,99,111,109,112,97,110,105,101,100,99,108,105,101,110,116,87,105,100,
+116,104,112,114,101,118,101,110,116,32,116,104,101,76,101,103,105,115,108,97,116
+,105,118,101,100,105,102,102,101,114,101,110,116,108,121,116,111,103,101,116,104
+,101,114,32,105,110,104,97,115,32,115,101,118,101,114,97,108,102,111,114,32,97,
+110,111,116,104,101,114,116,101,120,116,32,111,102,32,116,104,101,102,111,117,
+110,100,101,100,32,116,104,101,101,32,119,105,116,104,32,116,104,101,32,105,115,
+32,117,115,101,100,32,102,111,114,99,104,97,110,103,101,100,32,116,104,101,117,
+115,117,97,108,108,121,32,116,104,101,112,108,97,99,101,32,119,104,101,114,101,
+119,104,101,114,101,97,115,32,116,104,101,62,32,60,97,32,104,114,101,102,61,34,
+34,62,60,97,32,104,114,101,102,61,34,116,104,101,109,115,101,108,118,101,115,44,
+97,108,116,104,111,117,103,104,32,104,101,116,104,97,116,32,99,97,110,32,98,101,
+116,114,97,100,105,116,105,111,110,97,108,114,111,108,101,32,111,102,32,116,104,
+101,97,115,32,97,32,114,101,115,117,108,116,114,101,109,111,118,101,67,104,105,
+108,100,100,101,115,105,103,110,101,100,32,98,121,119,101,115,116,32,111,102,32,
+116,104,101,83,111,109,101,32,112,101,111,112,108,101,112,114,111,100,117,99,116
+,105,111,110,44,115,105,100,101,32,111,102,32,116,104,101,110,101,119,115,108,
+101,116,116,101,114,115,117,115,101,100,32,98,121,32,116,104,101,100,111,119,110
+,32,116,111,32,116,104,101,97,99,99,101,112,116,101,100,32,98,121,108,105,118,
+101,32,105,110,32,116,104,101,97,116,116,101,109,112,116,115,32,116,111,111,117,
+116,115,105,100,101,32,116,104,101,102,114,101,113,117,101,110,99,105,101,115,72
+,111,119,101,118,101,114,44,32,105,110,112,114,111,103,114,97,109,109,101,114,
+115,97,116,32,108,101,97,115,116,32,105,110,97,112,112,114,111,120,105,109,97,
+116,101,97,108,116,104,111,117,103,104,32,105,116,119,97,115,32,112,97,114,116,
+32,111,102,97,110,100,32,118,97,114,105,111,117,115,71,111,118,101,114,110,111,
+114,32,111,102,116,104,101,32,97,114,116,105,99,108,101,116,117,114,110,101,100,
+32,105,110,116,111,62,60,97,32,104,114,101,102,61,34,47,116,104,101,32,101,99,
+111,110,111,109,121,105,115,32,116,104,101,32,109,111,115,116,109,111,115,116,32
+,119,105,100,101,108,121,119,111,117,108,100,32,108,97,116,101,114,97,110,100,32
+,112,101,114,104,97,112,115,114,105,115,101,32,116,111,32,116,104,101,111,99,99,
+117,114,115,32,119,104,101,110,117,110,100,101,114,32,119,104,105,99,104,99,111,
+110,100,105,116,105,111,110,115,46,116,104,101,32,119,101,115,116,101,114,110,
+116,104,101,111,114,121,32,116,104,97,116,105,115,32,112,114,111,100,117,99,101,
+100,116,104,101,32,99,105,116,121,32,111,102,105,110,32,119,104,105,99,104,32,
+104,101,115,101,101,110,32,105,110,32,116,104,101,116,104,101,32,99,101,110,116,
+114,97,108,98,117,105,108,100,105,110,103,32,111,102,109,97,110,121,32,111,102,
+32,104,105,115,97,114,101,97,32,111,102,32,116,104,101,105,115,32,116,104,101,32
+,111,110,108,121,109,111,115,116,32,111,102,32,116,104,101,109,97,110,121,32,111
+,102,32,116,104,101,116,104,101,32,87,101,115,116,101,114,110,84,104,101,114,101
+,32,105,115,32,110,111,101,120,116,101,110,100,101,100,32,116,111,83,116,97,116,
+105,115,116,105,99,97,108,99,111,108,115,112,97,110,61,50,32,124,115,104,111,114
+,116,32,115,116,111,114,121,112,111,115,115,105,98,108,101,32,116,111,116,111,
+112,111,108,111,103,105,99,97,108,99,114,105,116,105,99,97,108,32,111,102,114,
+101,112,111,114,116,101,100,32,116,111,97,32,67,104,114,105,115,116,105,97,110,
+100,101,99,105,115,105,111,110,32,116,111,105,115,32,101,113,117,97,108,32,116,
+111,112,114,111,98,108,101,109,115,32,111,102,84,104,105,115,32,99,97,110,32,98,
+101,109,101,114,99,104,97,110,100,105,115,101,102,111,114,32,109,111,115,116,32,
+111,102,110,111,32,101,118,105,100,101,110,99,101,101,100,105,116,105,111,110,
+115,32,111,102,101,108,101,109,101,110,116,115,32,105,110,38,113,117,111,116,59,
+46,32,84,104,101,99,111,109,47,105,109,97,103,101,115,47,119,104,105,99,104,32,
+109,97,107,101,115,116,104,101,32,112,114,111,99,101,115,115,114,101,109,97,105,
+110,115,32,116,104,101,108,105,116,101,114,97,116,117,114,101,44,105,115,32,97,
+32,109,101,109,98,101,114,116,104,101,32,112,111,112,117,108,97,114,116,104,101,
+32,97,110,99,105,101,110,116,112,114,111,98,108,101,109,115,32,105,110,116,105,
+109,101,32,111,102,32,116,104,101,100,101,102,101,97,116,101,100,32,98,121,98,
+111,100,121,32,111,102,32,116,104,101,97,32,102,101,119,32,121,101,97,114,115,
+109,117,99,104,32,111,102,32,116,104,101,116,104,101,32,119,111,114,107,32,111,
+102,67,97,108,105,102,111,114,110,105,97,44,115,101,114,118,101,100,32,97,115,32
+,97,103,111,118,101,114,110,109,101,110,116,46,99,111,110,99,101,112,116,115,32,
+111,102,109,111,118,101,109,101,110,116,32,105,110,9,9,60,100,105,118,32,105,100
+,61,34,105,116,34,32,118,97,108,117,101,61,34,108,97,110,103,117,97,103,101,32,
+111,102,97,115,32,116,104,101,121,32,97,114,101,112,114,111,100,117,99,101,100,
+32,105,110,105,115,32,116,104,97,116,32,116,104,101,101,120,112,108,97,105,110,
+32,116,104,101,100,105,118,62,60,47,100,105,118,62,10,72,111,119,101,118,101,114
+,32,116,104,101,108,101,97,100,32,116,111,32,116,104,101,9,60,97,32,104,114,101,
+102,61,34,47,119,97,115,32,103,114,97,110,116,101,100,112,101,111,112,108,101,32
+,104,97,118,101,99,111,110,116,105,110,117,97,108,108,121,119,97,115,32,115,101,
+101,110,32,97,115,97,110,100,32,114,101,108,97,116,101,100,116,104,101,32,114,
+111,108,101,32,111,102,112,114,111,112,111,115,101,100,32,98,121,111,102,32,116,
+104,101,32,98,101,115,116,101,97,99,104,32,111,116,104,101,114,46,67,111,110,115
+,116,97,110,116,105,110,101,112,101,111,112,108,101,32,102,114,111,109,100,105,
+97,108,101,99,116,115,32,111,102,116,111,32,114,101,118,105,115,105,111,110,119,
+97,115,32,114,101,110,97,109,101,100,97,32,115,111,117,114,99,101,32,111,102,116
+,104,101,32,105,110,105,116,105,97,108,108,97,117,110,99,104,101,100,32,105,110,
+112,114,111,118,105,100,101,32,116,104,101,116,111,32,116,104,101,32,119,101,115
+,116,119,104,101,114,101,32,116,104,101,114,101,97,110,100,32,115,105,109,105,
+108,97,114,98,101,116,119,101,101,110,32,116,119,111,105,115,32,97,108,115,111,
+32,116,104,101,69,110,103,108,105,115,104,32,97,110,100,99,111,110,100,105,116,
+105,111,110,115,44,116,104,97,116,32,105,116,32,119,97,115,101,110,116,105,116,
+108,101,100,32,116,111,116,104,101,109,115,101,108,118,101,115,46,113,117,97,110
+,116,105,116,121,32,111,102,114,97,110,115,112,97,114,101,110,99,121,116,104,101
+,32,115,97,109,101,32,97,115,116,111,32,106,111,105,110,32,116,104,101,99,111,
+117,110,116,114,121,32,97,110,100,116,104,105,115,32,105,115,32,116,104,101,84,
+104,105,115,32,108,101,100,32,116,111,97,32,115,116,97,116,101,109,101,110,116,
+99,111,110,116,114,97,115,116,32,116,111,108,97,115,116,73,110,100,101,120,79,
+102,116,104,114,111,117,103,104,32,104,105,115,105,115,32,100,101,115,105,103,
+110,101,100,116,104,101,32,116,101,114,109,32,105,115,105,115,32,112,114,111,118
+,105,100,101,100,112,114,111,116,101,99,116,32,116,104,101,110,103,60,47,97,62,
+60,47,108,105,62,84,104,101,32,99,117,114,114,101,110,116,116,104,101,32,115,105
+,116,101,32,111,102,115,117,98,115,116,97,110,116,105,97,108,101,120,112,101,114
+,105,101,110,99,101,44,105,110,32,116,104,101,32,87,101,115,116,116,104,101,121,
+32,115,104,111,117,108,100,115,108,111,118,101,110,196,141,105,110,97,99,111,109
+,101,110,116,97,114,105,111,115,117,110,105,118,101,114,115,105,100,97,100,99,
+111,110,100,105,99,105,111,110,101,115,97,99,116,105,118,105,100,97,100,101,115,
+101,120,112,101,114,105,101,110,99,105,97,116,101,99,110,111,108,111,103,195,173
+,97,112,114,111,100,117,99,99,105,195,179,110,112,117,110,116,117,97,99,105,195,
+179,110,97,112,108,105,99,97,99,105,195,179,110,99,111,110,116,114,97,115,101,
+195,177,97,99,97,116,101,103,111,114,195,173,97,115,114,101,103,105,115,116,114,
+97,114,115,101,112,114,111,102,101,115,105,111,110,97,108,116,114,97,116,97,109,
+105,101,110,116,111,114,101,103,195,173,115,116,114,97,116,101,115,101,99,114,
+101,116,97,114,195,173,97,112,114,105,110,99,105,112,97,108,101,115,112,114,111,
+116,101,99,99,105,195,179,110,105,109,112,111,114,116,97,110,116,101,115,105,109
+,112,111,114,116,97,110,99,105,97,112,111,115,105,98,105,108,105,100,97,100,105,
+110,116,101,114,101,115,97,110,116,101,99,114,101,99,105,109,105,101,110,116,111
+,110,101,99,101,115,105,100,97,100,101,115,115,117,115,99,114,105,98,105,114,115
+,101,97,115,111,99,105,97,99,105,195,179,110,100,105,115,112,111,110,105,98,108,
+101,115,101,118,97,108,117,97,99,105,195,179,110,101,115,116,117,100,105,97,110,
+116,101,115,114,101,115,112,111,110,115,97,98,108,101,114,101,115,111,108,117,99
+,105,195,179,110,103,117,97,100,97,108,97,106,97,114,97,114,101,103,105,115,116,
+114,97,100,111,115,111,112,111,114,116,117,110,105,100,97,100,99,111,109,101,114
+,99,105,97,108,101,115,102,111,116,111,103,114,97,102,195,173,97,97,117,116,111,
+114,105,100,97,100,101,115,105,110,103,101,110,105,101,114,195,173,97,116,101,
+108,101,118,105,115,105,195,179,110,99,111,109,112,101,116,101,110,99,105,97,111
+,112,101,114,97,99,105,111,110,101,115,101,115,116,97,98,108,101,99,105,100,111,
+115,105,109,112,108,101,109,101,110,116,101,97,99,116,117,97,108,109,101,110,116
+,101,110,97,118,101,103,97,99,105,195,179,110,99,111,110,102,111,114,109,105,100
+,97,100,108,105,110,101,45,104,101,105,103,104,116,58,102,111,110,116,45,102,97,
+109,105,108,121,58,34,32,58,32,34,104,116,116,112,58,47,47,97,112,112,108,105,99
+,97,116,105,111,110,115,108,105,110,107,34,32,104,114,101,102,61,34,115,112,101,
+99,105,102,105,99,97,108,108,121,47,47,60,33,91,67,68,65,84,65,91,10,79,114,103,
+97,110,105,122,97,116,105,111,110,100,105,115,116,114,105,98,117,116,105,111,110
+,48,112,120,59,32,104,101,105,103,104,116,58,114,101,108,97,116,105,111,110,115,
+104,105,112,100,101,118,105,99,101,45,119,105,100,116,104,60,100,105,118,32,99,
+108,97,115,115,61,34,60,108,97,98,101,108,32,102,111,114,61,34,114,101,103,105,
+115,116,114,97,116,105,111,110,60,47,110,111,115,99,114,105,112,116,62,10,47,105
+,110,100,101,120,46,104,116,109,108,34,119,105,110,100,111,119,46,111,112,101,
+110,40,32,33,105,109,112,111,114,116,97,110,116,59,97,112,112,108,105,99,97,116,
+105,111,110,47,105,110,100,101,112,101,110,100,101,110,99,101,47,47,119,119,119,
+46,103,111,111,103,108,101,111,114,103,97,110,105,122,97,116,105,111,110,97,117,
+116,111,99,111,109,112,108,101,116,101,114,101,113,117,105,114,101,109,101,110,
+116,115,99,111,110,115,101,114,118,97,116,105,118,101,60,102,111,114,109,32,110,
+97,109,101,61,34,105,110,116,101,108,108,101,99,116,117,97,108,109,97,114,103,
+105,110,45,108,101,102,116,58,49,56,116,104,32,99,101,110,116,117,114,121,97,110
+,32,105,109,112,111,114,116,97,110,116,105,110,115,116,105,116,117,116,105,111,
+110,115,97,98,98,114,101,118,105,97,116,105,111,110,60,105,109,103,32,99,108,97,
+115,115,61,34,111,114,103,97,110,105,115,97,116,105,111,110,99,105,118,105,108,
+105,122,97,116,105,111,110,49,57,116,104,32,99,101,110,116,117,114,121,97,114,99
+,104,105,116,101,99,116,117,114,101,105,110,99,111,114,112,111,114,97,116,101,
+100,50,48,116,104,32,99,101,110,116,117,114,121,45,99,111,110,116,97,105,110,101
+,114,34,62,109,111,115,116,32,110,111,116,97,98,108,121,47,62,60,47,97,62,60,47,
+100,105,118,62,110,111,116,105,102,105,99,97,116,105,111,110,39,117,110,100,101,
+102,105,110,101,100,39,41,70,117,114,116,104,101,114,109,111,114,101,44,98,101,
+108,105,101,118,101,32,116,104,97,116,105,110,110,101,114,72,84,77,76,32,61,32,
+112,114,105,111,114,32,116,111,32,116,104,101,100,114,97,109,97,116,105,99,97,
+108,108,121,114,101,102,101,114,114,105,110,103,32,116,111,110,101,103,111,116,
+105,97,116,105,111,110,115,104,101,97,100,113,117,97,114,116,101,114,115,83,111,
+117,116,104,32,65,102,114,105,99,97,117,110,115,117,99,99,101,115,115,102,117,
+108,80,101,110,110,115,121,108,118,97,110,105,97,65,115,32,97,32,114,101,115,117
+,108,116,44,60,104,116,109,108,32,108,97,110,103,61,34,38,108,116,59,47,115,117,
+112,38,103,116,59,100,101,97,108,105,110,103,32,119,105,116,104,112,104,105,108,
+97,100,101,108,112,104,105,97,104,105,115,116,111,114,105,99,97,108,108,121,41,
+59,60,47,115,99,114,105,112,116,62,10,112,97,100,100,105,110,103,45,116,111,112,
+58,101,120,112,101,114,105,109,101,110,116,97,108,103,101,116,65,116,116,114,105
+,98,117,116,101,105,110,115,116,114,117,99,116,105,111,110,115,116,101,99,104,
+110,111,108,111,103,105,101,115,112,97,114,116,32,111,102,32,116,104,101,32,61,
+102,117,110,99,116,105,111,110,40,41,123,115,117,98,115,99,114,105,112,116,105,
+111,110,108,46,100,116,100,34,62,13,10,60,104,116,103,101,111,103,114,97,112,104
+,105,99,97,108,67,111,110,115,116,105,116,117,116,105,111,110,39,44,32,102,117,
+110,99,116,105,111,110,40,115,117,112,112,111,114,116,101,100,32,98,121,97,103,
+114,105,99,117,108,116,117,114,97,108,99,111,110,115,116,114,117,99,116,105,111,
+110,112,117,98,108,105,99,97,116,105,111,110,115,102,111,110,116,45,115,105,122,
+101,58,32,49,97,32,118,97,114,105,101,116,121,32,111,102,60,100,105,118,32,115,
+116,121,108,101,61,34,69,110,99,121,99,108,111,112,101,100,105,97,105,102,114,97
+,109,101,32,115,114,99,61,34,100,101,109,111,110,115,116,114,97,116,101,100,97,
+99,99,111,109,112,108,105,115,104,101,100,117,110,105,118,101,114,115,105,116,
+105,101,115,68,101,109,111,103,114,97,112,104,105,99,115,41,59,60,47,115,99,114,
+105,112,116,62,60,100,101,100,105,99,97,116,101,100,32,116,111,107,110,111,119,
+108,101,100,103,101,32,111,102,115,97,116,105,115,102,97,99,116,105,111,110,112,
+97,114,116,105,99,117,108,97,114,108,121,60,47,100,105,118,62,60,47,100,105,118,
+62,69,110,103,108,105,115,104,32,40,85,83,41,97,112,112,101,110,100,67,104,105,
+108,100,40,116,114,97,110,115,109,105,115,115,105,111,110,115,46,32,72,111,119,
+101,118,101,114,44,32,105,110,116,101,108,108,105,103,101,110,99,101,34,32,116,
+97,98,105,110,100,101,120,61,34,102,108,111,97,116,58,114,105,103,104,116,59,67,
+111,109,109,111,110,119,101,97,108,116,104,114,97,110,103,105,110,103,32,102,114
+,111,109,105,110,32,119,104,105,99,104,32,116,104,101,97,116,32,108,101,97,115,
+116,32,111,110,101,114,101,112,114,111,100,117,99,116,105,111,110,101,110,99,121
+,99,108,111,112,101,100,105,97,59,102,111,110,116,45,115,105,122,101,58,49,106,
+117,114,105,115,100,105,99,116,105,111,110,97,116,32,116,104,97,116,32,116,105,
+109,101,34,62,60,97,32,99,108,97,115,115,61,34,73,110,32,97,100,100,105,116,105,
+111,110,44,100,101,115,99,114,105,112,116,105,111,110,43,99,111,110,118,101,114,
+115,97,116,105,111,110,99,111,110,116,97,99,116,32,119,105,116,104,105,115,32,
+103,101,110,101,114,97,108,108,121,114,34,32,99,111,110,116,101,110,116,61,34,
+114,101,112,114,101,115,101,110,116,105,110,103,38,108,116,59,109,97,116,104,38,
+103,116,59,112,114,101,115,101,110,116,97,116,105,111,110,111,99,99,97,115,105,
+111,110,97,108,108,121,60,105,109,103,32,119,105,100,116,104,61,34,110,97,118,
+105,103,97,116,105,111,110,34,62,99,111,109,112,101,110,115,97,116,105,111,110,
+99,104,97,109,112,105,111,110,115,104,105,112,109,101,100,105,97,61,34,97,108,
+108,34,32,118,105,111,108,97,116,105,111,110,32,111,102,114,101,102,101,114,101,
+110,99,101,32,116,111,114,101,116,117,114,110,32,116,114,117,101,59,83,116,114,
+105,99,116,47,47,69,78,34,32,116,114,97,110,115,97,99,116,105,111,110,115,105,
+110,116,101,114,118,101,110,116,105,111,110,118,101,114,105,102,105,99,97,116,
+105,111,110,73,110,102,111,114,109,97,116,105,111,110,32,100,105,102,102,105,99,
+117,108,116,105,101,115,67,104,97,109,112,105,111,110,115,104,105,112,99,97,112,
+97,98,105,108,105,116,105,101,115,60,33,91,101,110,100,105,102,93,45,45,62,125,
+10,60,47,115,99,114,105,112,116,62,10,67,104,114,105,115,116,105,97,110,105,116,
+121,102,111,114,32,101,120,97,109,112,108,101,44,80,114,111,102,101,115,115,105,
+111,110,97,108,114,101,115,116,114,105,99,116,105,111,110,115,115,117,103,103,
+101,115,116,32,116,104,97,116,119,97,115,32,114,101,108,101,97,115,101,100,40,
+115,117,99,104,32,97,115,32,116,104,101,114,101,109,111,118,101,67,108,97,115,
+115,40,117,110,101,109,112,108,111,121,109,101,110,116,116,104,101,32,65,109,101
+,114,105,99,97,110,115,116,114,117,99,116,117,114,101,32,111,102,47,105,110,100,
+101,120,46,104,116,109,108,32,112,117,98,108,105,115,104,101,100,32,105,110,115,
+112,97,110,32,99,108,97,115,115,61,34,34,62,60,97,32,104,114,101,102,61,34,47,
+105,110,116,114,111,100,117,99,116,105,111,110,98,101,108,111,110,103,105,110,
+103,32,116,111,99,108,97,105,109,101,100,32,116,104,97,116,99,111,110,115,101,
+113,117,101,110,99,101,115,60,109,101,116,97,32,110,97,109,101,61,34,71,117,105,
+100,101,32,116,111,32,116,104,101,111,118,101,114,119,104,101,108,109,105,110,
+103,97,103,97,105,110,115,116,32,116,104,101,32,99,111,110,99,101,110,116,114,97
+,116,101,100,44,10,46,110,111,110,116,111,117,99,104,32,111,98,115,101,114,118,
+97,116,105,111,110,115,60,47,97,62,10,60,47,100,105,118,62,10,102,32,40,100,111,
+99,117,109,101,110,116,46,98,111,114,100,101,114,58,32,49,112,120,32,123,102,111
+,110,116,45,115,105,122,101,58,49,116,114,101,97,116,109,101,110,116,32,111,102,
+48,34,32,104,101,105,103,104,116,61,34,49,109,111,100,105,102,105,99,97,116,105,
+111,110,73,110,100,101,112,101,110,100,101,110,99,101,100,105,118,105,100,101,
+100,32,105,110,116,111,103,114,101,97,116,101,114,32,116,104,97,110,97,99,104,
+105,101,118,101,109,101,110,116,115,101,115,116,97,98,108,105,115,104,105,110,
+103,74,97,118,97,83,99,114,105,112,116,34,32,110,101,118,101,114,116,104,101,108
+,101,115,115,115,105,103,110,105,102,105,99,97,110,99,101,66,114,111,97,100,99,
+97,115,116,105,110,103,62,38,110,98,115,112,59,60,47,116,100,62,99,111,110,116,
+97,105,110,101,114,34,62,10,115,117,99,104,32,97,115,32,116,104,101,32,105,110,
+102,108,117,101,110,99,101,32,111,102,97,32,112,97,114,116,105,99,117,108,97,114
+,115,114,99,61,39,104,116,116,112,58,47,47,110,97,118,105,103,97,116,105,111,110
+,34,32,104,97,108,102,32,111,102,32,116,104,101,32,115,117,98,115,116,97,110,116
+,105,97,108,32,38,110,98,115,112,59,60,47,100,105,118,62,97,100,118,97,110,116,
+97,103,101,32,111,102,100,105,115,99,111,118,101,114,121,32,111,102,102,117,110,
+100,97,109,101,110,116,97,108,32,109,101,116,114,111,112,111,108,105,116,97,110,
+116,104,101,32,111,112,112,111,115,105,116,101,34,32,120,109,108,58,108,97,110,
+103,61,34,100,101,108,105,98,101,114,97,116,101,108,121,97,108,105,103,110,61,99
+,101,110,116,101,114,101,118,111,108,117,116,105,111,110,32,111,102,112,114,101,
+115,101,114,118,97,116,105,111,110,105,109,112,114,111,118,101,109,101,110,116,
+115,98,101,103,105,110,110,105,110,103,32,105,110,74,101,115,117,115,32,67,104,
+114,105,115,116,80,117,98,108,105,99,97,116,105,111,110,115,100,105,115,97,103,
+114,101,101,109,101,110,116,116,101,120,116,45,97,108,105,103,110,58,114,44,32,
+102,117,110,99,116,105,111,110,40,41,115,105,109,105,108,97,114,105,116,105,101,
+115,98,111,100,121,62,60,47,104,116,109,108,62,105,115,32,99,117,114,114,101,110
+,116,108,121,97,108,112,104,97,98,101,116,105,99,97,108,105,115,32,115,111,109,
+101,116,105,109,101,115,116,121,112,101,61,34,105,109,97,103,101,47,109,97,110,
+121,32,111,102,32,116,104,101,32,102,108,111,119,58,104,105,100,100,101,110,59,
+97,118,97,105,108,97,98,108,101,32,105,110,100,101,115,99,114,105,98,101,32,116,
+104,101,101,120,105,115,116,101,110,99,101,32,111,102,97,108,108,32,111,118,101,
+114,32,116,104,101,116,104,101,32,73,110,116,101,114,110,101,116,9,60,117,108,32
+,99,108,97,115,115,61,34,105,110,115,116,97,108,108,97,116,105,111,110,110,101,
+105,103,104,98,111,114,104,111,111,100,97,114,109,101,100,32,102,111,114,99,101,
+115,114,101,100,117,99,105,110,103,32,116,104,101,99,111,110,116,105,110,117,101
+,115,32,116,111,78,111,110,101,116,104,101,108,101,115,115,44,116,101,109,112,
+101,114,97,116,117,114,101,115,10,9,9,60,97,32,104,114,101,102,61,34,99,108,111,
+115,101,32,116,111,32,116,104,101,101,120,97,109,112,108,101,115,32,111,102,32,
+105,115,32,97,98,111,117,116,32,116,104,101,40,115,101,101,32,98,101,108,111,119
+,41,46,34,32,105,100,61,34,115,101,97,114,99,104,112,114,111,102,101,115,115,105
+,111,110,97,108,105,115,32,97,118,97,105,108,97,98,108,101,116,104,101,32,111,
+102,102,105,99,105,97,108,9,9,60,47,115,99,114,105,112,116,62,10,10,9,9,60,100,
+105,118,32,105,100,61,34,97,99,99,101,108,101,114,97,116,105,111,110,116,104,114
+,111,117,103,104,32,116,104,101,32,72,97,108,108,32,111,102,32,70,97,109,101,100
+,101,115,99,114,105,112,116,105,111,110,115,116,114,97,110,115,108,97,116,105,
+111,110,115,105,110,116,101,114,102,101,114,101,110,99,101,32,116,121,112,101,61
+,39,116,101,120,116,47,114,101,99,101,110,116,32,121,101,97,114,115,105,110,32,
+116,104,101,32,119,111,114,108,100,118,101,114,121,32,112,111,112,117,108,97,114
+,123,98,97,99,107,103,114,111,117,110,100,58,116,114,97,100,105,116,105,111,110,
+97,108,32,115,111,109,101,32,111,102,32,116,104,101,32,99,111,110,110,101,99,116
+,101,100,32,116,111,101,120,112,108,111,105,116,97,116,105,111,110,101,109,101,
+114,103,101,110,99,101,32,111,102,99,111,110,115,116,105,116,117,116,105,111,110
+,65,32,72,105,115,116,111,114,121,32,111,102,115,105,103,110,105,102,105,99,97,
+110,116,32,109,97,110,117,102,97,99,116,117,114,101,100,101,120,112,101,99,116,
+97,116,105,111,110,115,62,60,110,111,115,99,114,105,112,116,62,60,99,97,110,32,
+98,101,32,102,111,117,110,100,98,101,99,97,117,115,101,32,116,104,101,32,104,97,
+115,32,110,111,116,32,98,101,101,110,110,101,105,103,104,98,111,117,114,105,110,
+103,119,105,116,104,111,117,116,32,116,104,101,32,97,100,100,101,100,32,116,111,
+32,116,104,101,9,60,108,105,32,99,108,97,115,115,61,34,105,110,115,116,114,117,
+109,101,110,116,97,108,83,111,118,105,101,116,32,85,110,105,111,110,97,99,107,
+110,111,119,108,101,100,103,101,100,119,104,105,99,104,32,99,97,110,32,98,101,
+110,97,109,101,32,102,111,114,32,116,104,101,97,116,116,101,110,116,105,111,110,
+32,116,111,97,116,116,101,109,112,116,115,32,116,111,32,100,101,118,101,108,111,
+112,109,101,110,116,115,73,110,32,102,97,99,116,44,32,116,104,101,60,108,105,32,
+99,108,97,115,115,61,34,97,105,109,112,108,105,99,97,116,105,111,110,115,115,117
+,105,116,97,98,108,101,32,102,111,114,109,117,99,104,32,111,102,32,116,104,101,
+32,99,111,108,111,110,105,122,97,116,105,111,110,112,114,101,115,105,100,101,110
+,116,105,97,108,99,97,110,99,101,108,66,117,98,98,108,101,32,73,110,102,111,114,
+109,97,116,105,111,110,109,111,115,116,32,111,102,32,116,104,101,32,105,115,32,
+100,101,115,99,114,105,98,101,100,114,101,115,116,32,111,102,32,116,104,101,32,
+109,111,114,101,32,111,114,32,108,101,115,115,105,110,32,83,101,112,116,101,109,
+98,101,114,73,110,116,101,108,108,105,103,101,110,99,101,115,114,99,61,34,104,
+116,116,112,58,47,47,112,120,59,32,104,101,105,103,104,116,58,32,97,118,97,105,
+108,97,98,108,101,32,116,111,109,97,110,117,102,97,99,116,117,114,101,114,104,
+117,109,97,110,32,114,105,103,104,116,115,108,105,110,107,32,104,114,101,102,61,
+34,47,97,118,97,105,108,97,98,105,108,105,116,121,112,114,111,112,111,114,116,
+105,111,110,97,108,111,117,116,115,105,100,101,32,116,104,101,32,97,115,116,114,
+111,110,111,109,105,99,97,108,104,117,109,97,110,32,98,101,105,110,103,115,110,
+97,109,101,32,111,102,32,116,104,101,32,97,114,101,32,102,111,117,110,100,32,105
+,110,97,114,101,32,98,97,115,101,100,32,111,110,115,109,97,108,108,101,114,32,
+116,104,97,110,97,32,112,101,114,115,111,110,32,119,104,111,101,120,112,97,110,
+115,105,111,110,32,111,102,97,114,103,117,105,110,103,32,116,104,97,116,110,111,
+119,32,107,110,111,119,110,32,97,115,73,110,32,116,104,101,32,101,97,114,108,121
+,105,110,116,101,114,109,101,100,105,97,116,101,100,101,114,105,118,101,100,32,
+102,114,111,109,83,99,97,110,100,105,110,97,118,105,97,110,60,47,97,62,60,47,100
+,105,118,62,13,10,99,111,110,115,105,100,101,114,32,116,104,101,97,110,32,101,
+115,116,105,109,97,116,101,100,116,104,101,32,78,97,116,105,111,110,97,108,60,
+100,105,118,32,105,100,61,34,112,97,103,114,101,115,117,108,116,105,110,103,32,
+105,110,99,111,109,109,105,115,115,105,111,110,101,100,97,110,97,108,111,103,111
+,117,115,32,116,111,97,114,101,32,114,101,113,117,105,114,101,100,47,117,108,62,
+10,60,47,100,105,118,62,10,119,97,115,32,98,97,115,101,100,32,111,110,97,110,100
+,32,98,101,99,97,109,101,32,97,38,110,98,115,112,59,38,110,98,115,112,59,116,34,
+32,118,97,108,117,101,61,34,34,32,119,97,115,32,99,97,112,116,117,114,101,100,
+110,111,32,109,111,114,101,32,116,104,97,110,114,101,115,112,101,99,116,105,118,
+101,108,121,99,111,110,116,105,110,117,101,32,116,111,32,62,13,10,60,104,101,97,
+100,62,13,10,60,119,101,114,101,32,99,114,101,97,116,101,100,109,111,114,101,32,
+103,101,110,101,114,97,108,105,110,102,111,114,109,97,116,105,111,110,32,117,115
+,101,100,32,102,111,114,32,116,104,101,105,110,100,101,112,101,110,100,101,110,
+116,32,116,104,101,32,73,109,112,101,114,105,97,108,99,111,109,112,111,110,101,
+110,116,32,111,102,116,111,32,116,104,101,32,110,111,114,116,104,105,110,99,108,
+117,100,101,32,116,104,101,32,67,111,110,115,116,114,117,99,116,105,111,110,115,
+105,100,101,32,111,102,32,116,104,101,32,119,111,117,108,100,32,110,111,116,32,
+98,101,102,111,114,32,105,110,115,116,97,110,99,101,105,110,118,101,110,116,105,
+111,110,32,111,102,109,111,114,101,32,99,111,109,112,108,101,120,99,111,108,108,
+101,99,116,105,118,101,108,121,98,97,99,107,103,114,111,117,110,100,58,32,116,
+101,120,116,45,97,108,105,103,110,58,32,105,116,115,32,111,114,105,103,105,110,
+97,108,105,110,116,111,32,97,99,99,111,117,110,116,116,104,105,115,32,112,114,
+111,99,101,115,115,97,110,32,101,120,116,101,110,115,105,118,101,104,111,119,101
+,118,101,114,44,32,116,104,101,116,104,101,121,32,97,114,101,32,110,111,116,114,
+101,106,101,99,116,101,100,32,116,104,101,99,114,105,116,105,99,105,115,109,32,
+111,102,100,117,114,105,110,103,32,119,104,105,99,104,112,114,111,98,97,98,108,
+121,32,116,104,101,116,104,105,115,32,97,114,116,105,99,108,101,40,102,117,110,
+99,116,105,111,110,40,41,123,73,116,32,115,104,111,117,108,100,32,98,101,97,110,
+32,97,103,114,101,101,109,101,110,116,97,99,99,105,100,101,110,116,97,108,108,
+121,100,105,102,102,101,114,115,32,102,114,111,109,65,114,99,104,105,116,101,99,
+116,117,114,101,98,101,116,116,101,114,32,107,110,111,119,110,97,114,114,97,110,
+103,101,109,101,110,116,115,105,110,102,108,117,101,110,99,101,32,111,110,97,116
+,116,101,110,100,101,100,32,116,104,101,105,100,101,110,116,105,99,97,108,32,116
+,111,115,111,117,116,104,32,111,102,32,116,104,101,112,97,115,115,32,116,104,114
+,111,117,103,104,120,109,108,34,32,116,105,116,108,101,61,34,119,101,105,103,104
+,116,58,98,111,108,100,59,99,114,101,97,116,105,110,103,32,116,104,101,100,105,
+115,112,108,97,121,58,110,111,110,101,114,101,112,108,97,99,101,100,32,116,104,
+101,60,105,109,103,32,115,114,99,61,34,47,105,104,116,116,112,115,58,47,47,119,
+119,119,46,87,111,114,108,100,32,87,97,114,32,73,73,116,101,115,116,105,109,111,
+110,105,97,108,115,102,111,117,110,100,32,105,110,32,116,104,101,114,101,113,117
+,105,114,101,100,32,116,111,32,97,110,100,32,116,104,97,116,32,116,104,101,98,
+101,116,119,101,101,110,32,116,104,101,32,119,97,115,32,100,101,115,105,103,110,
+101,100,99,111,110,115,105,115,116,115,32,111,102,32,99,111,110,115,105,100,101,
+114,97,98,108,121,112,117,98,108,105,115,104,101,100,32,98,121,116,104,101,32,
+108,97,110,103,117,97,103,101,67,111,110,115,101,114,118,97,116,105,111,110,99,
+111,110,115,105,115,116,101,100,32,111,102,114,101,102,101,114,32,116,111,32,116
+,104,101,98,97,99,107,32,116,111,32,116,104,101,32,99,115,115,34,32,109,101,100,
+105,97,61,34,80,101,111,112,108,101,32,102,114,111,109,32,97,118,97,105,108,97,
+98,108,101,32,111,110,112,114,111,118,101,100,32,116,111,32,98,101,115,117,103,
+103,101,115,116,105,111,110,115,34,119,97,115,32,107,110,111,119,110,32,97,115,
+118,97,114,105,101,116,105,101,115,32,111,102,108,105,107,101,108,121,32,116,111
+,32,98,101,99,111,109,112,114,105,115,101,100,32,111,102,115,117,112,112,111,114
+,116,32,116,104,101,32,104,97,110,100,115,32,111,102,32,116,104,101,99,111,117,
+112,108,101,100,32,119,105,116,104,99,111,110,110,101,99,116,32,97,110,100,32,98
+,111,114,100,101,114,58,110,111,110,101,59,112,101,114,102,111,114,109,97,110,99
+,101,115,98,101,102,111,114,101,32,98,101,105,110,103,108,97,116,101,114,32,98,
+101,99,97,109,101,99,97,108,99,117,108,97,116,105,111,110,115,111,102,116,101,
+110,32,99,97,108,108,101,100,114,101,115,105,100,101,110,116,115,32,111,102,109,
+101,97,110,105,110,103,32,116,104,97,116,62,60,108,105,32,99,108,97,115,115,61,
+34,101,118,105,100,101,110,99,101,32,102,111,114,101,120,112,108,97,110,97,116,
+105,111,110,115,101,110,118,105,114,111,110,109,101,110,116,115,34,62,60,47,97,
+62,60,47,100,105,118,62,119,104,105,99,104,32,97,108,108,111,119,115,73,110,116,
+114,111,100,117,99,116,105,111,110,100,101,118,101,108,111,112,101,100,32,98,121
+,97,32,119,105,100,101,32,114,97,110,103,101,111,110,32,98,101,104,97,108,102,32
+,111,102,118,97,108,105,103,110,61,34,116,111,112,34,112,114,105,110,99,105,112,
+108,101,32,111,102,97,116,32,116,104,101,32,116,105,109,101,44,60,47,110,111,115
+,99,114,105,112,116,62,13,115,97,105,100,32,116,111,32,104,97,118,101,105,110,32
+,116,104,101,32,102,105,114,115,116,119,104,105,108,101,32,111,116,104,101,114,
+115,104,121,112,111,116,104,101,116,105,99,97,108,112,104,105,108,111,115,111,
+112,104,101,114,115,112,111,119,101,114,32,111,102,32,116,104,101,99,111,110,116
+,97,105,110,101,100,32,105,110,112,101,114,102,111,114,109,101,100,32,98,121,105
+,110,97,98,105,108,105,116,121,32,116,111,119,101,114,101,32,119,114,105,116,116
+,101,110,115,112,97,110,32,115,116,121,108,101,61,34,105,110,112,117,116,32,110,
+97,109,101,61,34,116,104,101,32,113,117,101,115,116,105,111,110,105,110,116,101,
+110,100,101,100,32,102,111,114,114,101,106,101,99,116,105,111,110,32,111,102,105
+,109,112,108,105,101,115,32,116,104,97,116,105,110,118,101,110,116,101,100,32,
+116,104,101,116,104,101,32,115,116,97,110,100,97,114,100,119,97,115,32,112,114,
+111,98,97,98,108,121,108,105,110,107,32,98,101,116,119,101,101,110,112,114,111,
+102,101,115,115,111,114,32,111,102,105,110,116,101,114,97,99,116,105,111,110,115
+,99,104,97,110,103,105,110,103,32,116,104,101,73,110,100,105,97,110,32,79,99,101
+,97,110,32,99,108,97,115,115,61,34,108,97,115,116,119,111,114,107,105,110,103,32
+,119,105,116,104,39,104,116,116,112,58,47,47,119,119,119,46,121,101,97,114,115,
+32,98,101,102,111,114,101,84,104,105,115,32,119,97,115,32,116,104,101,114,101,99
+,114,101,97,116,105,111,110,97,108,101,110,116,101,114,105,110,103,32,116,104,
+101,109,101,97,115,117,114,101,109,101,110,116,115,97,110,32,101,120,116,114,101
+,109,101,108,121,118,97,108,117,101,32,111,102,32,116,104,101,115,116,97,114,116
+,32,111,102,32,116,104,101,10,60,47,115,99,114,105,112,116,62,10,10,97,110,32,
+101,102,102,111,114,116,32,116,111,105,110,99,114,101,97,115,101,32,116,104,101,
+116,111,32,116,104,101,32,115,111,117,116,104,115,112,97,99,105,110,103,61,34,48
+,34,62,115,117,102,102,105,99,105,101,110,116,108,121,116,104,101,32,69,117,114,
+111,112,101,97,110,99,111,110,118,101,114,116,101,100,32,116,111,99,108,101,97,
+114,84,105,109,101,111,117,116,100,105,100,32,110,111,116,32,104,97,118,101,99,
+111,110,115,101,113,117,101,110,116,108,121,102,111,114,32,116,104,101,32,110,
+101,120,116,101,120,116,101,110,115,105,111,110,32,111,102,101,99,111,110,111,
+109,105,99,32,97,110,100,97,108,116,104,111,117,103,104,32,116,104,101,97,114,
+101,32,112,114,111,100,117,99,101,100,97,110,100,32,119,105,116,104,32,116,104,
+101,105,110,115,117,102,102,105,99,105,101,110,116,103,105,118,101,110,32,98,121
+,32,116,104,101,115,116,97,116,105,110,103,32,116,104,97,116,101,120,112,101,110
+,100,105,116,117,114,101,115,60,47,115,112,97,110,62,60,47,97,62,10,116,104,111,
+117,103,104,116,32,116,104,97,116,111,110,32,116,104,101,32,98,97,115,105,115,99
+,101,108,108,112,97,100,100,105,110,103,61,105,109,97,103,101,32,111,102,32,116,
+104,101,114,101,116,117,114,110,105,110,103,32,116,111,105,110,102,111,114,109,
+97,116,105,111,110,44,115,101,112,97,114,97,116,101,100,32,98,121,97,115,115,97,
+115,115,105,110,97,116,101,100,115,34,32,99,111,110,116,101,110,116,61,34,97,117
+,116,104,111,114,105,116,121,32,111,102,110,111,114,116,104,119,101,115,116,101,
+114,110,60,47,100,105,118,62,10,60,100,105,118,32,34,62,60,47,100,105,118,62,13,
+10,32,32,99,111,110,115,117,108,116,97,116,105,111,110,99,111,109,109,117,110,
+105,116,121,32,111,102,116,104,101,32,110,97,116,105,111,110,97,108,105,116,32,
+115,104,111,117,108,100,32,98,101,112,97,114,116,105,99,105,112,97,110,116,115,
+32,97,108,105,103,110,61,34,108,101,102,116,116,104,101,32,103,114,101,97,116,
+101,115,116,115,101,108,101,99,116,105,111,110,32,111,102,115,117,112,101,114,
+110,97,116,117,114,97,108,100,101,112,101,110,100,101,110,116,32,111,110,105,115
+,32,109,101,110,116,105,111,110,101,100,97,108,108,111,119,105,110,103,32,116,
+104,101,119,97,115,32,105,110,118,101,110,116,101,100,97,99,99,111,109,112,97,
+110,121,105,110,103,104,105,115,32,112,101,114,115,111,110,97,108,97,118,97,105,
+108,97,98,108,101,32,97,116,115,116,117,100,121,32,111,102,32,116,104,101,111,
+110,32,116,104,101,32,111,116,104,101,114,101,120,101,99,117,116,105,111,110,32,
+111,102,72,117,109,97,110,32,82,105,103,104,116,115,116,101,114,109,115,32,111,
+102,32,116,104,101,97,115,115,111,99,105,97,116,105,111,110,115,114,101,115,101,
+97,114,99,104,32,97,110,100,115,117,99,99,101,101,100,101,100,32,98,121,100,101,
+102,101,97,116,101,100,32,116,104,101,97,110,100,32,102,114,111,109,32,116,104,
+101,98,117,116,32,116,104,101,121,32,97,114,101,99,111,109,109,97,110,100,101,
+114,32,111,102,115,116,97,116,101,32,111,102,32,116,104,101,121,101,97,114,115,
+32,111,102,32,97,103,101,116,104,101,32,115,116,117,100,121,32,111,102,60,117,
+108,32,99,108,97,115,115,61,34,115,112,108,97,99,101,32,105,110,32,116,104,101,
+119,104,101,114,101,32,104,101,32,119,97,115,60,108,105,32,99,108,97,115,115,61,
+34,102,116,104,101,114,101,32,97,114,101,32,110,111,119,104,105,99,104,32,98,101
+,99,97,109,101,104,101,32,112,117,98,108,105,115,104,101,100,101,120,112,114,101
+,115,115,101,100,32,105,110,116,111,32,119,104,105,99,104,32,116,104,101,99,111,
+109,109,105,115,115,105,111,110,101,114,102,111,110,116,45,119,101,105,103,104,
+116,58,116,101,114,114,105,116,111,114,121,32,111,102,101,120,116,101,110,115,
+105,111,110,115,34,62,82,111,109,97,110,32,69,109,112,105,114,101,101,113,117,97
+,108,32,116,111,32,116,104,101,73,110,32,99,111,110,116,114,97,115,116,44,104,
+111,119,101,118,101,114,44,32,97,110,100,105,115,32,116,121,112,105,99,97,108,
+108,121,97,110,100,32,104,105,115,32,119,105,102,101,40,97,108,115,111,32,99,97,
+108,108,101,100,62,60,117,108,32,99,108,97,115,115,61,34,101,102,102,101,99,116,
+105,118,101,108,121,32,101,118,111,108,118,101,100,32,105,110,116,111,115,101,
+101,109,32,116,111,32,104,97,118,101,119,104,105,99,104,32,105,115,32,116,104,
+101,116,104,101,114,101,32,119,97,115,32,110,111,97,110,32,101,120,99,101,108,
+108,101,110,116,97,108,108,32,111,102,32,116,104,101,115,101,100,101,115,99,114,
+105,98,101,100,32,98,121,73,110,32,112,114,97,99,116,105,99,101,44,98,114,111,97
+,100,99,97,115,116,105,110,103,99,104,97,114,103,101,100,32,119,105,116,104,114,
+101,102,108,101,99,116,101,100,32,105,110,115,117,98,106,101,99,116,101,100,32,
+116,111,109,105,108,105,116,97,114,121,32,97,110,100,116,111,32,116,104,101,32,
+112,111,105,110,116,101,99,111,110,111,109,105,99,97,108,108,121,115,101,116,84,
+97,114,103,101,116,105,110,103,97,114,101,32,97,99,116,117,97,108,108,121,118,
+105,99,116,111,114,121,32,111,118,101,114,40,41,59,60,47,115,99,114,105,112,116,
+62,99,111,110,116,105,110,117,111,117,115,108,121,114,101,113,117,105,114,101,
+100,32,102,111,114,101,118,111,108,117,116,105,111,110,97,114,121,97,110,32,101,
+102,102,101,99,116,105,118,101,110,111,114,116,104,32,111,102,32,116,104,101,44,
+32,119,104,105,99,104,32,119,97,115,32,102,114,111,110,116,32,111,102,32,116,104
+,101,111,114,32,111,116,104,101,114,119,105,115,101,115,111,109,101,32,102,111,
+114,109,32,111,102,104,97,100,32,110,111,116,32,98,101,101,110,103,101,110,101,
+114,97,116,101,100,32,98,121,105,110,102,111,114,109,97,116,105,111,110,46,112,
+101,114,109,105,116,116,101,100,32,116,111,105,110,99,108,117,100,101,115,32,116
+,104,101,100,101,118,101,108,111,112,109,101,110,116,44,101,110,116,101,114,101,
+100,32,105,110,116,111,116,104,101,32,112,114,101,118,105,111,117,115,99,111,110
+,115,105,115,116,101,110,116,108,121,97,114,101,32,107,110,111,119,110,32,97,115
+,116,104,101,32,102,105,101,108,100,32,111,102,116,104,105,115,32,116,121,112,
+101,32,111,102,103,105,118,101,110,32,116,111,32,116,104,101,116,104,101,32,116,
+105,116,108,101,32,111,102,99,111,110,116,97,105,110,115,32,116,104,101,105,110,
+115,116,97,110,99,101,115,32,111,102,105,110,32,116,104,101,32,110,111,114,116,
+104,100,117,101,32,116,111,32,116,104,101,105,114,97,114,101,32,100,101,115,105,
+103,110,101,100,99,111,114,112,111,114,97,116,105,111,110,115,119,97,115,32,116,
+104,97,116,32,116,104,101,111,110,101,32,111,102,32,116,104,101,115,101,109,111,
+114,101,32,112,111,112,117,108,97,114,115,117,99,99,101,101,100,101,100,32,105,
+110,115,117,112,112,111,114,116,32,102,114,111,109,105,110,32,100,105,102,102,
+101,114,101,110,116,100,111,109,105,110,97,116,101,100,32,98,121,100,101,115,105
+,103,110,101,100,32,102,111,114,111,119,110,101,114,115,104,105,112,32,111,102,
+97,110,100,32,112,111,115,115,105,98,108,121,115,116,97,110,100,97,114,100,105,
+122,101,100,114,101,115,112,111,110,115,101,84,101,120,116,119,97,115,32,105,110
+,116,101,110,100,101,100,114,101,99,101,105,118,101,100,32,116,104,101,97,115,
+115,117,109,101,100,32,116,104,97,116,97,114,101,97,115,32,111,102,32,116,104,
+101,112,114,105,109,97,114,105,108,121,32,105,110,116,104,101,32,98,97,115,105,
+115,32,111,102,105,110,32,116,104,101,32,115,101,110,115,101,97,99,99,111,117,
+110,116,115,32,102,111,114,100,101,115,116,114,111,121,101,100,32,98,121,97,116,
+32,108,101,97,115,116,32,116,119,111,119,97,115,32,100,101,99,108,97,114,101,100
+,99,111,117,108,100,32,110,111,116,32,98,101,83,101,99,114,101,116,97,114,121,32
+,111,102,97,112,112,101,97,114,32,116,111,32,98,101,109,97,114,103,105,110,45,
+116,111,112,58,49,47,94,92,115,43,124,92,115,43,36,47,103,101,41,123,116,104,114
+,111,119,32,101,125,59,116,104,101,32,115,116,97,114,116,32,111,102,116,119,111,
+32,115,101,112,97,114,97,116,101,108,97,110,103,117,97,103,101,32,97,110,100,119
+,104,111,32,104,97,100,32,98,101,101,110,111,112,101,114,97,116,105,111,110,32,
+111,102,100,101,97,116,104,32,111,102,32,116,104,101,114,101,97,108,32,110,117,
+109,98,101,114,115,9,60,108,105,110,107,32,114,101,108,61,34,112,114,111,118,105
+,100,101,100,32,116,104,101,116,104,101,32,115,116,111,114,121,32,111,102,99,111
+,109,112,101,116,105,116,105,111,110,115,101,110,103,108,105,115,104,32,40,85,75
+,41,101,110,103,108,105,115,104,32,40,85,83,41,208,156,208,190,208,189,208,179,
+208,190,208,187,208,161,209,128,208,191,209,129,208,186,208,184,209,129,209,128,
+208,191,209,129,208,186,208,184,209,129,209,128,208,191,209,129,208,186,208,190,
+217,132,216,185,216,177,216,168,217,138,216,169,230,173,163,233,171,148,228,184,
+173,230,150,135,231,174,128,228,189,147,228,184,173,230,150,135,231,185,129,228,
+189,147,228,184,173,230,150,135,230,156,137,233,153,144,229,133,172,229,143,184,
+228,186,186,230,176,145,230,148,191,229,186,156,233,152,191,233,135,140,229,183,
+180,229,183,180,231,164,190,228,188,154,228,184,187,228,185,137,230,147,141,228,
+189,156,231,179,187,231,187,159,230,148,191,231,173,150,230,179,149,232,167,132,
+105,110,102,111,114,109,97,99,105,195,179,110,104,101,114,114,97,109,105,101,110
+,116,97,115,101,108,101,99,116,114,195,179,110,105,99,111,100,101,115,99,114,105
+,112,99,105,195,179,110,99,108,97,115,105,102,105,99,97,100,111,115,99,111,110,
+111,99,105,109,105,101,110,116,111,112,117,98,108,105,99,97,99,105,195,179,110,
+114,101,108,97,99,105,111,110,97,100,97,115,105,110,102,111,114,109,195,161,116,
+105,99,97,114,101,108,97,99,105,111,110,97,100,111,115,100,101,112,97,114,116,97
+,109,101,110,116,111,116,114,97,98,97,106,97,100,111,114,101,115,100,105,114,101
+,99,116,97,109,101,110,116,101,97,121,117,110,116,97,109,105,101,110,116,111,109
+,101,114,99,97,100,111,76,105,98,114,101,99,111,110,116,195,161,99,116,101,110,
+111,115,104,97,98,105,116,97,99,105,111,110,101,115,99,117,109,112,108,105,109,
+105,101,110,116,111,114,101,115,116,97,117,114,97,110,116,101,115,100,105,115,
+112,111,115,105,99,105,195,179,110,99,111,110,115,101,99,117,101,110,99,105,97,
+101,108,101,99,116,114,195,179,110,105,99,97,97,112,108,105,99,97,99,105,111,110
+,101,115,100,101,115,99,111,110,101,99,116,97,100,111,105,110,115,116,97,108,97,
+99,105,195,179,110,114,101,97,108,105,122,97,99,105,195,179,110,117,116,105,108,
+105,122,97,99,105,195,179,110,101,110,99,105,99,108,111,112,101,100,105,97,101,
+110,102,101,114,109,101,100,97,100,101,115,105,110,115,116,114,117,109,101,110,
+116,111,115,101,120,112,101,114,105,101,110,99,105,97,115,105,110,115,116,105,
+116,117,99,105,195,179,110,112,97,114,116,105,99,117,108,97,114,101,115,115,117,
+98,99,97,116,101,103,111,114,105,97,209,130,208,190,208,187,209,140,208,186,208,
+190,208,160,208,190,209,129,209,129,208,184,208,184,209,128,208,176,208,177,208,
+190,209,130,209,139,208,177,208,190,208,187,209,140,209,136,208,181,208,191,209,
+128,208,190,209,129,209,130,208,190,208,188,208,190,208,182,208,181,209,130,208,
+181,208,180,209,128,209,131,208,179,208,184,209,133,209,129,208,187,209,131,209,
+135,208,176,208,181,209,129,208,181,208,185,209,135,208,176,209,129,208,178,209,
+129,208,181,208,179,208,180,208,176,208,160,208,190,209,129,209,129,208,184,209,
+143,208,156,208,190,209,129,208,186,208,178,208,181,208,180,209,128,209,131,208,
+179,208,184,208,181,208,179,208,190,209,128,208,190,208,180,208,176,208,178,208,
+190,208,191,209,128,208,190,209,129,208,180,208,176,208,189,208,189,209,139,209,
+133,208,180,208,190,208,187,208,182,208,189,209,139,208,184,208,188,208,181,208,
+189,208,189,208,190,208,156,208,190,209,129,208,186,208,178,209,139,209,128,209,
+131,208,177,208,187,208,181,208,185,208,156,208,190,209,129,208,186,208,178,208,
+176,209,129,209,130,209,128,208,176,208,189,209,139,208,189,208,184,209,135,208,
+181,208,179,208,190,209,128,208,176,208,177,208,190,209,130,208,181,208,180,208,
+190,208,187,208,182,208,181,208,189,209,131,209,129,208,187,209,131,208,179,208,
+184,209,130,208,181,208,191,208,181,209,128,209,140,208,158,208,180,208,189,208,
+176,208,186,208,190,208,191,208,190,209,130,208,190,208,188,209,131,209,128,208,
+176,208,177,208,190,209,130,209,131,208,176,208,191,209,128,208,181,208,187,209,
+143,208,178,208,190,208,190,208,177,209,137,208,181,208,190,208,180,208,189,208,
+190,208,179,208,190,209,129,208,178,208,190,208,181,208,179,208,190,209,129,209,
+130,208,176,209,130,209,140,208,184,208,180,209,128,209,131,208,179,208,190,208,
+185,209,132,208,190,209,128,209,131,208,188,208,181,209,133,208,190,209,128,208,
+190,209,136,208,190,208,191,209,128,208,190,209,130,208,184,208,178,209,129,209,
+129,209,139,208,187,208,186,208,176,208,186,208,176,208,182,208,180,209,139,208,
+185,208,178,208,187,208,176,209,129,209,130,208,184,208,179,209,128,209,131,208,
+191,208,191,209,139,208,178,208,188,208,181,209,129,209,130,208,181,209,128,208,
+176,208,177,208,190,209,130,208,176,209,129,208,186,208,176,208,183,208,176,208,
+187,208,191,208,181,209,128,208,178,209,139,208,185,208,180,208,181,208,187,208,
+176,209,130,209,140,208,180,208,181,208,189,209,140,208,179,208,184,208,191,208,
+181,209,128,208,184,208,190,208,180,208,177,208,184,208,183,208,189,208,181,209,
+129,208,190,209,129,208,189,208,190,208,178,208,181,208,188,208,190,208,188,208,
+181,208,189,209,130,208,186,209,131,208,191,208,184,209,130,209,140,208,180,208,
+190,208,187,208,182,208,189,208,176,209,128,208,176,208,188,208,186,208,176,209,
+133,208,189,208,176,209,135,208,176,208,187,208,190,208,160,208,176,208,177,208,
+190,209,130,208,176,208,162,208,190,208,187,209,140,208,186,208,190,209,129,208,
+190,208,178,209,129,208,181,208,188,208,178,209,130,208,190,209,128,208,190,208,
+185,208,189,208,176,209,135,208,176,208,187,208,176,209,129,208,191,208,184,209,
+129,208,190,208,186,209,129,208,187,209,131,208,182,208,177,209,139,209,129,208,
+184,209,129,209,130,208,181,208,188,208,191,208,181,209,135,208,176,209,130,208,
+184,208,189,208,190,208,178,208,190,208,179,208,190,208,191,208,190,208,188,208,
+190,209,137,208,184,209,129,208,176,208,185,209,130,208,190,208,178,208,191,208,
+190,209,135,208,181,208,188,209,131,208,191,208,190,208,188,208,190,209,137,209,
+140,208,180,208,190,208,187,208,182,208,189,208,190,209,129,209,129,209,139,208,
+187,208,186,208,184,208,177,209,139,209,129,209,130,209,128,208,190,208,180,208,
+176,208,189,208,189,209,139,208,181,208,188,208,189,208,190,208,179,208,184,208,
+181,208,191,209,128,208,190,208,181,208,186,209,130,208,161,208,181,208,185,209,
+135,208,176,209,129,208,188,208,190,208,180,208,181,208,187,208,184,209,130,208,
+176,208,186,208,190,208,179,208,190,208,190,208,189,208,187,208,176,208,185,208,
+189,208,179,208,190,209,128,208,190,208,180,208,181,208,178,208,181,209,128,209,
+129,208,184,209,143,209,129,209,130,209,128,208,176,208,189,208,181,209,132,208,
+184,208,187,209,140,208,188,209,139,209,131,209,128,208,190,208,178,208,189,209,
+143,209,128,208,176,208,183,208,189,209,139,209,133,208,184,209,129,208,186,208,
+176,209,130,209,140,208,189,208,181,208,180,208,181,208,187,209,142,209,143,208,
+189,208,178,208,176,209,128,209,143,208,188,208,181,208,189,209,140,209,136,208,
+181,208,188,208,189,208,190,208,179,208,184,209,133,208,180,208,176,208,189,208,
+189,208,190,208,185,208,183,208,189,208,176,209,135,208,184,209,130,208,189,208,
+181,208,187,209,140,208,183,209,143,209,132,208,190,209,128,209,131,208,188,208,
+176,208,162,208,181,208,191,208,181,209,128,209,140,208,188,208,181,209,129,209,
+143,209,134,208,176,208,183,208,176,209,137,208,184,209,130,209,139,208,155,209,
+131,209,135,209,136,208,184,208,181,224,164,168,224,164,185,224,165,128,224,164,
+130,224,164,149,224,164,176,224,164,168,224,165,135,224,164,133,224,164,170,224,
+164,168,224,165,135,224,164,149,224,164,191,224,164,175,224,164,190,224,164,149,
+224,164,176,224,165,135,224,164,130,224,164,133,224,164,168,224,165,141,224,164,
+175,224,164,149,224,165,141,224,164,175,224,164,190,224,164,151,224,164,190,224,
+164,135,224,164,161,224,164,172,224,164,190,224,164,176,224,165,135,224,164,149,
+224,164,191,224,164,184,224,165,128,224,164,166,224,164,191,224,164,175,224,164,
+190,224,164,170,224,164,185,224,164,178,224,165,135,224,164,184,224,164,191,224,
+164,130,224,164,185,224,164,173,224,164,190,224,164,176,224,164,164,224,164,133,
+224,164,170,224,164,168,224,165,128,224,164,181,224,164,190,224,164,178,224,165,
+135,224,164,184,224,165,135,224,164,181,224,164,190,224,164,149,224,164,176,224,
+164,164,224,165,135,224,164,174,224,165,135,224,164,176,224,165,135,224,164,185,
+224,165,139,224,164,168,224,165,135,224,164,184,224,164,149,224,164,164,224,165,
+135,224,164,172,224,164,185,224,165,129,224,164,164,224,164,184,224,164,190,224,
+164,135,224,164,159,224,164,185,224,165,139,224,164,151,224,164,190,224,164,156,
+224,164,190,224,164,168,224,165,135,224,164,174,224,164,191,224,164,168,224,164,
+159,224,164,149,224,164,176,224,164,164,224,164,190,224,164,149,224,164,176,224,
+164,168,224,164,190,224,164,137,224,164,168,224,164,149,224,165,135,224,164,175,
+224,164,185,224,164,190,224,164,129,224,164,184,224,164,172,224,164,184,224,165,
+135,224,164,173,224,164,190,224,164,183,224,164,190,224,164,134,224,164,170,224,
+164,149,224,165,135,224,164,178,224,164,191,224,164,175,224,165,135,224,164,182,
+224,165,129,224,164,176,224,165,130,224,164,135,224,164,184,224,164,149,224,165,
+135,224,164,152,224,164,130,224,164,159,224,165,135,224,164,174,224,165,135,224,
+164,176,224,165,128,224,164,184,224,164,149,224,164,164,224,164,190,224,164,174,
+224,165,135,224,164,176,224,164,190,224,164,178,224,165,135,224,164,149,224,164,
+176,224,164,133,224,164,167,224,164,191,224,164,149,224,164,133,224,164,170,224,
+164,168,224,164,190,224,164,184,224,164,174,224,164,190,224,164,156,224,164,174,
+224,165,129,224,164,157,224,165,135,224,164,149,224,164,190,224,164,176,224,164,
+163,224,164,185,224,165,139,224,164,164,224,164,190,224,164,149,224,164,161,224,
+164,188,224,165,128,224,164,175,224,164,185,224,164,190,224,164,130,224,164,185,
+224,165,139,224,164,159,224,164,178,224,164,182,224,164,172,224,165,141,224,164,
+166,224,164,178,224,164,191,224,164,175,224,164,190,224,164,156,224,165,128,224,
+164,181,224,164,168,224,164,156,224,164,190,224,164,164,224,164,190,224,164,149,
+224,165,136,224,164,184,224,165,135,224,164,134,224,164,170,224,164,149,224,164,
+190,224,164,181,224,164,190,224,164,178,224,165,128,224,164,166,224,165,135,224,
+164,168,224,165,135,224,164,170,224,165,130,224,164,176,224,165,128,224,164,170,
+224,164,190,224,164,168,224,165,128,224,164,137,224,164,184,224,164,149,224,165,
+135,224,164,185,224,165,139,224,164,151,224,165,128,224,164,172,224,165,136,224,
+164,160,224,164,149,224,164,134,224,164,170,224,164,149,224,165,128,224,164,181,
+224,164,176,224,165,141,224,164,183,224,164,151,224,164,190,224,164,130,224,164,
+181,224,164,134,224,164,170,224,164,149,224,165,139,224,164,156,224,164,191,224,
+164,178,224,164,190,224,164,156,224,164,190,224,164,168,224,164,190,224,164,184,
+224,164,185,224,164,174,224,164,164,224,164,185,224,164,174,224,165,135,224,164,
+130,224,164,137,224,164,168,224,164,149,224,165,128,224,164,175,224,164,190,224,
+164,185,224,165,130,224,164,166,224,164,176,224,165,141,224,164,156,224,164,184,
+224,165,130,224,164,154,224,165,128,224,164,170,224,164,184,224,164,130,224,164,
+166,224,164,184,224,164,181,224,164,190,224,164,178,224,164,185,224,165,139,224,
+164,168,224,164,190,224,164,185,224,165,139,224,164,164,224,165,128,224,164,156,
+224,165,136,224,164,184,224,165,135,224,164,181,224,164,190,224,164,170,224,164,
+184,224,164,156,224,164,168,224,164,164,224,164,190,224,164,168,224,165,135,224,
+164,164,224,164,190,224,164,156,224,164,190,224,164,176,224,165,128,224,164,152,
+224,164,190,224,164,175,224,164,178,224,164,156,224,164,191,224,164,178,224,165,
+135,224,164,168,224,165,128,224,164,154,224,165,135,224,164,156,224,164,190,224,
+164,130,224,164,154,224,164,170,224,164,164,224,165,141,224,164,176,224,164,151,
+224,165,130,224,164,151,224,164,178,224,164,156,224,164,190,224,164,164,224,165,
+135,224,164,172,224,164,190,224,164,185,224,164,176,224,164,134,224,164,170,224,
+164,168,224,165,135,224,164,181,224,164,190,224,164,185,224,164,168,224,164,135,
+224,164,184,224,164,149,224,164,190,224,164,184,224,165,129,224,164,172,224,164,
+185,224,164,176,224,164,185,224,164,168,224,165,135,224,164,135,224,164,184,224,
+164,184,224,165,135,224,164,184,224,164,185,224,164,191,224,164,164,224,164,172,
+224,164,161,224,164,188,224,165,135,224,164,152,224,164,159,224,164,168,224,164,
+190,224,164,164,224,164,178,224,164,190,224,164,182,224,164,170,224,164,190,224,
+164,130,224,164,154,224,164,182,224,165,141,224,164,176,224,165,128,224,164,172,
+224,164,161,224,164,188,224,165,128,224,164,185,224,165,139,224,164,164,224,165,
+135,224,164,184,224,164,190,224,164,136,224,164,159,224,164,182,224,164,190,224,
+164,175,224,164,166,224,164,184,224,164,149,224,164,164,224,165,128,224,164,156,
+224,164,190,224,164,164,224,165,128,224,164,181,224,164,190,224,164,178,224,164,
+190,224,164,185,224,164,156,224,164,190,224,164,176,224,164,170,224,164,159,224,
+164,168,224,164,190,224,164,176,224,164,150,224,164,168,224,165,135,224,164,184,
+224,164,161,224,164,188,224,164,149,224,164,174,224,164,191,224,164,178,224,164,
+190,224,164,137,224,164,184,224,164,149,224,165,128,224,164,149,224,165,135,224,
+164,181,224,164,178,224,164,178,224,164,151,224,164,164,224,164,190,224,164,150,
+224,164,190,224,164,168,224,164,190,224,164,133,224,164,176,224,165,141,224,164,
+165,224,164,156,224,164,185,224,164,190,224,164,130,224,164,166,224,165,135,224,
+164,150,224,164,190,224,164,170,224,164,185,224,164,178,224,165,128,224,164,168,
+224,164,191,224,164,175,224,164,174,224,164,172,224,164,191,224,164,168,224,164,
+190,224,164,172,224,165,136,224,164,130,224,164,149,224,164,149,224,164,185,224,
+165,128,224,164,130,224,164,149,224,164,185,224,164,168,224,164,190,224,164,166,
+224,165,135,224,164,164,224,164,190,224,164,185,224,164,174,224,164,178,224,165,
+135,224,164,149,224,164,190,224,164,171,224,165,128,224,164,156,224,164,172,224,
+164,149,224,164,191,224,164,164,224,165,129,224,164,176,224,164,164,224,164,174,
+224,164,190,224,164,130,224,164,151,224,164,181,224,164,185,224,165,128,224,164,
+130,224,164,176,224,165,139,224,164,156,224,164,188,224,164,174,224,164,191,224,
+164,178,224,165,128,224,164,134,224,164,176,224,165,139,224,164,170,224,164,184,
+224,165,135,224,164,168,224,164,190,224,164,175,224,164,190,224,164,166,224,164,
+181,224,164,178,224,165,135,224,164,168,224,165,135,224,164,150,224,164,190,224,
+164,164,224,164,190,224,164,149,224,164,176,224,165,128,224,164,172,224,164,137,
+224,164,168,224,164,149,224,164,190,224,164,156,224,164,181,224,164,190,224,164,
+172,224,164,170,224,165,130,224,164,176,224,164,190,224,164,172,224,164,161,224,
+164,188,224,164,190,224,164,184,224,165,140,224,164,166,224,164,190,224,164,182,
+224,165,135,224,164,175,224,164,176,224,164,149,224,164,191,224,164,175,224,165,
+135,224,164,149,224,164,185,224,164,190,224,164,130,224,164,133,224,164,149,224,
+164,184,224,164,176,224,164,172,224,164,168,224,164,190,224,164,143,224,164,181,
+224,164,185,224,164,190,224,164,130,224,164,184,224,165,141,224,164,165,224,164,
+178,224,164,174,224,164,191,224,164,178,224,165,135,224,164,178,224,165,135,224,
+164,150,224,164,149,224,164,181,224,164,191,224,164,183,224,164,175,224,164,149,
+224,165,141,224,164,176,224,164,130,224,164,184,224,164,174,224,165,130,224,164,
+185,224,164,165,224,164,190,224,164,168,224,164,190,216,170,216,179,216,170,216,
+183,217,138,216,185,217,133,216,180,216,167,216,177,217,131,216,169,216,168,217,
+136,216,167,216,179,216,183,216,169,216,167,217,132,216,181,217,129,216,173,216,
+169,217,133,217,136,216,167,216,182,217,138,216,185,216,167,217,132,216,174,216,
+167,216,181,216,169,216,167,217,132,217,133,216,178,217,138,216,175,216,167,217,
+132,216,185,216,167,217,133,216,169,216,167,217,132,217,131,216,167,216,170,216,
+168,216,167,217,132,216,177,216,175,217,136,216,175,216,168,216,177,217,134,216,
+167,217,133,216,172,216,167,217,132,216,175,217,136,217,132,216,169,216,167,217,
+132,216,185,216,167,217,132,217,133,216,167,217,132,217,133,217,136,217,130,216,
+185,216,167,217,132,216,185,216,177,216,168,217,138,216,167,217,132,216,179,216,
+177,217,138,216,185,216,167,217,132,216,172,217,136,216,167,217,132,216,167,217,
+132,216,176,217,135,216,167,216,168,216,167,217,132,216,173,217,138,216,167,216,
+169,216,167,217,132,216,173,217,130,217,136,217,130,216,167,217,132,217,131,216,
+177,217,138,217,133,216,167,217,132,216,185,216,177,216,167,217,130,217,133,216,
+173,217,129,217,136,216,184,216,169,216,167,217,132,216,171,216,167,217,134,217,
+138,217,133,216,180,216,167,217,135,216,175,216,169,216,167,217,132,217,133,216,
+177,216,163,216,169,216,167,217,132,217,130,216,177,216,162,217,134,216,167,217,
+132,216,180,216,168,216,167,216,168,216,167,217,132,216,173,217,136,216,167,216,
+177,216,167,217,132,216,172,216,175,217,138,216,175,216,167,217,132,216,163,216,
+179,216,177,216,169,216,167,217,132,216,185,217,132,217,136,217,133,217,133,216,
+172,217,133,217,136,216,185,216,169,216,167,217,132,216,177,216,173,217,133,217,
+134,216,167,217,132,217,134,217,130,216,167,216,183,217,129,217,132,216,179,216,
+183,217,138,217,134,216,167,217,132,217,131,217,136,217,138,216,170,216,167,217,
+132,216,175,217,134,217,138,216,167,216,168,216,177,217,131,216,167,216,170,217,
+135,216,167,217,132,216,177,217,138,216,167,216,182,216,170,216,173,217,138,216,
+167,216,170,217,138,216,168,216,170,217,136,217,130,217,138,216,170,216,167,217,
+132,216,163,217,136,217,132,217,137,216,167,217,132,216,168,216,177,217,138,216,
+175,216,167,217,132,217,131,217,132,216,167,217,133,216,167,217,132,216,177,216,
+167,216,168,216,183,216,167,217,132,216,180,216,174,216,181,217,138,216,179,217,
+138,216,167,216,177,216,167,216,170,216,167,217,132,216,171,216,167,217,132,216,
+171,216,167,217,132,216,181,217,132,216,167,216,169,216,167,217,132,216,173,216,
+175,217,138,216,171,216,167,217,132,216,178,217,136,216,167,216,177,216,167,217,
+132,216,174,217,132,217,138,216,172,216,167,217,132,216,172,217,133,217,138,216,
+185,216,167,217,132,216,185,216,167,217,133,217,135,216,167,217,132,216,172,217,
+133,216,167,217,132,216,167,217,132,216,179,216,167,216,185,216,169,217,133,216,
+180,216,167,217,135,216,175,217,135,216,167,217,132,216,177,216,166,217,138,216,
+179,216,167,217,132,216,175,216,174,217,136,217,132,216,167,217,132,217,129,217,
+134,217,138,216,169,216,167,217,132,217,131,216,170,216,167,216,168,216,167,217,
+132,216,175,217,136,216,177,217,138,216,167,217,132,216,175,216,177,217,136,216,
+179,216,167,216,179,216,170,216,186,216,177,217,130,216,170,216,181,216,167,217,
+133,217,138,217,133,216,167,217,132,216,168,217,134,216,167,216,170,216,167,217,
+132,216,185,216,184,217,138,217,133,101,110,116,101,114,116,97,105,110,109,101,
+110,116,117,110,100,101,114,115,116,97,110,100,105,110,103,32,61,32,102,117,110,
+99,116,105,111,110,40,41,46,106,112,103,34,32,119,105,100,116,104,61,34,99,111,
+110,102,105,103,117,114,97,116,105,111,110,46,112,110,103,34,32,119,105,100,116,
+104,61,34,60,98,111,100,121,32,99,108,97,115,115,61,34,77,97,116,104,46,114,97,
+110,100,111,109,40,41,99,111,110,116,101,109,112,111,114,97,114,121,32,85,110,
+105,116,101,100,32,83,116,97,116,101,115,99,105,114,99,117,109,115,116,97,110,99
+,101,115,46,97,112,112,101,110,100,67,104,105,108,100,40,111,114,103,97,110,105,
+122,97,116,105,111,110,115,60,115,112,97,110,32,99,108,97,115,115,61,34,34,62,60
+,105,109,103,32,115,114,99,61,34,47,100,105,115,116,105,110,103,117,105,115,104,
+101,100,116,104,111,117,115,97,110,100,115,32,111,102,32,99,111,109,109,117,110,
+105,99,97,116,105,111,110,99,108,101,97,114,34,62,60,47,100,105,118,62,105,110,
+118,101,115,116,105,103,97,116,105,111,110,102,97,118,105,99,111,110,46,105,99,
+111,34,32,109,97,114,103,105,110,45,114,105,103,104,116,58,98,97,115,101,100,32,
+111,110,32,116,104,101,32,77,97,115,115,97,99,104,117,115,101,116,116,115,116,97
+,98,108,101,32,98,111,114,100,101,114,61,105,110,116,101,114,110,97,116,105,111,
+110,97,108,97,108,115,111,32,107,110,111,119,110,32,97,115,112,114,111,110,117,
+110,99,105,97,116,105,111,110,98,97,99,107,103,114,111,117,110,100,58,35,102,112
+,97,100,100,105,110,103,45,108,101,102,116,58,70,111,114,32,101,120,97,109,112,
+108,101,44,32,109,105,115,99,101,108,108,97,110,101,111,117,115,38,108,116,59,47
+,109,97,116,104,38,103,116,59,112,115,121,99,104,111,108,111,103,105,99,97,108,
+105,110,32,112,97,114,116,105,99,117,108,97,114,101,97,114,99,104,34,32,116,121,
+112,101,61,34,102,111,114,109,32,109,101,116,104,111,100,61,34,97,115,32,111,112
+,112,111,115,101,100,32,116,111,83,117,112,114,101,109,101,32,67,111,117,114,116
+,111,99,99,97,115,105,111,110,97,108,108,121,32,65,100,100,105,116,105,111,110,
+97,108,108,121,44,78,111,114,116,104,32,65,109,101,114,105,99,97,112,120,59,98,
+97,99,107,103,114,111,117,110,100,111,112,112,111,114,116,117,110,105,116,105,
+101,115,69,110,116,101,114,116,97,105,110,109,101,110,116,46,116,111,76,111,119,
+101,114,67,97,115,101,40,109,97,110,117,102,97,99,116,117,114,105,110,103,112,
+114,111,102,101,115,115,105,111,110,97,108,32,99,111,109,98,105,110,101,100,32,
+119,105,116,104,70,111,114,32,105,110,115,116,97,110,99,101,44,99,111,110,115,
+105,115,116,105,110,103,32,111,102,34,32,109,97,120,108,101,110,103,116,104,61,
+34,114,101,116,117,114,110,32,102,97,108,115,101,59,99,111,110,115,99,105,111,
+117,115,110,101,115,115,77,101,100,105,116,101,114,114,97,110,101,97,110,101,120
+,116,114,97,111,114,100,105,110,97,114,121,97,115,115,97,115,115,105,110,97,116,
+105,111,110,115,117,98,115,101,113,117,101,110,116,108,121,32,98,117,116,116,111
+,110,32,116,121,112,101,61,34,116,104,101,32,110,117,109,98,101,114,32,111,102,
+116,104,101,32,111,114,105,103,105,110,97,108,32,99,111,109,112,114,101,104,101,
+110,115,105,118,101,114,101,102,101,114,115,32,116,111,32,116,104,101,60,47,117,
+108,62,10,60,47,100,105,118,62,10,112,104,105,108,111,115,111,112,104,105,99,97,
+108,108,111,99,97,116,105,111,110,46,104,114,101,102,119,97,115,32,112,117,98,
+108,105,115,104,101,100,83,97,110,32,70,114,97,110,99,105,115,99,111,40,102,117,
+110,99,116,105,111,110,40,41,123,10,60,100,105,118,32,105,100,61,34,109,97,105,
+110,115,111,112,104,105,115,116,105,99,97,116,101,100,109,97,116,104,101,109,97,
+116,105,99,97,108,32,47,104,101,97,100,62,13,10,60,98,111,100,121,115,117,103,
+103,101,115,116,115,32,116,104,97,116,100,111,99,117,109,101,110,116,97,116,105,
+111,110,99,111,110,99,101,110,116,114,97,116,105,111,110,114,101,108,97,116,105,
+111,110,115,104,105,112,115,109,97,121,32,104,97,118,101,32,98,101,101,110,40,
+102,111,114,32,101,120,97,109,112,108,101,44,84,104,105,115,32,97,114,116,105,99
+,108,101,32,105,110,32,115,111,109,101,32,99,97,115,101,115,112,97,114,116,115,
+32,111,102,32,116,104,101,32,100,101,102,105,110,105,116,105,111,110,32,111,102,
+71,114,101,97,116,32,66,114,105,116,97,105,110,32,99,101,108,108,112,97,100,100,
+105,110,103,61,101,113,117,105,118,97,108,101,110,116,32,116,111,112,108,97,99,
+101,104,111,108,100,101,114,61,34,59,32,102,111,110,116,45,115,105,122,101,58,32
+,106,117,115,116,105,102,105,99,97,116,105,111,110,98,101,108,105,101,118,101,
+100,32,116,104,97,116,115,117,102,102,101,114,101,100,32,102,114,111,109,97,116,
+116,101,109,112,116,101,100,32,116,111,32,108,101,97,100,101,114,32,111,102,32,
+116,104,101,99,114,105,112,116,34,32,115,114,99,61,34,47,40,102,117,110,99,116,
+105,111,110,40,41,32,123,97,114,101,32,97,118,97,105,108,97,98,108,101,10,9,60,
+108,105,110,107,32,114,101,108,61,34,32,115,114,99,61,39,104,116,116,112,58,47,
+47,105,110,116,101,114,101,115,116,101,100,32,105,110,99,111,110,118,101,110,116
+,105,111,110,97,108,32,34,32,97,108,116,61,34,34,32,47,62,60,47,97,114,101,32,
+103,101,110,101,114,97,108,108,121,104,97,115,32,97,108,115,111,32,98,101,101,
+110,109,111,115,116,32,112,111,112,117,108,97,114,32,99,111,114,114,101,115,112,
+111,110,100,105,110,103,99,114,101,100,105,116,101,100,32,119,105,116,104,116,
+121,108,101,61,34,98,111,114,100,101,114,58,60,47,97,62,60,47,115,112,97,110,62,
+60,47,46,103,105,102,34,32,119,105,100,116,104,61,34,60,105,102,114,97,109,101,
+32,115,114,99,61,34,116,97,98,108,101,32,99,108,97,115,115,61,34,105,110,108,105
+,110,101,45,98,108,111,99,107,59,97,99,99,111,114,100,105,110,103,32,116,111,32,
+116,111,103,101,116,104,101,114,32,119,105,116,104,97,112,112,114,111,120,105,
+109,97,116,101,108,121,112,97,114,108,105,97,109,101,110,116,97,114,121,109,111,
+114,101,32,97,110,100,32,109,111,114,101,100,105,115,112,108,97,121,58,110,111,
+110,101,59,116,114,97,100,105,116,105,111,110,97,108,108,121,112,114,101,100,111
+,109,105,110,97,110,116,108,121,38,110,98,115,112,59,124,38,110,98,115,112,59,38
+,110,98,115,112,59,60,47,115,112,97,110,62,32,99,101,108,108,115,112,97,99,105,
+110,103,61,60,105,110,112,117,116,32,110,97,109,101,61,34,111,114,34,32,99,111,
+110,116,101,110,116,61,34,99,111,110,116,114,111,118,101,114,115,105,97,108,112,
+114,111,112,101,114,116,121,61,34,111,103,58,47,120,45,115,104,111,99,107,119,97
+,118,101,45,100,101,109,111,110,115,116,114,97,116,105,111,110,115,117,114,114,
+111,117,110,100,101,100,32,98,121,78,101,118,101,114,116,104,101,108,101,115,115
+,44,119,97,115,32,116,104,101,32,102,105,114,115,116,99,111,110,115,105,100,101,
+114,97,98,108,101,32,65,108,116,104,111,117,103,104,32,116,104,101,32,99,111,108
+,108,97,98,111,114,97,116,105,111,110,115,104,111,117,108,100,32,110,111,116,32,
+98,101,112,114,111,112,111,114,116,105,111,110,32,111,102,60,115,112,97,110,32,
+115,116,121,108,101,61,34,107,110,111,119,110,32,97,115,32,116,104,101,32,115,
+104,111,114,116,108,121,32,97,102,116,101,114,102,111,114,32,105,110,115,116,97,
+110,99,101,44,100,101,115,99,114,105,98,101,100,32,97,115,32,47,104,101,97,100,
+62,10,60,98,111,100,121,32,115,116,97,114,116,105,110,103,32,119,105,116,104,105
+,110,99,114,101,97,115,105,110,103,108,121,32,116,104,101,32,102,97,99,116,32,
+116,104,97,116,100,105,115,99,117,115,115,105,111,110,32,111,102,109,105,100,100
+,108,101,32,111,102,32,116,104,101,97,110,32,105,110,100,105,118,105,100,117,97,
+108,100,105,102,102,105,99,117,108,116,32,116,111,32,112,111,105,110,116,32,111,
+102,32,118,105,101,119,104,111,109,111,115,101,120,117,97,108,105,116,121,97,99,
+99,101,112,116,97,110,99,101,32,111,102,60,47,115,112,97,110,62,60,47,100,105,
+118,62,109,97,110,117,102,97,99,116,117,114,101,114,115,111,114,105,103,105,110,
+32,111,102,32,116,104,101,99,111,109,109,111,110,108,121,32,117,115,101,100,105,
+109,112,111,114,116,97,110,99,101,32,111,102,100,101,110,111,109,105,110,97,116,
+105,111,110,115,98,97,99,107,103,114,111,117,110,100,58,32,35,108,101,110,103,
+116,104,32,111,102,32,116,104,101,100,101,116,101,114,109,105,110,97,116,105,111
+,110,97,32,115,105,103,110,105,102,105,99,97,110,116,34,32,98,111,114,100,101,
+114,61,34,48,34,62,114,101,118,111,108,117,116,105,111,110,97,114,121,112,114,
+105,110,99,105,112,108,101,115,32,111,102,105,115,32,99,111,110,115,105,100,101,
+114,101,100,119,97,115,32,100,101,118,101,108,111,112,101,100,73,110,100,111,45,
+69,117,114,111,112,101,97,110,118,117,108,110,101,114,97,98,108,101,32,116,111,
+112,114,111,112,111,110,101,110,116,115,32,111,102,97,114,101,32,115,111,109,101
+,116,105,109,101,115,99,108,111,115,101,114,32,116,111,32,116,104,101,78,101,119
+,32,89,111,114,107,32,67,105,116,121,32,110,97,109,101,61,34,115,101,97,114,99,
+104,97,116,116,114,105,98,117,116,101,100,32,116,111,99,111,117,114,115,101,32,
+111,102,32,116,104,101,109,97,116,104,101,109,97,116,105,99,105,97,110,98,121,32
+,116,104,101,32,101,110,100,32,111,102,97,116,32,116,104,101,32,101,110,100,32,
+111,102,34,32,98,111,114,100,101,114,61,34,48,34,32,116,101,99,104,110,111,108,
+111,103,105,99,97,108,46,114,101,109,111,118,101,67,108,97,115,115,40,98,114,97,
+110,99,104,32,111,102,32,116,104,101,101,118,105,100,101,110,99,101,32,116,104,
+97,116,33,91,101,110,100,105,102,93,45,45,62,13,10,73,110,115,116,105,116,117,
+116,101,32,111,102,32,105,110,116,111,32,97,32,115,105,110,103,108,101,114,101,
+115,112,101,99,116,105,118,101,108,121,46,97,110,100,32,116,104,101,114,101,102,
+111,114,101,112,114,111,112,101,114,116,105,101,115,32,111,102,105,115,32,108,
+111,99,97,116,101,100,32,105,110,115,111,109,101,32,111,102,32,119,104,105,99,
+104,84,104,101,114,101,32,105,115,32,97,108,115,111,99,111,110,116,105,110,117,
+101,100,32,116,111,32,97,112,112,101,97,114,97,110,99,101,32,111,102,32,38,97,
+109,112,59,110,100,97,115,104,59,32,100,101,115,99,114,105,98,101,115,32,116,104
+,101,99,111,110,115,105,100,101,114,97,116,105,111,110,97,117,116,104,111,114,32
+,111,102,32,116,104,101,105,110,100,101,112,101,110,100,101,110,116,108,121,101,
+113,117,105,112,112,101,100,32,119,105,116,104,100,111,101,115,32,110,111,116,32
+,104,97,118,101,60,47,97,62,60,97,32,104,114,101,102,61,34,99,111,110,102,117,
+115,101,100,32,119,105,116,104,60,108,105,110,107,32,104,114,101,102,61,34,47,97
+,116,32,116,104,101,32,97,103,101,32,111,102,97,112,112,101,97,114,32,105,110,32
+,116,104,101,84,104,101,115,101,32,105,110,99,108,117,100,101,114,101,103,97,114
+,100,108,101,115,115,32,111,102,99,111,117,108,100,32,98,101,32,117,115,101,100,
+32,115,116,121,108,101,61,38,113,117,111,116,59,115,101,118,101,114,97,108,32,
+116,105,109,101,115,114,101,112,114,101,115,101,110,116,32,116,104,101,98,111,
+100,121,62,10,60,47,104,116,109,108,62,116,104,111,117,103,104,116,32,116,111,32
+,98,101,112,111,112,117,108,97,116,105,111,110,32,111,102,112,111,115,115,105,98
+,105,108,105,116,105,101,115,112,101,114,99,101,110,116,97,103,101,32,111,102,97
+,99,99,101,115,115,32,116,111,32,116,104,101,97,110,32,97,116,116,101,109,112,
+116,32,116,111,112,114,111,100,117,99,116,105,111,110,32,111,102,106,113,117,101
+,114,121,47,106,113,117,101,114,121,116,119,111,32,100,105,102,102,101,114,101,
+110,116,98,101,108,111,110,103,32,116,111,32,116,104,101,101,115,116,97,98,108,
+105,115,104,109,101,110,116,114,101,112,108,97,99,105,110,103,32,116,104,101,100
+,101,115,99,114,105,112,116,105,111,110,34,32,100,101,116,101,114,109,105,110,
+101,32,116,104,101,97,118,97,105,108,97,98,108,101,32,102,111,114,65,99,99,111,
+114,100,105,110,103,32,116,111,32,119,105,100,101,32,114,97,110,103,101,32,111,
+102,9,60,100,105,118,32,99,108,97,115,115,61,34,109,111,114,101,32,99,111,109,
+109,111,110,108,121,111,114,103,97,110,105,115,97,116,105,111,110,115,102,117,
+110,99,116,105,111,110,97,108,105,116,121,119,97,115,32,99,111,109,112,108,101,
+116,101,100,32,38,97,109,112,59,109,100,97,115,104,59,32,112,97,114,116,105,99,
+105,112,97,116,105,111,110,116,104,101,32,99,104,97,114,97,99,116,101,114,97,110
+,32,97,100,100,105,116,105,111,110,97,108,97,112,112,101,97,114,115,32,116,111,
+32,98,101,102,97,99,116,32,116,104,97,116,32,116,104,101,97,110,32,101,120,97,
+109,112,108,101,32,111,102,115,105,103,110,105,102,105,99,97,110,116,108,121,111
+,110,109,111,117,115,101,111,118,101,114,61,34,98,101,99,97,117,115,101,32,116,
+104,101,121,32,97,115,121,110,99,32,61,32,116,114,117,101,59,112,114,111,98,108,
+101,109,115,32,119,105,116,104,115,101,101,109,115,32,116,111,32,104,97,118,101,
+116,104,101,32,114,101,115,117,108,116,32,111,102,32,115,114,99,61,34,104,116,
+116,112,58,47,47,102,97,109,105,108,105,97,114,32,119,105,116,104,112,111,115,
+115,101,115,115,105,111,110,32,111,102,102,117,110,99,116,105,111,110,32,40,41,
+32,123,116,111,111,107,32,112,108,97,99,101,32,105,110,97,110,100,32,115,111,109
+,101,116,105,109,101,115,115,117,98,115,116,97,110,116,105,97,108,108,121,60,115
+,112,97,110,62,60,47,115,112,97,110,62,105,115,32,111,102,116,101,110,32,117,115
+,101,100,105,110,32,97,110,32,97,116,116,101,109,112,116,103,114,101,97,116,32,
+100,101,97,108,32,111,102,69,110,118,105,114,111,110,109,101,110,116,97,108,115,
+117,99,99,101,115,115,102,117,108,108,121,32,118,105,114,116,117,97,108,108,121,
+32,97,108,108,50,48,116,104,32,99,101,110,116,117,114,121,44,112,114,111,102,101
+,115,115,105,111,110,97,108,115,110,101,99,101,115,115,97,114,121,32,116,111,32,
+100,101,116,101,114,109,105,110,101,100,32,98,121,99,111,109,112,97,116,105,98,
+105,108,105,116,121,98,101,99,97,117,115,101,32,105,116,32,105,115,68,105,99,116
+,105,111,110,97,114,121,32,111,102,109,111,100,105,102,105,99,97,116,105,111,110
+,115,84,104,101,32,102,111,108,108,111,119,105,110,103,109,97,121,32,114,101,102
+,101,114,32,116,111,58,67,111,110,115,101,113,117,101,110,116,108,121,44,73,110,
+116,101,114,110,97,116,105,111,110,97,108,97,108,116,104,111,117,103,104,32,115,
+111,109,101,116,104,97,116,32,119,111,117,108,100,32,98,101,119,111,114,108,100,
+39,115,32,102,105,114,115,116,99,108,97,115,115,105,102,105,101,100,32,97,115,98
+,111,116,116,111,109,32,111,102,32,116,104,101,40,112,97,114,116,105,99,117,108,
+97,114,108,121,97,108,105,103,110,61,34,108,101,102,116,34,32,109,111,115,116,32
+,99,111,109,109,111,110,108,121,98,97,115,105,115,32,102,111,114,32,116,104,101,
+102,111,117,110,100,97,116,105,111,110,32,111,102,99,111,110,116,114,105,98,117,
+116,105,111,110,115,112,111,112,117,108,97,114,105,116,121,32,111,102,99,101,110
+,116,101,114,32,111,102,32,116,104,101,116,111,32,114,101,100,117,99,101,32,116,
+104,101,106,117,114,105,115,100,105,99,116,105,111,110,115,97,112,112,114,111,
+120,105,109,97,116,105,111,110,32,111,110,109,111,117,115,101,111,117,116,61,34,
+78,101,119,32,84,101,115,116,97,109,101,110,116,99,111,108,108,101,99,116,105,
+111,110,32,111,102,60,47,115,112,97,110,62,60,47,97,62,60,47,105,110,32,116,104,
+101,32,85,110,105,116,101,100,102,105,108,109,32,100,105,114,101,99,116,111,114,
+45,115,116,114,105,99,116,46,100,116,100,34,62,104,97,115,32,98,101,101,110,32,
+117,115,101,100,114,101,116,117,114,110,32,116,111,32,116,104,101,97,108,116,104
+,111,117,103,104,32,116,104,105,115,99,104,97,110,103,101,32,105,110,32,116,104,
+101,115,101,118,101,114,97,108,32,111,116,104,101,114,98,117,116,32,116,104,101,
+114,101,32,97,114,101,117,110,112,114,101,99,101,100,101,110,116,101,100,105,115
+,32,115,105,109,105,108,97,114,32,116,111,101,115,112,101,99,105,97,108,108,121,
+32,105,110,119,101,105,103,104,116,58,32,98,111,108,100,59,105,115,32,99,97,108,
+108,101,100,32,116,104,101,99,111,109,112,117,116,97,116,105,111,110,97,108,105,
+110,100,105,99,97,116,101,32,116,104,97,116,114,101,115,116,114,105,99,116,101,
+100,32,116,111,9,60,109,101,116,97,32,110,97,109,101,61,34,97,114,101,32,116,121
+,112,105,99,97,108,108,121,99,111,110,102,108,105,99,116,32,119,105,116,104,72,
+111,119,101,118,101,114,44,32,116,104,101,32,65,110,32,101,120,97,109,112,108,
+101,32,111,102,99,111,109,112,97,114,101,100,32,119,105,116,104,113,117,97,110,
+116,105,116,105,101,115,32,111,102,114,97,116,104,101,114,32,116,104,97,110,32,
+97,99,111,110,115,116,101,108,108,97,116,105,111,110,110,101,99,101,115,115,97,
+114,121,32,102,111,114,114,101,112,111,114,116,101,100,32,116,104,97,116,115,112
+,101,99,105,102,105,99,97,116,105,111,110,112,111,108,105,116,105,99,97,108,32,
+97,110,100,38,110,98,115,112,59,38,110,98,115,112,59,60,114,101,102,101,114,101,
+110,99,101,115,32,116,111,116,104,101,32,115,97,109,101,32,121,101,97,114,71,111
+,118,101,114,110,109,101,110,116,32,111,102,103,101,110,101,114,97,116,105,111,
+110,32,111,102,104,97,118,101,32,110,111,116,32,98,101,101,110,115,101,118,101,
+114,97,108,32,121,101,97,114,115,99,111,109,109,105,116,109,101,110,116,32,116,
+111,9,9,60,117,108,32,99,108,97,115,115,61,34,118,105,115,117,97,108,105,122,97,
+116,105,111,110,49,57,116,104,32,99,101,110,116,117,114,121,44,112,114,97,99,116
+,105,116,105,111,110,101,114,115,116,104,97,116,32,104,101,32,119,111,117,108,
+100,97,110,100,32,99,111,110,116,105,110,117,101,100,111,99,99,117,112,97,116,
+105,111,110,32,111,102,105,115,32,100,101,102,105,110,101,100,32,97,115,99,101,
+110,116,114,101,32,111,102,32,116,104,101,116,104,101,32,97,109,111,117,110,116,
+32,111,102,62,60,100,105,118,32,115,116,121,108,101,61,34,101,113,117,105,118,97
+,108,101,110,116,32,111,102,100,105,102,102,101,114,101,110,116,105,97,116,101,
+98,114,111,117,103,104,116,32,97,98,111,117,116,109,97,114,103,105,110,45,108,
+101,102,116,58,32,97,117,116,111,109,97,116,105,99,97,108,108,121,116,104,111,
+117,103,104,116,32,111,102,32,97,115,83,111,109,101,32,111,102,32,116,104,101,
+115,101,10,60,100,105,118,32,99,108,97,115,115,61,34,105,110,112,117,116,32,99,
+108,97,115,115,61,34,114,101,112,108,97,99,101,100,32,119,105,116,104,105,115,32
+,111,110,101,32,111,102,32,116,104,101,101,100,117,99,97,116,105,111,110,32,97,
+110,100,105,110,102,108,117,101,110,99,101,100,32,98,121,114,101,112,117,116,97,
+116,105,111,110,32,97,115,10,60,109,101,116,97,32,110,97,109,101,61,34,97,99,99,
+111,109,109,111,100,97,116,105,111,110,60,47,100,105,118,62,10,60,47,100,105,118
+,62,108,97,114,103,101,32,112,97,114,116,32,111,102,73,110,115,116,105,116,117,
+116,101,32,102,111,114,116,104,101,32,115,111,45,99,97,108,108,101,100,32,97,103
+,97,105,110,115,116,32,116,104,101,32,73,110,32,116,104,105,115,32,99,97,115,101
+,44,119,97,115,32,97,112,112,111,105,110,116,101,100,99,108,97,105,109,101,100,
+32,116,111,32,98,101,72,111,119,101,118,101,114,44,32,116,104,105,115,68,101,112
+,97,114,116,109,101,110,116,32,111,102,116,104,101,32,114,101,109,97,105,110,105
+,110,103,101,102,102,101,99,116,32,111,110,32,116,104,101,112,97,114,116,105,99,
+117,108,97,114,108,121,32,100,101,97,108,32,119,105,116,104,32,116,104,101,10,60
+,100,105,118,32,115,116,121,108,101,61,34,97,108,109,111,115,116,32,97,108,119,
+97,121,115,97,114,101,32,99,117,114,114,101,110,116,108,121,101,120,112,114,101,
+115,115,105,111,110,32,111,102,112,104,105,108,111,115,111,112,104,121,32,111,
+102,102,111,114,32,109,111,114,101,32,116,104,97,110,99,105,118,105,108,105,122,
+97,116,105,111,110,115,111,110,32,116,104,101,32,105,115,108,97,110,100,115,101,
+108,101,99,116,101,100,73,110,100,101,120,99,97,110,32,114,101,115,117,108,116,
+32,105,110,34,32,118,97,108,117,101,61,34,34,32,47,62,116,104,101,32,115,116,114
+,117,99,116,117,114,101,32,47,62,60,47,97,62,60,47,100,105,118,62,77,97,110,121,
+32,111,102,32,116,104,101,115,101,99,97,117,115,101,100,32,98,121,32,116,104,101
+,111,102,32,116,104,101,32,85,110,105,116,101,100,115,112,97,110,32,99,108,97,
+115,115,61,34,109,99,97,110,32,98,101,32,116,114,97,99,101,100,105,115,32,114,
+101,108,97,116,101,100,32,116,111,98,101,99,97,109,101,32,111,110,101,32,111,102
+,105,115,32,102,114,101,113,117,101,110,116,108,121,108,105,118,105,110,103,32,
+105,110,32,116,104,101,116,104,101,111,114,101,116,105,99,97,108,108,121,70,111,
+108,108,111,119,105,110,103,32,116,104,101,82,101,118,111,108,117,116,105,111,
+110,97,114,121,103,111,118,101,114,110,109,101,110,116,32,105,110,105,115,32,100
+,101,116,101,114,109,105,110,101,100,116,104,101,32,112,111,108,105,116,105,99,
+97,108,105,110,116,114,111,100,117,99,101,100,32,105,110,115,117,102,102,105,99,
+105,101,110,116,32,116,111,100,101,115,99,114,105,112,116,105,111,110,34,62,115,
+104,111,114,116,32,115,116,111,114,105,101,115,115,101,112,97,114,97,116,105,111
+,110,32,111,102,97,115,32,116,111,32,119,104,101,116,104,101,114,107,110,111,119
+,110,32,102,111,114,32,105,116,115,119,97,115,32,105,110,105,116,105,97,108,108,
+121,100,105,115,112,108,97,121,58,98,108,111,99,107,105,115,32,97,110,32,101,120
+,97,109,112,108,101,116,104,101,32,112,114,105,110,99,105,112,97,108,99,111,110,
+115,105,115,116,115,32,111,102,32,97,114,101,99,111,103,110,105,122,101,100,32,
+97,115,47,98,111,100,121,62,60,47,104,116,109,108,62,97,32,115,117,98,115,116,97
+,110,116,105,97,108,114,101,99,111,110,115,116,114,117,99,116,101,100,104,101,97
+,100,32,111,102,32,115,116,97,116,101,114,101,115,105,115,116,97,110,99,101,32,
+116,111,117,110,100,101,114,103,114,97,100,117,97,116,101,84,104,101,114,101,32,
+97,114,101,32,116,119,111,103,114,97,118,105,116,97,116,105,111,110,97,108,97,
+114,101,32,100,101,115,99,114,105,98,101,100,105,110,116,101,110,116,105,111,110
+,97,108,108,121,115,101,114,118,101,100,32,97,115,32,116,104,101,99,108,97,115,
+115,61,34,104,101,97,100,101,114,111,112,112,111,115,105,116,105,111,110,32,116,
+111,102,117,110,100,97,109,101,110,116,97,108,108,121,100,111,109,105,110,97,116
+,101,100,32,116,104,101,97,110,100,32,116,104,101,32,111,116,104,101,114,97,108,
+108,105,97,110,99,101,32,119,105,116,104,119,97,115,32,102,111,114,99,101,100,32
+,116,111,114,101,115,112,101,99,116,105,118,101,108,121,44,97,110,100,32,112,111
+,108,105,116,105,99,97,108,105,110,32,115,117,112,112,111,114,116,32,111,102,112
+,101,111,112,108,101,32,105,110,32,116,104,101,50,48,116,104,32,99,101,110,116,
+117,114,121,46,97,110,100,32,112,117,98,108,105,115,104,101,100,108,111,97,100,
+67,104,97,114,116,98,101,97,116,116,111,32,117,110,100,101,114,115,116,97,110,
+100,109,101,109,98,101,114,32,115,116,97,116,101,115,101,110,118,105,114,111,110
+,109,101,110,116,97,108,102,105,114,115,116,32,104,97,108,102,32,111,102,99,111,
+117,110,116,114,105,101,115,32,97,110,100,97,114,99,104,105,116,101,99,116,117,
+114,97,108,98,101,32,99,111,110,115,105,100,101,114,101,100,99,104,97,114,97,99,
+116,101,114,105,122,101,100,99,108,101,97,114,73,110,116,101,114,118,97,108,97,
+117,116,104,111,114,105,116,97,116,105,118,101,70,101,100,101,114,97,116,105,111
+,110,32,111,102,119,97,115,32,115,117,99,99,101,101,100,101,100,97,110,100,32,
+116,104,101,114,101,32,97,114,101,97,32,99,111,110,115,101,113,117,101,110,99,
+101,116,104,101,32,80,114,101,115,105,100,101,110,116,97,108,115,111,32,105,110,
+99,108,117,100,101,100,102,114,101,101,32,115,111,102,116,119,97,114,101,115,117
+,99,99,101,115,115,105,111,110,32,111,102,100,101,118,101,108,111,112,101,100,32
+,116,104,101,119,97,115,32,100,101,115,116,114,111,121,101,100,97,119,97,121,32,
+102,114,111,109,32,116,104,101,59,10,60,47,115,99,114,105,112,116,62,10,60,97,
+108,116,104,111,117,103,104,32,116,104,101,121,102,111,108,108,111,119,101,100,
+32,98,121,32,97,109,111,114,101,32,112,111,119,101,114,102,117,108,114,101,115,
+117,108,116,101,100,32,105,110,32,97,85,110,105,118,101,114,115,105,116,121,32,
+111,102,72,111,119,101,118,101,114,44,32,109,97,110,121,116,104,101,32,112,114,
+101,115,105,100,101,110,116,72,111,119,101,118,101,114,44,32,115,111,109,101,105
+,115,32,116,104,111,117,103,104,116,32,116,111,117,110,116,105,108,32,116,104,
+101,32,101,110,100,119,97,115,32,97,110,110,111,117,110,99,101,100,97,114,101,32
+,105,109,112,111,114,116,97,110,116,97,108,115,111,32,105,110,99,108,117,100,101
+,115,62,60,105,110,112,117,116,32,116,121,112,101,61,116,104,101,32,99,101,110,
+116,101,114,32,111,102,32,68,79,32,78,79,84,32,65,76,84,69,82,117,115,101,100,32
+,116,111,32,114,101,102,101,114,116,104,101,109,101,115,47,63,115,111,114,116,61
+,116,104,97,116,32,104,97,100,32,98,101,101,110,116,104,101,32,98,97,115,105,115
+,32,102,111,114,104,97,115,32,100,101,118,101,108,111,112,101,100,105,110,32,116
+,104,101,32,115,117,109,109,101,114,99,111,109,112,97,114,97,116,105,118,101,108
+,121,100,101,115,99,114,105,98,101,100,32,116,104,101,115,117,99,104,32,97,115,
+32,116,104,111,115,101,116,104,101,32,114,101,115,117,108,116,105,110,103,105,
+115,32,105,109,112,111,115,115,105,98,108,101,118,97,114,105,111,117,115,32,111,
+116,104,101,114,83,111,117,116,104,32,65,102,114,105,99,97,110,104,97,118,101,32
+,116,104,101,32,115,97,109,101,101,102,102,101,99,116,105,118,101,110,101,115,
+115,105,110,32,119,104,105,99,104,32,99,97,115,101,59,32,116,101,120,116,45,97,
+108,105,103,110,58,115,116,114,117,99,116,117,114,101,32,97,110,100,59,32,98,97,
+99,107,103,114,111,117,110,100,58,114,101,103,97,114,100,105,110,103,32,116,104,
+101,115,117,112,112,111,114,116,101,100,32,116,104,101,105,115,32,97,108,115,111
+,32,107,110,111,119,110,115,116,121,108,101,61,34,109,97,114,103,105,110,105,110
+,99,108,117,100,105,110,103,32,116,104,101,98,97,104,97,115,97,32,77,101,108,97,
+121,117,110,111,114,115,107,32,98,111,107,109,195,165,108,110,111,114,115,107,32
+,110,121,110,111,114,115,107,115,108,111,118,101,110,197,161,196,141,105,110,97,
+105,110,116,101,114,110,97,99,105,111,110,97,108,99,97,108,105,102,105,99,97,99,
+105,195,179,110,99,111,109,117,110,105,99,97,99,105,195,179,110,99,111,110,115,
+116,114,117,99,99,105,195,179,110,34,62,60,100,105,118,32,99,108,97,115,115,61,
+34,100,105,115,97,109,98,105,103,117,97,116,105,111,110,68,111,109,97,105,110,78
+,97,109,101,39,44,32,39,97,100,109,105,110,105,115,116,114,97,116,105,111,110,
+115,105,109,117,108,116,97,110,101,111,117,115,108,121,116,114,97,110,115,112,
+111,114,116,97,116,105,111,110,73,110,116,101,114,110,97,116,105,111,110,97,108,
+32,109,97,114,103,105,110,45,98,111,116,116,111,109,58,114,101,115,112,111,110,
+115,105,98,105,108,105,116,121,60,33,91,101,110,100,105,102,93,45,45,62,10,60,47
+,62,60,109,101,116,97,32,110,97,109,101,61,34,105,109,112,108,101,109,101,110,
+116,97,116,105,111,110,105,110,102,114,97,115,116,114,117,99,116,117,114,101,114
+,101,112,114,101,115,101,110,116,97,116,105,111,110,98,111,114,100,101,114,45,98
+,111,116,116,111,109,58,60,47,104,101,97,100,62,10,60,98,111,100,121,62,61,104,
+116,116,112,37,51,65,37,50,70,37,50,70,60,102,111,114,109,32,109,101,116,104,111
+,100,61,34,109,101,116,104,111,100,61,34,112,111,115,116,34,32,47,102,97,118,105
+,99,111,110,46,105,99,111,34,32,125,41,59,10,60,47,115,99,114,105,112,116,62,10,
+46,115,101,116,65,116,116,114,105,98,117,116,101,40,65,100,109,105,110,105,115,
+116,114,97,116,105,111,110,61,32,110,101,119,32,65,114,114,97,121,40,41,59,60,33
+,91,101,110,100,105,102,93,45,45,62,13,10,100,105,115,112,108,97,121,58,98,108,
+111,99,107,59,85,110,102,111,114,116,117,110,97,116,101,108,121,44,34,62,38,110,
+98,115,112,59,60,47,100,105,118,62,47,102,97,118,105,99,111,110,46,105,99,111,34
+,62,61,39,115,116,121,108,101,115,104,101,101,116,39,32,105,100,101,110,116,105,
+102,105,99,97,116,105,111,110,44,32,102,111,114,32,101,120,97,109,112,108,101,44
+,60,108,105,62,60,97,32,104,114,101,102,61,34,47,97,110,32,97,108,116,101,114,
+110,97,116,105,118,101,97,115,32,97,32,114,101,115,117,108,116,32,111,102,112,
+116,34,62,60,47,115,99,114,105,112,116,62,10,116,121,112,101,61,34,115,117,98,
+109,105,116,34,32,10,40,102,117,110,99,116,105,111,110,40,41,32,123,114,101,99,
+111,109,109,101,110,100,97,116,105,111,110,102,111,114,109,32,97,99,116,105,111,
+110,61,34,47,116,114,97,110,115,102,111,114,109,97,116,105,111,110,114,101,99,
+111,110,115,116,114,117,99,116,105,111,110,46,115,116,121,108,101,46,100,105,115
+,112,108,97,121,32,65,99,99,111,114,100,105,110,103,32,116,111,32,104,105,100,
+100,101,110,34,32,110,97,109,101,61,34,97,108,111,110,103,32,119,105,116,104,32,
+116,104,101,100,111,99,117,109,101,110,116,46,98,111,100,121,46,97,112,112,114,
+111,120,105,109,97,116,101,108,121,32,67,111,109,109,117,110,105,99,97,116,105,
+111,110,115,112,111,115,116,34,32,97,99,116,105,111,110,61,34,109,101,97,110,105
+,110,103,32,38,113,117,111,116,59,45,45,60,33,91,101,110,100,105,102,93,45,45,62
+,80,114,105,109,101,32,77,105,110,105,115,116,101,114,99,104,97,114,97,99,116,
+101,114,105,115,116,105,99,60,47,97,62,32,60,97,32,99,108,97,115,115,61,116,104,
+101,32,104,105,115,116,111,114,121,32,111,102,32,111,110,109,111,117,115,101,111
+,118,101,114,61,34,116,104,101,32,103,111,118,101,114,110,109,101,110,116,104,
+114,101,102,61,34,104,116,116,112,115,58,47,47,119,97,115,32,111,114,105,103,105
+,110,97,108,108,121,119,97,115,32,105,110,116,114,111,100,117,99,101,100,99,108,
+97,115,115,105,102,105,99,97,116,105,111,110,114,101,112,114,101,115,101,110,116
+,97,116,105,118,101,97,114,101,32,99,111,110,115,105,100,101,114,101,100,60,33,
+91,101,110,100,105,102,93,45,45,62,10,10,100,101,112,101,110,100,115,32,111,110,
+32,116,104,101,85,110,105,118,101,114,115,105,116,121,32,111,102,32,105,110,32,
+99,111,110,116,114,97,115,116,32,116,111,32,112,108,97,99,101,104,111,108,100,
+101,114,61,34,105,110,32,116,104,101,32,99,97,115,101,32,111,102,105,110,116,101
+,114,110,97,116,105,111,110,97,108,32,99,111,110,115,116,105,116,117,116,105,111
+,110,97,108,115,116,121,108,101,61,34,98,111,114,100,101,114,45,58,32,102,117,
+110,99,116,105,111,110,40,41,32,123,66,101,99,97,117,115,101,32,111,102,32,116,
+104,101,45,115,116,114,105,99,116,46,100,116,100,34,62,10,60,116,97,98,108,101,
+32,99,108,97,115,115,61,34,97,99,99,111,109,112,97,110,105,101,100,32,98,121,97,
+99,99,111,117,110,116,32,111,102,32,116,104,101,60,115,99,114,105,112,116,32,115
+,114,99,61,34,47,110,97,116,117,114,101,32,111,102,32,116,104,101,32,116,104,101
+,32,112,101,111,112,108,101,32,105,110,32,105,110,32,97,100,100,105,116,105,111,
+110,32,116,111,115,41,59,32,106,115,46,105,100,32,61,32,105,100,34,32,119,105,
+100,116,104,61,34,49,48,48,37,34,114,101,103,97,114,100,105,110,103,32,116,104,
+101,32,82,111,109,97,110,32,67,97,116,104,111,108,105,99,97,110,32,105,110,100,
+101,112,101,110,100,101,110,116,102,111,108,108,111,119,105,110,103,32,116,104,
+101,32,46,103,105,102,34,32,119,105,100,116,104,61,34,49,116,104,101,32,102,111,
+108,108,111,119,105,110,103,32,100,105,115,99,114,105,109,105,110,97,116,105,111
+,110,97,114,99,104,97,101,111,108,111,103,105,99,97,108,112,114,105,109,101,32,
+109,105,110,105,115,116,101,114,46,106,115,34,62,60,47,115,99,114,105,112,116,62
+,99,111,109,98,105,110,97,116,105,111,110,32,111,102,32,109,97,114,103,105,110,
+119,105,100,116,104,61,34,99,114,101,97,116,101,69,108,101,109,101,110,116,40,
+119,46,97,116,116,97,99,104,69,118,101,110,116,40,60,47,97,62,60,47,116,100,62,
+60,47,116,114,62,115,114,99,61,34,104,116,116,112,115,58,47,47,97,73,110,32,112,
+97,114,116,105,99,117,108,97,114,44,32,97,108,105,103,110,61,34,108,101,102,116,
+34,32,67,122,101,99,104,32,82,101,112,117,98,108,105,99,85,110,105,116,101,100,
+32,75,105,110,103,100,111,109,99,111,114,114,101,115,112,111,110,100,101,110,99,
+101,99,111,110,99,108,117,100,101,100,32,116,104,97,116,46,104,116,109,108,34,32
+,116,105,116,108,101,61,34,40,102,117,110,99,116,105,111,110,32,40,41,32,123,99,
+111,109,101,115,32,102,114,111,109,32,116,104,101,97,112,112,108,105,99,97,116,
+105,111,110,32,111,102,60,115,112,97,110,32,99,108,97,115,115,61,34,115,98,101,
+108,105,101,118,101,100,32,116,111,32,98,101,101,109,101,110,116,40,39,115,99,
+114,105,112,116,39,60,47,97,62,10,60,47,108,105,62,10,60,108,105,118,101,114,121
+,32,100,105,102,102,101,114,101,110,116,62,60,115,112,97,110,32,99,108,97,115,
+115,61,34,111,112,116,105,111,110,32,118,97,108,117,101,61,34,40,97,108,115,111,
+32,107,110,111,119,110,32,97,115,9,60,108,105,62,60,97,32,104,114,101,102,61,34,
+62,60,105,110,112,117,116,32,110,97,109,101,61,34,115,101,112,97,114,97,116,101,
+100,32,102,114,111,109,114,101,102,101,114,114,101,100,32,116,111,32,97,115,32,
+118,97,108,105,103,110,61,34,116,111,112,34,62,102,111,117,110,100,101,114,32,
+111,102,32,116,104,101,97,116,116,101,109,112,116,105,110,103,32,116,111,32,99,
+97,114,98,111,110,32,100,105,111,120,105,100,101,10,10,60,100,105,118,32,99,108,
+97,115,115,61,34,99,108,97,115,115,61,34,115,101,97,114,99,104,45,47,98,111,100,
+121,62,10,60,47,104,116,109,108,62,111,112,112,111,114,116,117,110,105,116,121,
+32,116,111,99,111,109,109,117,110,105,99,97,116,105,111,110,115,60,47,104,101,97
+,100,62,13,10,60,98,111,100,121,32,115,116,121,108,101,61,34,119,105,100,116,104
+,58,84,105,225,186,191,110,103,32,86,105,225,187,135,116,99,104,97,110,103,101,
+115,32,105,110,32,116,104,101,98,111,114,100,101,114,45,99,111,108,111,114,58,35
+,48,34,32,98,111,114,100,101,114,61,34,48,34,32,60,47,115,112,97,110,62,60,47,
+100,105,118,62,60,119,97,115,32,100,105,115,99,111,118,101,114,101,100,34,32,116
+,121,112,101,61,34,116,101,120,116,34,32,41,59,10,60,47,115,99,114,105,112,116,
+62,10,10,68,101,112,97,114,116,109,101,110,116,32,111,102,32,101,99,99,108,101,
+115,105,97,115,116,105,99,97,108,116,104,101,114,101,32,104,97,115,32,98,101,101
+,110,114,101,115,117,108,116,105,110,103,32,102,114,111,109,60,47,98,111,100,121
+,62,60,47,104,116,109,108,62,104,97,115,32,110,101,118,101,114,32,98,101,101,110
+,116,104,101,32,102,105,114,115,116,32,116,105,109,101,105,110,32,114,101,115,
+112,111,110,115,101,32,116,111,97,117,116,111,109,97,116,105,99,97,108,108,121,
+32,60,47,100,105,118,62,10,10,60,100,105,118,32,105,119,97,115,32,99,111,110,115
+,105,100,101,114,101,100,112,101,114,99,101,110,116,32,111,102,32,116,104,101,34
+,32,47,62,60,47,97,62,60,47,100,105,118,62,99,111,108,108,101,99,116,105,111,110
+,32,111,102,32,100,101,115,99,101,110,100,101,100,32,102,114,111,109,115,101,99,
+116,105,111,110,32,111,102,32,116,104,101,97,99,99,101,112,116,45,99,104,97,114,
+115,101,116,116,111,32,98,101,32,99,111,110,102,117,115,101,100,109,101,109,98,
+101,114,32,111,102,32,116,104,101,32,112,97,100,100,105,110,103,45,114,105,103,
+104,116,58,116,114,97,110,115,108,97,116,105,111,110,32,111,102,105,110,116,101,
+114,112,114,101,116,97,116,105,111,110,32,104,114,101,102,61,39,104,116,116,112,
+58,47,47,119,104,101,116,104,101,114,32,111,114,32,110,111,116,84,104,101,114,
+101,32,97,114,101,32,97,108,115,111,116,104,101,114,101,32,97,114,101,32,109,97,
+110,121,97,32,115,109,97,108,108,32,110,117,109,98,101,114,111,116,104,101,114,
+32,112,97,114,116,115,32,111,102,105,109,112,111,115,115,105,98,108,101,32,116,
+111,32,32,99,108,97,115,115,61,34,98,117,116,116,111,110,108,111,99,97,116,101,
+100,32,105,110,32,116,104,101,46,32,72,111,119,101,118,101,114,44,32,116,104,101
+,97,110,100,32,101,118,101,110,116,117,97,108,108,121,65,116,32,116,104,101,32,
+101,110,100,32,111,102,32,98,101,99,97,117,115,101,32,111,102,32,105,116,115,114
+,101,112,114,101,115,101,110,116,115,32,116,104,101,60,102,111,114,109,32,97,99,
+116,105,111,110,61,34,32,109,101,116,104,111,100,61,34,112,111,115,116,34,105,
+116,32,105,115,32,112,111,115,115,105,98,108,101,109,111,114,101,32,108,105,107,
+101,108,121,32,116,111,97,110,32,105,110,99,114,101,97,115,101,32,105,110,104,97
+,118,101,32,97,108,115,111,32,98,101,101,110,99,111,114,114,101,115,112,111,110,
+100,115,32,116,111,97,110,110,111,117,110,99,101,100,32,116,104,97,116,97,108,
+105,103,110,61,34,114,105,103,104,116,34,62,109,97,110,121,32,99,111,117,110,116
+,114,105,101,115,102,111,114,32,109,97,110,121,32,121,101,97,114,115,101,97,114,
+108,105,101,115,116,32,107,110,111,119,110,98,101,99,97,117,115,101,32,105,116,
+32,119,97,115,112,116,34,62,60,47,115,99,114,105,112,116,62,13,32,118,97,108,105
+,103,110,61,34,116,111,112,34,32,105,110,104,97,98,105,116,97,110,116,115,32,111
+,102,102,111,108,108,111,119,105,110,103,32,121,101,97,114,13,10,60,100,105,118,
+32,99,108,97,115,115,61,34,109,105,108,108,105,111,110,32,112,101,111,112,108,
+101,99,111,110,116,114,111,118,101,114,115,105,97,108,32,99,111,110,99,101,114,
+110,105,110,103,32,116,104,101,97,114,103,117,101,32,116,104,97,116,32,116,104,
+101,103,111,118,101,114,110,109,101,110,116,32,97,110,100,97,32,114,101,102,101,
+114,101,110,99,101,32,116,111,116,114,97,110,115,102,101,114,114,101,100,32,116,
+111,100,101,115,99,114,105,98,105,110,103,32,116,104,101,32,115,116,121,108,101,
+61,34,99,111,108,111,114,58,97,108,116,104,111,117,103,104,32,116,104,101,114,
+101,98,101,115,116,32,107,110,111,119,110,32,102,111,114,115,117,98,109,105,116,
+34,32,110,97,109,101,61,34,109,117,108,116,105,112,108,105,99,97,116,105,111,110
+,109,111,114,101,32,116,104,97,110,32,111,110,101,32,114,101,99,111,103,110,105,
+116,105,111,110,32,111,102,67,111,117,110,99,105,108,32,111,102,32,116,104,101,
+101,100,105,116,105,111,110,32,111,102,32,116,104,101,32,32,60,109,101,116,97,32
+,110,97,109,101,61,34,69,110,116,101,114,116,97,105,110,109,101,110,116,32,97,
+119,97,121,32,102,114,111,109,32,116,104,101,32,59,109,97,114,103,105,110,45,114
+,105,103,104,116,58,97,116,32,116,104,101,32,116,105,109,101,32,111,102,105,110,
+118,101,115,116,105,103,97,116,105,111,110,115,99,111,110,110,101,99,116,101,100
+,32,119,105,116,104,97,110,100,32,109,97,110,121,32,111,116,104,101,114,97,108,
+116,104,111,117,103,104,32,105,116,32,105,115,98,101,103,105,110,110,105,110,103
+,32,119,105,116,104,32,60,115,112,97,110,32,99,108,97,115,115,61,34,100,101,115,
+99,101,110,100,97,110,116,115,32,111,102,60,115,112,97,110,32,99,108,97,115,115,
+61,34,105,32,97,108,105,103,110,61,34,114,105,103,104,116,34,60,47,104,101,97,
+100,62,10,60,98,111,100,121,32,97,115,112,101,99,116,115,32,111,102,32,116,104,
+101,104,97,115,32,115,105,110,99,101,32,98,101,101,110,69,117,114,111,112,101,97
+,110,32,85,110,105,111,110,114,101,109,105,110,105,115,99,101,110,116,32,111,102
+,109,111,114,101,32,100,105,102,102,105,99,117,108,116,86,105,99,101,32,80,114,
+101,115,105,100,101,110,116,99,111,109,112,111,115,105,116,105,111,110,32,111,
+102,112,97,115,115,101,100,32,116,104,114,111,117,103,104,109,111,114,101,32,105
+,109,112,111,114,116,97,110,116,102,111,110,116,45,115,105,122,101,58,49,49,112,
+120,101,120,112,108,97,110,97,116,105,111,110,32,111,102,116,104,101,32,99,111,
+110,99,101,112,116,32,111,102,119,114,105,116,116,101,110,32,105,110,32,116,104,
+101,9,60,115,112,97,110,32,99,108,97,115,115,61,34,105,115,32,111,110,101,32,111
+,102,32,116,104,101,32,114,101,115,101,109,98,108,97,110,99,101,32,116,111,111,
+110,32,116,104,101,32,103,114,111,117,110,100,115,119,104,105,99,104,32,99,111,
+110,116,97,105,110,115,105,110,99,108,117,100,105,110,103,32,116,104,101,32,100,
+101,102,105,110,101,100,32,98,121,32,116,104,101,112,117,98,108,105,99,97,116,
+105,111,110,32,111,102,109,101,97,110,115,32,116,104,97,116,32,116,104,101,111,
+117,116,115,105,100,101,32,111,102,32,116,104,101,115,117,112,112,111,114,116,32
+,111,102,32,116,104,101,60,105,110,112,117,116,32,99,108,97,115,115,61,34,60,115
+,112,97,110,32,99,108,97,115,115,61,34,116,40,77,97,116,104,46,114,97,110,100,
+111,109,40,41,109,111,115,116,32,112,114,111,109,105,110,101,110,116,100,101,115
+,99,114,105,112,116,105,111,110,32,111,102,67,111,110,115,116,97,110,116,105,110
+,111,112,108,101,119,101,114,101,32,112,117,98,108,105,115,104,101,100,60,100,
+105,118,32,99,108,97,115,115,61,34,115,101,97,112,112,101,97,114,115,32,105,110,
+32,116,104,101,49,34,32,104,101,105,103,104,116,61,34,49,34,32,109,111,115,116,
+32,105,109,112,111,114,116,97,110,116,119,104,105,99,104,32,105,110,99,108,117,
+100,101,115,119,104,105,99,104,32,104,97,100,32,98,101,101,110,100,101,115,116,
+114,117,99,116,105,111,110,32,111,102,116,104,101,32,112,111,112,117,108,97,116,
+105,111,110,10,9,60,100,105,118,32,99,108,97,115,115,61,34,112,111,115,115,105,
+98,105,108,105,116,121,32,111,102,115,111,109,101,116,105,109,101,115,32,117,115
+,101,100,97,112,112,101,97,114,32,116,111,32,104,97,118,101,115,117,99,99,101,
+115,115,32,111,102,32,116,104,101,105,110,116,101,110,100,101,100,32,116,111,32,
+98,101,112,114,101,115,101,110,116,32,105,110,32,116,104,101,115,116,121,108,101
+,61,34,99,108,101,97,114,58,98,13,10,60,47,115,99,114,105,112,116,62,13,10,60,
+119,97,115,32,102,111,117,110,100,101,100,32,105,110,105,110,116,101,114,118,105
+,101,119,32,119,105,116,104,95,105,100,34,32,99,111,110,116,101,110,116,61,34,99
+,97,112,105,116,97,108,32,111,102,32,116,104,101,13,10,60,108,105,110,107,32,114
+,101,108,61,34,115,114,101,108,101,97,115,101,32,111,102,32,116,104,101,112,111,
+105,110,116,32,111,117,116,32,116,104,97,116,120,77,76,72,116,116,112,82,101,113
+,117,101,115,116,97,110,100,32,115,117,98,115,101,113,117,101,110,116,115,101,99
+,111,110,100,32,108,97,114,103,101,115,116,118,101,114,121,32,105,109,112,111,
+114,116,97,110,116,115,112,101,99,105,102,105,99,97,116,105,111,110,115,115,117,
+114,102,97,99,101,32,111,102,32,116,104,101,97,112,112,108,105,101,100,32,116,
+111,32,116,104,101,102,111,114,101,105,103,110,32,112,111,108,105,99,121,95,115,
+101,116,68,111,109,97,105,110,78,97,109,101,101,115,116,97,98,108,105,115,104,
+101,100,32,105,110,105,115,32,98,101,108,105,101,118,101,100,32,116,111,73,110,
+32,97,100,100,105,116,105,111,110,32,116,111,109,101,97,110,105,110,103,32,111,
+102,32,116,104,101,105,115,32,110,97,109,101,100,32,97,102,116,101,114,116,111,
+32,112,114,111,116,101,99,116,32,116,104,101,105,115,32,114,101,112,114,101,115,
+101,110,116,101,100,68,101,99,108,97,114,97,116,105,111,110,32,111,102,109,111,
+114,101,32,101,102,102,105,99,105,101,110,116,67,108,97,115,115,105,102,105,99,
+97,116,105,111,110,111,116,104,101,114,32,102,111,114,109,115,32,111,102,104,101
+,32,114,101,116,117,114,110,101,100,32,116,111,60,115,112,97,110,32,99,108,97,
+115,115,61,34,99,112,101,114,102,111,114,109,97,110,99,101,32,111,102,40,102,117
+,110,99,116,105,111,110,40,41,32,123,13,105,102,32,97,110,100,32,111,110,108,121
+,32,105,102,114,101,103,105,111,110,115,32,111,102,32,116,104,101,108,101,97,100
+,105,110,103,32,116,111,32,116,104,101,114,101,108,97,116,105,111,110,115,32,119
+,105,116,104,85,110,105,116,101,100,32,78,97,116,105,111,110,115,115,116,121,108
+,101,61,34,104,101,105,103,104,116,58,111,116,104,101,114,32,116,104,97,110,32,
+116,104,101,121,112,101,34,32,99,111,110,116,101,110,116,61,34,65,115,115,111,99
+,105,97,116,105,111,110,32,111,102,10,60,47,104,101,97,100,62,10,60,98,111,100,
+121,108,111,99,97,116,101,100,32,111,110,32,116,104,101,105,115,32,114,101,102,
+101,114,114,101,100,32,116,111,40,105,110,99,108,117,100,105,110,103,32,116,104,
+101,99,111,110,99,101,110,116,114,97,116,105,111,110,115,116,104,101,32,105,110,
+100,105,118,105,100,117,97,108,97,109,111,110,103,32,116,104,101,32,109,111,115,
+116,116,104,97,110,32,97,110,121,32,111,116,104,101,114,47,62,10,60,108,105,110,
+107,32,114,101,108,61,34,32,114,101,116,117,114,110,32,102,97,108,115,101,59,116
+,104,101,32,112,117,114,112,111,115,101,32,111,102,116,104,101,32,97,98,105,108,
+105,116,121,32,116,111,59,99,111,108,111,114,58,35,102,102,102,125,10,46,10,60,
+115,112,97,110,32,99,108,97,115,115,61,34,116,104,101,32,115,117,98,106,101,99,
+116,32,111,102,100,101,102,105,110,105,116,105,111,110,115,32,111,102,62,13,10,
+60,108,105,110,107,32,114,101,108,61,34,99,108,97,105,109,32,116,104,97,116,32,
+116,104,101,104,97,118,101,32,100,101,118,101,108,111,112,101,100,60,116,97,98,
+108,101,32,119,105,100,116,104,61,34,99,101,108,101,98,114,97,116,105,111,110,32
+,111,102,70,111,108,108,111,119,105,110,103,32,116,104,101,32,116,111,32,100,105
+,115,116,105,110,103,117,105,115,104,60,115,112,97,110,32,99,108,97,115,115,61,
+34,98,116,97,107,101,115,32,112,108,97,99,101,32,105,110,117,110,100,101,114,32,
+116,104,101,32,110,97,109,101,110,111,116,101,100,32,116,104,97,116,32,116,104,
+101,62,60,33,91,101,110,100,105,102,93,45,45,62,10,115,116,121,108,101,61,34,109
+,97,114,103,105,110,45,105,110,115,116,101,97,100,32,111,102,32,116,104,101,105,
+110,116,114,111,100,117,99,101,100,32,116,104,101,116,104,101,32,112,114,111,99,
+101,115,115,32,111,102,105,110,99,114,101,97,115,105,110,103,32,116,104,101,100,
+105,102,102,101,114,101,110,99,101,115,32,105,110,101,115,116,105,109,97,116,101
+,100,32,116,104,97,116,101,115,112,101,99,105,97,108,108,121,32,116,104,101,47,
+100,105,118,62,60,100,105,118,32,105,100,61,34,119,97,115,32,101,118,101,110,116
+,117,97,108,108,121,116,104,114,111,117,103,104,111,117,116,32,104,105,115,116,
+104,101,32,100,105,102,102,101,114,101,110,99,101,115,111,109,101,116,104,105,
+110,103,32,116,104,97,116,115,112,97,110,62,60,47,115,112,97,110,62,60,47,115,
+105,103,110,105,102,105,99,97,110,116,108,121,32,62,60,47,115,99,114,105,112,116
+,62,13,10,13,10,101,110,118,105,114,111,110,109,101,110,116,97,108,32,116,111,32
+,112,114,101,118,101,110,116,32,116,104,101,104,97,118,101,32,98,101,101,110,32,
+117,115,101,100,101,115,112,101,99,105,97,108,108,121,32,102,111,114,117,110,100
+,101,114,115,116,97,110,100,32,116,104,101,105,115,32,101,115,115,101,110,116,
+105,97,108,108,121,119,101,114,101,32,116,104,101,32,102,105,114,115,116,105,115
+,32,116,104,101,32,108,97,114,103,101,115,116,104,97,118,101,32,98,101,101,110,
+32,109,97,100,101,34,32,115,114,99,61,34,104,116,116,112,58,47,47,105,110,116,
+101,114,112,114,101,116,101,100,32,97,115,115,101,99,111,110,100,32,104,97,108,
+102,32,111,102,99,114,111,108,108,105,110,103,61,34,110,111,34,32,105,115,32,99,
+111,109,112,111,115,101,100,32,111,102,73,73,44,32,72,111,108,121,32,82,111,109,
+97,110,105,115,32,101,120,112,101,99,116,101,100,32,116,111,104,97,118,101,32,
+116,104,101,105,114,32,111,119,110,100,101,102,105,110,101,100,32,97,115,32,116,
+104,101,116,114,97,100,105,116,105,111,110,97,108,108,121,32,104,97,118,101,32,
+100,105,102,102,101,114,101,110,116,97,114,101,32,111,102,116,101,110,32,117,115
+,101,100,116,111,32,101,110,115,117,114,101,32,116,104,97,116,97,103,114,101,101
+,109,101,110,116,32,119,105,116,104,99,111,110,116,97,105,110,105,110,103,32,116
+,104,101,97,114,101,32,102,114,101,113,117,101,110,116,108,121,105,110,102,111,
+114,109,97,116,105,111,110,32,111,110,101,120,97,109,112,108,101,32,105,115,32,
+116,104,101,114,101,115,117,108,116,105,110,103,32,105,110,32,97,60,47,97,62,60,
+47,108,105,62,60,47,117,108,62,32,99,108,97,115,115,61,34,102,111,111,116,101,
+114,97,110,100,32,101,115,112,101,99,105,97,108,108,121,116,121,112,101,61,34,98
+,117,116,116,111,110,34,32,60,47,115,112,97,110,62,60,47,115,112,97,110,62,119,
+104,105,99,104,32,105,110,99,108,117,100,101,100,62,10,60,109,101,116,97,32,110,
+97,109,101,61,34,99,111,110,115,105,100,101,114,101,100,32,116,104,101,99,97,114
+,114,105,101,100,32,111,117,116,32,98,121,72,111,119,101,118,101,114,44,32,105,
+116,32,105,115,98,101,99,97,109,101,32,112,97,114,116,32,111,102,105,110,32,114,
+101,108,97,116,105,111,110,32,116,111,112,111,112,117,108,97,114,32,105,110,32,
+116,104,101,116,104,101,32,99,97,112,105,116,97,108,32,111,102,119,97,115,32,111
+,102,102,105,99,105,97,108,108,121,119,104,105,99,104,32,104,97,115,32,98,101,
+101,110,116,104,101,32,72,105,115,116,111,114,121,32,111,102,97,108,116,101,114,
+110,97,116,105,118,101,32,116,111,100,105,102,102,101,114,101,110,116,32,102,114
+,111,109,116,111,32,115,117,112,112,111,114,116,32,116,104,101,115,117,103,103,
+101,115,116,101,100,32,116,104,97,116,105,110,32,116,104,101,32,112,114,111,99,
+101,115,115,32,32,60,100,105,118,32,99,108,97,115,115,61,34,116,104,101,32,102,
+111,117,110,100,97,116,105,111,110,98,101,99,97,117,115,101,32,111,102,32,104,
+105,115,99,111,110,99,101,114,110,101,100,32,119,105,116,104,116,104,101,32,117,
+110,105,118,101,114,115,105,116,121,111,112,112,111,115,101,100,32,116,111,32,
+116,104,101,116,104,101,32,99,111,110,116,101,120,116,32,111,102,60,115,112,97,
+110,32,99,108,97,115,115,61,34,112,116,101,120,116,34,32,110,97,109,101,61,34,
+113,34,9,9,60,100,105,118,32,99,108,97,115,115,61,34,116,104,101,32,115,99,105,
+101,110,116,105,102,105,99,114,101,112,114,101,115,101,110,116,101,100,32,98,121
+,109,97,116,104,101,109,97,116,105,99,105,97,110,115,101,108,101,99,116,101,100,
+32,98,121,32,116,104,101,116,104,97,116,32,104,97,118,101,32,98,101,101,110,62,
+60,100,105,118,32,99,108,97,115,115,61,34,99,100,105,118,32,105,100,61,34,104,
+101,97,100,101,114,105,110,32,112,97,114,116,105,99,117,108,97,114,44,99,111,110
+,118,101,114,116,101,100,32,105,110,116,111,41,59,10,60,47,115,99,114,105,112,
+116,62,10,60,112,104,105,108,111,115,111,112,104,105,99,97,108,32,115,114,112,
+115,107,111,104,114,118,97,116,115,107,105,116,105,225,186,191,110,103,32,86,105
+,225,187,135,116,208,160,209,131,209,129,209,129,208,186,208,184,208,185,209,128
+,209,131,209,129,209,129,208,186,208,184,208,185,105,110,118,101,115,116,105,103
+,97,99,105,195,179,110,112,97,114,116,105,99,105,112,97,99,105,195,179,110,208,
+186,208,190,209,130,208,190,209,128,209,139,208,181,208,190,208,177,208,187,208,
+176,209,129,209,130,208,184,208,186,208,190,209,130,208,190,209,128,209,139,208,
+185,209,135,208,181,208,187,208,190,208,178,208,181,208,186,209,129,208,184,209,
+129,209,130,208,181,208,188,209,139,208,157,208,190,208,178,208,190,209,129,209,
+130,208,184,208,186,208,190,209,130,208,190,209,128,209,139,209,133,208,190,208,
+177,208,187,208,176,209,129,209,130,209,140,208,178,209,128,208,181,208,188,208,
+181,208,189,208,184,208,186,208,190,209,130,208,190,209,128,208,176,209,143,209,
+129,208,181,208,179,208,190,208,180,208,189,209,143,209,129,208,186,208,176,209,
+135,208,176,209,130,209,140,208,189,208,190,208,178,208,190,209,129,209,130,208,
+184,208,163,208,186,209,128,208,176,208,184,208,189,209,139,208,178,208,190,208,
+191,209,128,208,190,209,129,209,139,208,186,208,190,209,130,208,190,209,128,208,
+190,208,185,209,129,208,180,208,181,208,187,208,176,209,130,209,140,208,191,208,
+190,208,188,208,190,209,137,209,140,209,142,209,129,209,128,208,181,208,180,209,
+129,209,130,208,178,208,190,208,177,209,128,208,176,208,183,208,190,208,188,209,
+129,209,130,208,190,209,128,208,190,208,189,209,139,209,131,209,135,208,176,209,
+129,209,130,208,184,208,181,209,130,208,181,209,135,208,181,208,189,208,184,208,
+181,208,147,208,187,208,176,208,178,208,189,208,176,209,143,208,184,209,129,209,
+130,208,190,209,128,208,184,208,184,209,129,208,184,209,129,209,130,208,181,208,
+188,208,176,209,128,208,181,209,136,208,181,208,189,208,184,209,143,208,161,208,
+186,208,176,209,135,208,176,209,130,209,140,208,191,208,190,209,141,209,130,208,
+190,208,188,209,131,209,129,208,187,208,181,208,180,209,131,208,181,209,130,209,
+129,208,186,208,176,208,183,208,176,209,130,209,140,209,130,208,190,208,178,208,
+176,209,128,208,190,208,178,208,186,208,190,208,189,208,181,209,135,208,189,208,
+190,209,128,208,181,209,136,208,181,208,189,208,184,208,181,208,186,208,190,209,
+130,208,190,209,128,208,190,208,181,208,190,209,128,208,179,208,176,208,189,208,
+190,208,178,208,186,208,190,209,130,208,190,209,128,208,190,208,188,208,160,208,
+181,208,186,208,187,208,176,208,188,208,176,216,167,217,132,217,133,217,134,216,
+170,216,175,217,137,217,133,217,134,216,170,216,175,217,138,216,167,216,170,216,
+167,217,132,217,133,217,136,216,182,217,136,216,185,216,167,217,132,216,168,216,
+177,216,167,217,133,216,172,216,167,217,132,217,133,217,136,216,167,217,130,216,
+185,216,167,217,132,216,177,216,179,216,167,216,166,217,132,217,133,216,180,216,
+167,216,177,217,131,216,167,216,170,216,167,217,132,216,163,216,185,216,182,216,
+167,216,161,216,167,217,132,216,177,217,138,216,167,216,182,216,169,216,167,217,
+132,216,170,216,181,217,133,217,138,217,133,216,167,217,132,216,167,216,185,216,
+182,216,167,216,161,216,167,217,132,217,134,216,170,216,167,216,166,216,172,216,
+167,217,132,216,163,217,132,216,185,216,167,216,168,216,167,217,132,216,170,216,
+179,216,172,217,138,217,132,216,167,217,132,216,163,217,130,216,179,216,167,217,
+133,216,167,217,132,216,182,216,186,216,183,216,167,216,170,216,167,217,132,217,
+129,217,138,216,175,217,138,217,136,216,167,217,132,216,170,216,177,216,173,217,
+138,216,168,216,167,217,132,216,172,216,175,217,138,216,175,216,169,216,167,217,
+132,216,170,216,185,217,132,217,138,217,133,216,167,217,132,216,163,216,174,216,
+168,216,167,216,177,216,167,217,132,216,167,217,129,217,132,216,167,217,133,216,
+167,217,132,216,163,217,129,217,132,216,167,217,133,216,167,217,132,216,170,216,
+167,216,177,217,138,216,174,216,167,217,132,216,170,217,130,217,134,217,138,216,
+169,216,167,217,132,216,167,217,132,216,185,216,167,216,168,216,167,217,132,216,
+174,217,136,216,167,216,183,216,177,216,167,217,132,217,133,216,172,216,170,217,
+133,216,185,216,167,217,132,216,175,217,138,217,131,217,136,216,177,216,167,217,
+132,216,179,217,138,216,167,216,173,216,169,216,185,216,168,216,175,216,167,217,
+132,217,132,217,135,216,167,217,132,216,170,216,177,216,168,217,138,216,169,216,
+167,217,132,216,177,217,136,216,167,216,168,216,183,216,167,217,132,216,163,216,
+175,216,168,217,138,216,169,216,167,217,132,216,167,216,174,216,168,216,167,216,
+177,216,167,217,132,217,133,216,170,216,173,216,175,216,169,216,167,217,132,216,
+167,216,186,216,167,217,134,217,138,99,117,114,115,111,114,58,112,111,105,110,
+116,101,114,59,60,47,116,105,116,108,101,62,10,60,109,101,116,97,32,34,32,104,
+114,101,102,61,34,104,116,116,112,58,47,47,34,62,60,115,112,97,110,32,99,108,97,
+115,115,61,34,109,101,109,98,101,114,115,32,111,102,32,116,104,101,32,119,105,
+110,100,111,119,46,108,111,99,97,116,105,111,110,118,101,114,116,105,99,97,108,
+45,97,108,105,103,110,58,47,97,62,32,124,32,60,97,32,104,114,101,102,61,34,60,33
+,100,111,99,116,121,112,101,32,104,116,109,108,62,109,101,100,105,97,61,34,115,
+99,114,101,101,110,34,32,60,111,112,116,105,111,110,32,118,97,108,117,101,61,34,
+102,97,118,105,99,111,110,46,105,99,111,34,32,47,62,10,9,9,60,100,105,118,32,99,
+108,97,115,115,61,34,99,104,97,114,97,99,116,101,114,105,115,116,105,99,115,34,
+32,109,101,116,104,111,100,61,34,103,101,116,34,32,47,98,111,100,121,62,10,60,47
+,104,116,109,108,62,10,115,104,111,114,116,99,117,116,32,105,99,111,110,34,32,
+100,111,99,117,109,101,110,116,46,119,114,105,116,101,40,112,97,100,100,105,110,
+103,45,98,111,116,116,111,109,58,114,101,112,114,101,115,101,110,116,97,116,105,
+118,101,115,115,117,98,109,105,116,34,32,118,97,108,117,101,61,34,97,108,105,103
+,110,61,34,99,101,110,116,101,114,34,32,116,104,114,111,117,103,104,111,117,116,
+32,116,104,101,32,115,99,105,101,110,99,101,32,102,105,99,116,105,111,110,10,32,
+32,60,100,105,118,32,99,108,97,115,115,61,34,115,117,98,109,105,116,34,32,99,108
+,97,115,115,61,34,111,110,101,32,111,102,32,116,104,101,32,109,111,115,116,32,
+118,97,108,105,103,110,61,34,116,111,112,34,62,60,119,97,115,32,101,115,116,97,
+98,108,105,115,104,101,100,41,59,13,10,60,47,115,99,114,105,112,116,62,13,10,114
+,101,116,117,114,110,32,102,97,108,115,101,59,34,62,41,46,115,116,121,108,101,46
+,100,105,115,112,108,97,121,98,101,99,97,117,115,101,32,111,102,32,116,104,101,
+32,100,111,99,117,109,101,110,116,46,99,111,111,107,105,101,60,102,111,114,109,
+32,97,99,116,105,111,110,61,34,47,125,98,111,100,121,123,109,97,114,103,105,110,
+58,48,59,69,110,99,121,99,108,111,112,101,100,105,97,32,111,102,118,101,114,115,
+105,111,110,32,111,102,32,116,104,101,32,46,99,114,101,97,116,101,69,108,101,109
+,101,110,116,40,110,97,109,101,34,32,99,111,110,116,101,110,116,61,34,60,47,100,
+105,118,62,10,60,47,100,105,118,62,10,10,97,100,109,105,110,105,115,116,114,97,
+116,105,118,101,32,60,47,98,111,100,121,62,10,60,47,104,116,109,108,62,104,105,
+115,116,111,114,121,32,111,102,32,116,104,101,32,34,62,60,105,110,112,117,116,32
+,116,121,112,101,61,34,112,111,114,116,105,111,110,32,111,102,32,116,104,101,32,
+97,115,32,112,97,114,116,32,111,102,32,116,104,101,32,38,110,98,115,112,59,60,97
+,32,104,114,101,102,61,34,111,116,104,101,114,32,99,111,117,110,116,114,105,101,
+115,34,62,10,60,100,105,118,32,99,108,97,115,115,61,34,60,47,115,112,97,110,62,
+60,47,115,112,97,110,62,60,73,110,32,111,116,104,101,114,32,119,111,114,100,115,
+44,100,105,115,112,108,97,121,58,32,98,108,111,99,107,59,99,111,110,116,114,111,
+108,32,111,102,32,116,104,101,32,105,110,116,114,111,100,117,99,116,105,111,110,
+32,111,102,47,62,10,60,109,101,116,97,32,110,97,109,101,61,34,97,115,32,119,101,
+108,108,32,97,115,32,116,104,101,32,105,110,32,114,101,99,101,110,116,32,121,101
+,97,114,115,13,10,9,60,100,105,118,32,99,108,97,115,115,61,34,60,47,100,105,118,
+62,10,9,60,47,100,105,118,62,10,105,110,115,112,105,114,101,100,32,98,121,32,116
+,104,101,116,104,101,32,101,110,100,32,111,102,32,116,104,101,32,99,111,109,112,
+97,116,105,98,108,101,32,119,105,116,104,98,101,99,97,109,101,32,107,110,111,119
+,110,32,97,115,32,115,116,121,108,101,61,34,109,97,114,103,105,110,58,46,106,115
+,34,62,60,47,115,99,114,105,112,116,62,60,32,73,110,116,101,114,110,97,116,105,
+111,110,97,108,32,116,104,101,114,101,32,104,97,118,101,32,98,101,101,110,71,101
+,114,109,97,110,32,108,97,110,103,117,97,103,101,32,115,116,121,108,101,61,34,99
+,111,108,111,114,58,35,67,111,109,109,117,110,105,115,116,32,80,97,114,116,121,
+99,111,110,115,105,115,116,101,110,116,32,119,105,116,104,98,111,114,100,101,114
+,61,34,48,34,32,99,101,108,108,32,109,97,114,103,105,110,104,101,105,103,104,116
+,61,34,116,104,101,32,109,97,106,111,114,105,116,121,32,111,102,34,32,97,108,105
+,103,110,61,34,99,101,110,116,101,114,114,101,108,97,116,101,100,32,116,111,32,
+116,104,101,32,109,97,110,121,32,100,105,102,102,101,114,101,110,116,32,79,114,
+116,104,111,100,111,120,32,67,104,117,114,99,104,115,105,109,105,108,97,114,32,
+116,111,32,116,104,101,32,47,62,10,60,108,105,110,107,32,114,101,108,61,34,115,
+119,97,115,32,111,110,101,32,111,102,32,116,104,101,32,117,110,116,105,108,32,
+104,105,115,32,100,101,97,116,104,125,41,40,41,59,10,60,47,115,99,114,105,112,
+116,62,111,116,104,101,114,32,108,97,110,103,117,97,103,101,115,99,111,109,112,
+97,114,101,100,32,116,111,32,116,104,101,112,111,114,116,105,111,110,115,32,111,
+102,32,116,104,101,116,104,101,32,78,101,116,104,101,114,108,97,110,100,115,116,
+104,101,32,109,111,115,116,32,99,111,109,109,111,110,98,97,99,107,103,114,111,
+117,110,100,58,117,114,108,40,97,114,103,117,101,100,32,116,104,97,116,32,116,
+104,101,115,99,114,111,108,108,105,110,103,61,34,110,111,34,32,105,110,99,108,
+117,100,101,100,32,105,110,32,116,104,101,78,111,114,116,104,32,65,109,101,114,
+105,99,97,110,32,116,104,101,32,110,97,109,101,32,111,102,32,116,104,101,105,110
+,116,101,114,112,114,101,116,97,116,105,111,110,115,116,104,101,32,116,114,97,
+100,105,116,105,111,110,97,108,100,101,118,101,108,111,112,109,101,110,116,32,
+111,102,32,102,114,101,113,117,101,110,116,108,121,32,117,115,101,100,97,32,99,
+111,108,108,101,99,116,105,111,110,32,111,102,118,101,114,121,32,115,105,109,105
+,108,97,114,32,116,111,115,117,114,114,111,117,110,100,105,110,103,32,116,104,
+101,101,120,97,109,112,108,101,32,111,102,32,116,104,105,115,97,108,105,103,110,
+61,34,99,101,110,116,101,114,34,62,119,111,117,108,100,32,104,97,118,101,32,98,
+101,101,110,105,109,97,103,101,95,99,97,112,116,105,111,110,32,61,97,116,116,97,
+99,104,101,100,32,116,111,32,116,104,101,115,117,103,103,101,115,116,105,110,103
+,32,116,104,97,116,105,110,32,116,104,101,32,102,111,114,109,32,111,102,32,105,
+110,118,111,108,118,101,100,32,105,110,32,116,104,101,105,115,32,100,101,114,105
+,118,101,100,32,102,114,111,109,110,97,109,101,100,32,97,102,116,101,114,32,116,
+104,101,73,110,116,114,111,100,117,99,116,105,111,110,32,116,111,114,101,115,116
+,114,105,99,116,105,111,110,115,32,111,110,32,115,116,121,108,101,61,34,119,105,
+100,116,104,58,32,99,97,110,32,98,101,32,117,115,101,100,32,116,111,32,116,104,
+101,32,99,114,101,97,116,105,111,110,32,111,102,109,111,115,116,32,105,109,112,
+111,114,116,97,110,116,32,105,110,102,111,114,109,97,116,105,111,110,32,97,110,
+100,114,101,115,117,108,116,101,100,32,105,110,32,116,104,101,99,111,108,108,97,
+112,115,101,32,111,102,32,116,104,101,84,104,105,115,32,109,101,97,110,115,32,
+116,104,97,116,101,108,101,109,101,110,116,115,32,111,102,32,116,104,101,119,97,
+115,32,114,101,112,108,97,99,101,100,32,98,121,97,110,97,108,121,115,105,115,32,
+111,102,32,116,104,101,105,110,115,112,105,114,97,116,105,111,110,32,102,111,114
+,114,101,103,97,114,100,101,100,32,97,115,32,116,104,101,109,111,115,116,32,115,
+117,99,99,101,115,115,102,117,108,107,110,111,119,110,32,97,115,32,38,113,117,
+111,116,59,97,32,99,111,109,112,114,101,104,101,110,115,105,118,101,72,105,115,
+116,111,114,121,32,111,102,32,116,104,101,32,119,101,114,101,32,99,111,110,115,
+105,100,101,114,101,100,114,101,116,117,114,110,101,100,32,116,111,32,116,104,
+101,97,114,101,32,114,101,102,101,114,114,101,100,32,116,111,85,110,115,111,117,
+114,99,101,100,32,105,109,97,103,101,62,10,9,60,100,105,118,32,99,108,97,115,115
+,61,34,99,111,110,115,105,115,116,115,32,111,102,32,116,104,101,115,116,111,112,
+80,114,111,112,97,103,97,116,105,111,110,105,110,116,101,114,101,115,116,32,105,
+110,32,116,104,101,97,118,97,105,108,97,98,105,108,105,116,121,32,111,102,97,112
+,112,101,97,114,115,32,116,111,32,104,97,118,101,101,108,101,99,116,114,111,109,
+97,103,110,101,116,105,99,101,110,97,98,108,101,83,101,114,118,105,99,101,115,40
+,102,117,110,99,116,105,111,110,32,111,102,32,116,104,101,73,116,32,105,115,32,
+105,109,112,111,114,116,97,110,116,60,47,115,99,114,105,112,116,62,60,47,100,105
+,118,62,102,117,110,99,116,105,111,110,40,41,123,118,97,114,32,114,101,108,97,
+116,105,118,101,32,116,111,32,116,104,101,97,115,32,97,32,114,101,115,117,108,
+116,32,111,102,32,116,104,101,32,112,111,115,105,116,105,111,110,32,111,102,70,
+111,114,32,101,120,97,109,112,108,101,44,32,105,110,32,109,101,116,104,111,100,
+61,34,112,111,115,116,34,32,119,97,115,32,102,111,108,108,111,119,101,100,32,98,
+121,38,97,109,112,59,109,100,97,115,104,59,32,116,104,101,116,104,101,32,97,112,
+112,108,105,99,97,116,105,111,110,106,115,34,62,60,47,115,99,114,105,112,116,62,
+13,10,117,108,62,60,47,100,105,118,62,60,47,100,105,118,62,97,102,116,101,114,32
+,116,104,101,32,100,101,97,116,104,119,105,116,104,32,114,101,115,112,101,99,116
+,32,116,111,115,116,121,108,101,61,34,112,97,100,100,105,110,103,58,105,115,32,
+112,97,114,116,105,99,117,108,97,114,108,121,100,105,115,112,108,97,121,58,105,
+110,108,105,110,101,59,32,116,121,112,101,61,34,115,117,98,109,105,116,34,32,105
+,115,32,100,105,118,105,100,101,100,32,105,110,116,111,228,184,173,230,150,135,
+32,40,231,174,128,228,189,147,41,114,101,115,112,111,110,115,97,98,105,108,105,
+100,97,100,97,100,109,105,110,105,115,116,114,97,99,105,195,179,110,105,110,116,
+101,114,110,97,99,105,111,110,97,108,101,115,99,111,114,114,101,115,112,111,110,
+100,105,101,110,116,101,224,164,137,224,164,170,224,164,175,224,165,139,224,164,
+151,224,164,170,224,165,130,224,164,176,224,165,141,224,164,181,224,164,185,224,
+164,174,224,164,190,224,164,176,224,165,135,224,164,178,224,165,139,224,164,151,
+224,165,139,224,164,130,224,164,154,224,165,129,224,164,168,224,164,190,224,164,
+181,224,164,178,224,165,135,224,164,149,224,164,191,224,164,168,224,164,184,224,
+164,176,224,164,149,224,164,190,224,164,176,224,164,170,224,165,129,224,164,178,
+224,164,191,224,164,184,224,164,150,224,165,139,224,164,156,224,165,135,224,164,
+130,224,164,154,224,164,190,224,164,185,224,164,191,224,164,143,224,164,173,224,
+165,135,224,164,156,224,165,135,224,164,130,224,164,182,224,164,190,224,164,174,
+224,164,191,224,164,178,224,164,185,224,164,174,224,164,190,224,164,176,224,165,
+128,224,164,156,224,164,190,224,164,151,224,164,176,224,164,163,224,164,172,224,
+164,168,224,164,190,224,164,168,224,165,135,224,164,149,224,165,129,224,164,174,
+224,164,190,224,164,176,224,164,172,224,165,141,224,164,178,224,165,137,224,164,
+151,224,164,174,224,164,190,224,164,178,224,164,191,224,164,149,224,164,174,224,
+164,185,224,164,191,224,164,178,224,164,190,224,164,170,224,165,131,224,164,183,
+224,165,141,224,164,160,224,164,172,224,164,162,224,164,188,224,164,164,224,165,
+135,224,164,173,224,164,190,224,164,156,224,164,170,224,164,190,224,164,149,224,
+165,141,224,164,178,224,164,191,224,164,149,224,164,159,224,165,141,224,164,176,
+224,165,135,224,164,168,224,164,150,224,164,191,224,164,178,224,164,190,224,164,
+171,224,164,166,224,165,140,224,164,176,224,164,190,224,164,168,224,164,174,224,
+164,190,224,164,174,224,164,178,224,165,135,224,164,174,224,164,164,224,164,166,
+224,164,190,224,164,168,224,164,172,224,164,190,224,164,156,224,164,190,224,164,
+176,224,164,181,224,164,191,224,164,149,224,164,190,224,164,184,224,164,149,224,
+165,141,224,164,175,224,165,139,224,164,130,224,164,154,224,164,190,224,164,185,
+224,164,164,224,165,135,224,164,170,224,164,185,224,165,129,224,164,129,224,164,
+154,224,164,172,224,164,164,224,164,190,224,164,175,224,164,190,224,164,184,224,
+164,130,224,164,181,224,164,190,224,164,166,224,164,166,224,165,135,224,164,150,
+224,164,168,224,165,135,224,164,170,224,164,191,224,164,155,224,164,178,224,165,
+135,224,164,181,224,164,191,224,164,182,224,165,135,224,164,183,224,164,176,224,
+164,190,224,164,156,224,165,141,224,164,175,224,164,137,224,164,164,224,165,141,
+224,164,164,224,164,176,224,164,174,224,165,129,224,164,130,224,164,172,224,164,
+136,224,164,166,224,165,139,224,164,168,224,165,139,224,164,130,224,164,137,224,
+164,170,224,164,149,224,164,176,224,164,163,224,164,170,224,164,162,224,164,188,
+224,165,135,224,164,130,224,164,184,224,165,141,224,164,165,224,164,191,224,164,
+164,224,164,171,224,164,191,224,164,178,224,165,141,224,164,174,224,164,174,224,
+165,129,224,164,150,224,165,141,224,164,175,224,164,133,224,164,154,224,165,141,
+224,164,155,224,164,190,224,164,155,224,165,130,224,164,159,224,164,164,224,165,
+128,224,164,184,224,164,130,224,164,151,224,165,128,224,164,164,224,164,156,224,
+164,190,224,164,143,224,164,151,224,164,190,224,164,181,224,164,191,224,164,173,
+224,164,190,224,164,151,224,164,152,224,164,163,224,165,141,224,164,159,224,165,
+135,224,164,166,224,165,130,224,164,184,224,164,176,224,165,135,224,164,166,224,
+164,191,224,164,168,224,165,139,224,164,130,224,164,185,224,164,164,224,165,141,
+224,164,175,224,164,190,224,164,184,224,165,135,224,164,149,224,165,141,224,164,
+184,224,164,151,224,164,190,224,164,130,224,164,167,224,165,128,224,164,181,224,
+164,191,224,164,182,224,165,141,224,164,181,224,164,176,224,164,190,224,164,164,
+224,165,135,224,164,130,224,164,166,224,165,136,224,164,159,224,165,141,224,164,
+184,224,164,168,224,164,149,224,165,141,224,164,182,224,164,190,224,164,184,224,
+164,190,224,164,174,224,164,168,224,165,135,224,164,133,224,164,166,224,164,190,
+224,164,178,224,164,164,224,164,172,224,164,191,224,164,156,224,164,178,224,165,
+128,224,164,170,224,165,129,224,164,176,224,165,130,224,164,183,224,164,185,224,
+164,191,224,164,130,224,164,166,224,165,128,224,164,174,224,164,191,224,164,164,
+224,165,141,224,164,176,224,164,149,224,164,181,224,164,191,224,164,164,224,164,
+190,224,164,176,224,165,129,224,164,170,224,164,175,224,165,135,224,164,184,224,
+165,141,224,164,165,224,164,190,224,164,168,224,164,149,224,164,176,224,165,139,
+224,164,161,224,164,188,224,164,174,224,165,129,224,164,149,224,165,141,224,164,
+164,224,164,175,224,165,139,224,164,156,224,164,168,224,164,190,224,164,149,224,
+165,131,224,164,170,224,164,175,224,164,190,224,164,170,224,165,139,224,164,184,
+224,165,141,224,164,159,224,164,152,224,164,176,224,165,135,224,164,178,224,165,
+130,224,164,149,224,164,190,224,164,176,224,165,141,224,164,175,224,164,181,224,
+164,191,224,164,154,224,164,190,224,164,176,224,164,184,224,165,130,224,164,154,
+224,164,168,224,164,190,224,164,174,224,165,130,224,164,178,224,165,141,224,164,
+175,224,164,166,224,165,135,224,164,150,224,165,135,224,164,130,224,164,185,224,
+164,174,224,165,135,224,164,182,224,164,190,224,164,184,224,165,141,224,164,149,
+224,165,130,224,164,178,224,164,174,224,165,136,224,164,130,224,164,168,224,165,
+135,224,164,164,224,165,136,224,164,175,224,164,190,224,164,176,224,164,156,224,
+164,191,224,164,184,224,164,149,224,165,135,114,115,115,43,120,109,108,34,32,116
+,105,116,108,101,61,34,45,116,121,112,101,34,32,99,111,110,116,101,110,116,61,34
+,116,105,116,108,101,34,32,99,111,110,116,101,110,116,61,34,97,116,32,116,104,
+101,32,115,97,109,101,32,116,105,109,101,46,106,115,34,62,60,47,115,99,114,105,
+112,116,62,10,60,34,32,109,101,116,104,111,100,61,34,112,111,115,116,34,32,60,47
+,115,112,97,110,62,60,47,97,62,60,47,108,105,62,118,101,114,116,105,99,97,108,45
+,97,108,105,103,110,58,116,47,106,113,117,101,114,121,46,109,105,110,46,106,115,
+34,62,46,99,108,105,99,107,40,102,117,110,99,116,105,111,110,40,32,115,116,121,
+108,101,61,34,112,97,100,100,105,110,103,45,125,41,40,41,59,10,60,47,115,99,114,
+105,112,116,62,10,60,47,115,112,97,110,62,60,97,32,104,114,101,102,61,34,60,97,
+32,104,114,101,102,61,34,104,116,116,112,58,47,47,41,59,32,114,101,116,117,114,
+110,32,102,97,108,115,101,59,116,101,120,116,45,100,101,99,111,114,97,116,105,
+111,110,58,32,115,99,114,111,108,108,105,110,103,61,34,110,111,34,32,98,111,114,
+100,101,114,45,99,111,108,108,97,112,115,101,58,97,115,115,111,99,105,97,116,101
+,100,32,119,105,116,104,32,66,97,104,97,115,97,32,73,110,100,111,110,101,115,105
+,97,69,110,103,108,105,115,104,32,108,97,110,103,117,97,103,101,60,116,101,120,
+116,32,120,109,108,58,115,112,97,99,101,61,46,103,105,102,34,32,98,111,114,100,
+101,114,61,34,48,34,60,47,98,111,100,121,62,10,60,47,104,116,109,108,62,10,111,
+118,101,114,102,108,111,119,58,104,105,100,100,101,110,59,105,109,103,32,115,114
+,99,61,34,104,116,116,112,58,47,47,97,100,100,69,118,101,110,116,76,105,115,116,
+101,110,101,114,114,101,115,112,111,110,115,105,98,108,101,32,102,111,114,32,115
+,46,106,115,34,62,60,47,115,99,114,105,112,116,62,10,47,102,97,118,105,99,111,
+110,46,105,99,111,34,32,47,62,111,112,101,114,97,116,105,110,103,32,115,121,115,
+116,101,109,34,32,115,116,121,108,101,61,34,119,105,100,116,104,58,49,116,97,114
+,103,101,116,61,34,95,98,108,97,110,107,34,62,83,116,97,116,101,32,85,110,105,
+118,101,114,115,105,116,121,116,101,120,116,45,97,108,105,103,110,58,108,101,102
+,116,59,10,100,111,99,117,109,101,110,116,46,119,114,105,116,101,40,44,32,105,
+110,99,108,117,100,105,110,103,32,116,104,101,32,97,114,111,117,110,100,32,116,
+104,101,32,119,111,114,108,100,41,59,13,10,60,47,115,99,114,105,112,116,62,13,10
+,60,34,32,115,116,121,108,101,61,34,104,101,105,103,104,116,58,59,111,118,101,
+114,102,108,111,119,58,104,105,100,100,101,110,109,111,114,101,32,105,110,102,
+111,114,109,97,116,105,111,110,97,110,32,105,110,116,101,114,110,97,116,105,111,
+110,97,108,97,32,109,101,109,98,101,114,32,111,102,32,116,104,101,32,111,110,101
+,32,111,102,32,116,104,101,32,102,105,114,115,116,99,97,110,32,98,101,32,102,111
+,117,110,100,32,105,110,32,60,47,100,105,118,62,10,9,9,60,47,100,105,118,62,10,
+100,105,115,112,108,97,121,58,32,110,111,110,101,59,34,62,34,32,47,62,10,60,108,
+105,110,107,32,114,101,108,61,34,10,32,32,40,102,117,110,99,116,105,111,110,40,
+41,32,123,116,104,101,32,49,53,116,104,32,99,101,110,116,117,114,121,46,112,114,
+101,118,101,110,116,68,101,102,97,117,108,116,40,108,97,114,103,101,32,110,117,
+109,98,101,114,32,111,102,32,66,121,122,97,110,116,105,110,101,32,69,109,112,105
+,114,101,46,106,112,103,124,116,104,117,109,98,124,108,101,102,116,124,118,97,
+115,116,32,109,97,106,111,114,105,116,121,32,111,102,109,97,106,111,114,105,116,
+121,32,111,102,32,116,104,101,32,32,97,108,105,103,110,61,34,99,101,110,116,101,
+114,34,62,85,110,105,118,101,114,115,105,116,121,32,80,114,101,115,115,100,111,
+109,105,110,97,116,101,100,32,98,121,32,116,104,101,83,101,99,111,110,100,32,87,
+111,114,108,100,32,87,97,114,100,105,115,116,114,105,98,117,116,105,111,110,32,
+111,102,32,115,116,121,108,101,61,34,112,111,115,105,116,105,111,110,58,116,104,
+101,32,114,101,115,116,32,111,102,32,116,104,101,32,99,104,97,114,97,99,116,101,
+114,105,122,101,100,32,98,121,32,114,101,108,61,34,110,111,102,111,108,108,111,
+119,34,62,100,101,114,105,118,101,115,32,102,114,111,109,32,116,104,101,114,97,
+116,104,101,114,32,116,104,97,110,32,116,104,101,32,97,32,99,111,109,98,105,110,
+97,116,105,111,110,32,111,102,115,116,121,108,101,61,34,119,105,100,116,104,58,
+49,48,48,69,110,103,108,105,115,104,45,115,112,101,97,107,105,110,103,99,111,109
+,112,117,116,101,114,32,115,99,105,101,110,99,101,98,111,114,100,101,114,61,34,
+48,34,32,97,108,116,61,34,116,104,101,32,101,120,105,115,116,101,110,99,101,32,
+111,102,68,101,109,111,99,114,97,116,105,99,32,80,97,114,116,121,34,32,115,116,
+121,108,101,61,34,109,97,114,103,105,110,45,70,111,114,32,116,104,105,115,32,114
+,101,97,115,111,110,44,46,106,115,34,62,60,47,115,99,114,105,112,116,62,10,9,115
+,66,121,84,97,103,78,97,109,101,40,115,41,91,48,93,106,115,34,62,60,47,115,99,
+114,105,112,116,62,13,10,60,46,106,115,34,62,60,47,115,99,114,105,112,116,62,13,
+10,108,105,110,107,32,114,101,108,61,34,105,99,111,110,34,32,39,32,97,108,116,61
+,39,39,32,99,108,97,115,115,61,39,102,111,114,109,97,116,105,111,110,32,111,102,
+32,116,104,101,118,101,114,115,105,111,110,115,32,111,102,32,116,104,101,32,60,
+47,97,62,60,47,100,105,118,62,60,47,100,105,118,62,47,112,97,103,101,62,10,32,32
+,60,112,97,103,101,62,10,60,100,105,118,32,99,108,97,115,115,61,34,99,111,110,
+116,98,101,99,97,109,101,32,116,104,101,32,102,105,114,115,116,98,97,104,97,115,
+97,32,73,110,100,111,110,101,115,105,97,101,110,103,108,105,115,104,32,40,115,
+105,109,112,108,101,41,206,149,206,187,206,187,206,183,206,189,206,185,206,186,
+206,172,209,133,209,128,208,178,208,176,209,130,209,129,208,186,208,184,208,186,
+208,190,208,188,208,191,208,176,208,189,208,184,208,184,209,143,208,178,208,187,
+209,143,208,181,209,130,209,129,209,143,208,148,208,190,208,177,208,176,208,178,
+208,184,209,130,209,140,209,135,208,181,208,187,208,190,208,178,208,181,208,186,
+208,176,209,128,208,176,208,183,208,178,208,184,209,130,208,184,209,143,208,152,
+208,189,209,130,208,181,209,128,208,189,208,181,209,130,208,158,209,130,208,178,
+208,181,209,130,208,184,209,130,209,140,208,189,208,176,208,191,209,128,208,184,
+208,188,208,181,209,128,208,184,208,189,209,130,208,181,209,128,208,189,208,181,
+209,130,208,186,208,190,209,130,208,190,209,128,208,190,208,179,208,190,209,129,
+209,130,209,128,208,176,208,189,208,184,209,134,209,139,208,186,208,176,209,135,
+208,181,209,129,209,130,208,178,208,181,209,131,209,129,208,187,208,190,208,178,
+208,184,209,143,209,133,208,191,209,128,208,190,208,177,208,187,208,181,208,188,
+209,139,208,191,208,190,208,187,209,131,209,135,208,184,209,130,209,140,209,143,
+208,178,208,187,209,143,209,142,209,130,209,129,209,143,208,189,208,176,208,184,
+208,177,208,190,208,187,208,181,208,181,208,186,208,190,208,188,208,191,208,176,
+208,189,208,184,209,143,208,178,208,189,208,184,208,188,208,176,208,189,208,184,
+208,181,209,129,209,128,208,181,208,180,209,129,209,130,208,178,208,176,216,167,
+217,132,217,133,217,136,216,167,216,182,217,138,216,185,216,167,217,132,216,177,
+216,166,217,138,216,179,217,138,216,169,216,167,217,132,216,167,217,134,216,170,
+217,130,216,167,217,132,217,133,216,180,216,167,216,177,217,131,216,167,216,170,
+217,131,216,167,217,132,216,179,217,138,216,167,216,177,216,167,216,170,216,167,
+217,132,217,133,217,131,216,170,217,136,216,168,216,169,216,167,217,132,216,179,
+216,185,217,136,216,175,217,138,216,169,216,167,216,173,216,181,216,167,216,166,
+217,138,216,167,216,170,216,167,217,132,216,185,216,167,217,132,217,133,217,138,
+216,169,216,167,217,132,216,181,217,136,216,170,217,138,216,167,216,170,216,167,
+217,132,216,167,217,134,216,170,216,177,217,134,216,170,216,167,217,132,216,170,
+216,181,216,167,217,133,217,138,217,133,216,167,217,132,216,165,216,179,217,132,
+216,167,217,133,217,138,216,167,217,132,217,133,216,180,216,167,216,177,217,131,
+216,169,216,167,217,132,217,133,216,177,216,166,217,138,216,167,216,170,114,111,
+98,111,116,115,34,32,99,111,110,116,101,110,116,61,34,60,100,105,118,32,105,100,
+61,34,102,111,111,116,101,114,34,62,116,104,101,32,85,110,105,116,101,100,32,83,
+116,97,116,101,115,60,105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,
+46,106,112,103,124,114,105,103,104,116,124,116,104,117,109,98,124,46,106,115,34,
+62,60,47,115,99,114,105,112,116,62,13,10,60,108,111,99,97,116,105,111,110,46,112
+,114,111,116,111,99,111,108,102,114,97,109,101,98,111,114,100,101,114,61,34,48,
+34,32,115,34,32,47,62,10,60,109,101,116,97,32,110,97,109,101,61,34,60,47,97,62,
+60,47,100,105,118,62,60,47,100,105,118,62,60,102,111,110,116,45,119,101,105,103,
+104,116,58,98,111,108,100,59,38,113,117,111,116,59,32,97,110,100,32,38,113,117,
+111,116,59,100,101,112,101,110,100,105,110,103,32,111,110,32,116,104,101,32,109,
+97,114,103,105,110,58,48,59,112,97,100,100,105,110,103,58,34,32,114,101,108,61,
+34,110,111,102,111,108,108,111,119,34,32,80,114,101,115,105,100,101,110,116,32,
+111,102,32,116,104,101,32,116,119,101,110,116,105,101,116,104,32,99,101,110,116,
+117,114,121,101,118,105,115,105,111,110,62,10,32,32,60,47,112,97,103,101,73,110,
+116,101,114,110,101,116,32,69,120,112,108,111,114,101,114,97,46,97,115,121,110,
+99,32,61,32,116,114,117,101,59,13,10,105,110,102,111,114,109,97,116,105,111,110,
+32,97,98,111,117,116,60,100,105,118,32,105,100,61,34,104,101,97,100,101,114,34,
+62,34,32,97,99,116,105,111,110,61,34,104,116,116,112,58,47,47,60,97,32,104,114,
+101,102,61,34,104,116,116,112,115,58,47,47,60,100,105,118,32,105,100,61,34,99,
+111,110,116,101,110,116,34,60,47,100,105,118,62,13,10,60,47,100,105,118,62,13,10
+,60,100,101,114,105,118,101,100,32,102,114,111,109,32,116,104,101,32,60,105,109,
+103,32,115,114,99,61,39,104,116,116,112,58,47,47,97,99,99,111,114,100,105,110,
+103,32,116,111,32,116,104,101,32,10,60,47,98,111,100,121,62,10,60,47,104,116,109
+,108,62,10,115,116,121,108,101,61,34,102,111,110,116,45,115,105,122,101,58,115,
+99,114,105,112,116,32,108,97,110,103,117,97,103,101,61,34,65,114,105,97,108,44,
+32,72,101,108,118,101,116,105,99,97,44,60,47,97,62,60,115,112,97,110,32,99,108,
+97,115,115,61,34,60,47,115,99,114,105,112,116,62,60,115,99,114,105,112,116,32,
+112,111,108,105,116,105,99,97,108,32,112,97,114,116,105,101,115,116,100,62,60,47
+,116,114,62,60,47,116,97,98,108,101,62,60,104,114,101,102,61,34,104,116,116,112,
+58,47,47,119,119,119,46,105,110,116,101,114,112,114,101,116,97,116,105,111,110,
+32,111,102,114,101,108,61,34,115,116,121,108,101,115,104,101,101,116,34,32,100,
+111,99,117,109,101,110,116,46,119,114,105,116,101,40,39,60,99,104,97,114,115,101
+,116,61,34,117,116,102,45,56,34,62,10,98,101,103,105,110,110,105,110,103,32,111,
+102,32,116,104,101,32,114,101,118,101,97,108,101,100,32,116,104,97,116,32,116,
+104,101,116,101,108,101,118,105,115,105,111,110,32,115,101,114,105,101,115,34,32
+,114,101,108,61,34,110,111,102,111,108,108,111,119,34,62,32,116,97,114,103,101,
+116,61,34,95,98,108,97,110,107,34,62,99,108,97,105,109,105,110,103,32,116,104,97
+,116,32,116,104,101,104,116,116,112,37,51,65,37,50,70,37,50,70,119,119,119,46,
+109,97,110,105,102,101,115,116,97,116,105,111,110,115,32,111,102,80,114,105,109,
+101,32,77,105,110,105,115,116,101,114,32,111,102,105,110,102,108,117,101,110,99,
+101,100,32,98,121,32,116,104,101,99,108,97,115,115,61,34,99,108,101,97,114,102,
+105,120,34,62,47,100,105,118,62,13,10,60,47,100,105,118,62,13,10,13,10,116,104,
+114,101,101,45,100,105,109,101,110,115,105,111,110,97,108,67,104,117,114,99,104,
+32,111,102,32,69,110,103,108,97,110,100,111,102,32,78,111,114,116,104,32,67,97,
+114,111,108,105,110,97,115,113,117,97,114,101,32,107,105,108,111,109,101,116,114
+,101,115,46,97,100,100,69,118,101,110,116,76,105,115,116,101,110,101,114,100,105
+,115,116,105,110,99,116,32,102,114,111,109,32,116,104,101,99,111,109,109,111,110
+,108,121,32,107,110,111,119,110,32,97,115,80,104,111,110,101,116,105,99,32,65,
+108,112,104,97,98,101,116,100,101,99,108,97,114,101,100,32,116,104,97,116,32,116
+,104,101,99,111,110,116,114,111,108,108,101,100,32,98,121,32,116,104,101,66,101,
+110,106,97,109,105,110,32,70,114,97,110,107,108,105,110,114,111,108,101,45,112,
+108,97,121,105,110,103,32,103,97,109,101,116,104,101,32,85,110,105,118,101,114,
+115,105,116,121,32,111,102,105,110,32,87,101,115,116,101,114,110,32,69,117,114,
+111,112,101,112,101,114,115,111,110,97,108,32,99,111,109,112,117,116,101,114,80,
+114,111,106,101,99,116,32,71,117,116,101,110,98,101,114,103,114,101,103,97,114,
+100,108,101,115,115,32,111,102,32,116,104,101,104,97,115,32,98,101,101,110,32,
+112,114,111,112,111,115,101,100,116,111,103,101,116,104,101,114,32,119,105,116,
+104,32,116,104,101,62,60,47,108,105,62,60,108,105,32,99,108,97,115,115,61,34,105
+,110,32,115,111,109,101,32,99,111,117,110,116,114,105,101,115,109,105,110,46,106
+,115,34,62,60,47,115,99,114,105,112,116,62,111,102,32,116,104,101,32,112,111,112
+,117,108,97,116,105,111,110,111,102,102,105,99,105,97,108,32,108,97,110,103,117,
+97,103,101,60,105,109,103,32,115,114,99,61,34,105,109,97,103,101,115,47,105,100,
+101,110,116,105,102,105,101,100,32,98,121,32,116,104,101,110,97,116,117,114,97,
+108,32,114,101,115,111,117,114,99,101,115,99,108,97,115,115,105,102,105,99,97,
+116,105,111,110,32,111,102,99,97,110,32,98,101,32,99,111,110,115,105,100,101,114
+,101,100,113,117,97,110,116,117,109,32,109,101,99,104,97,110,105,99,115,78,101,
+118,101,114,116,104,101,108,101,115,115,44,32,116,104,101,109,105,108,108,105,
+111,110,32,121,101,97,114,115,32,97,103,111,60,47,98,111,100,121,62,13,10,60,47,
+104,116,109,108,62,13,206,149,206,187,206,187,206,183,206,189,206,185,206,186,
+206,172,10,116,97,107,101,32,97,100,118,97,110,116,97,103,101,32,111,102,97,110,
+100,44,32,97,99,99,111,114,100,105,110,103,32,116,111,97,116,116,114,105,98,117,
+116,101,100,32,116,111,32,116,104,101,77,105,99,114,111,115,111,102,116,32,87,
+105,110,100,111,119,115,116,104,101,32,102,105,114,115,116,32,99,101,110,116,117
+,114,121,117,110,100,101,114,32,116,104,101,32,99,111,110,116,114,111,108,100,
+105,118,32,99,108,97,115,115,61,34,104,101,97,100,101,114,115,104,111,114,116,
+108,121,32,97,102,116,101,114,32,116,104,101,110,111,116,97,98,108,101,32,101,
+120,99,101,112,116,105,111,110,116,101,110,115,32,111,102,32,116,104,111,117,115
+,97,110,100,115,115,101,118,101,114,97,108,32,100,105,102,102,101,114,101,110,
+116,97,114,111,117,110,100,32,116,104,101,32,119,111,114,108,100,46,114,101,97,
+99,104,105,110,103,32,109,105,108,105,116,97,114,121,105,115,111,108,97,116,101,
+100,32,102,114,111,109,32,116,104,101,111,112,112,111,115,105,116,105,111,110,32
+,116,111,32,116,104,101,116,104,101,32,79,108,100,32,84,101,115,116,97,109,101,
+110,116,65,102,114,105,99,97,110,32,65,109,101,114,105,99,97,110,115,105,110,115
+,101,114,116,101,100,32,105,110,116,111,32,116,104,101,115,101,112,97,114,97,116
+,101,32,102,114,111,109,32,116,104,101,109,101,116,114,111,112,111,108,105,116,
+97,110,32,97,114,101,97,109,97,107,101,115,32,105,116,32,112,111,115,115,105,98,
+108,101,97,99,107,110,111,119,108,101,100,103,101,100,32,116,104,97,116,97,114,
+103,117,97,98,108,121,32,116,104,101,32,109,111,115,116,116,121,112,101,61,34,
+116,101,120,116,47,99,115,115,34,62,10,116,104,101,32,73,110,116,101,114,110,97,
+116,105,111,110,97,108,65,99,99,111,114,100,105,110,103,32,116,111,32,116,104,
+101,32,112,101,61,34,116,101,120,116,47,99,115,115,34,32,47,62,10,99,111,105,110
+,99,105,100,101,32,119,105,116,104,32,116,104,101,116,119,111,45,116,104,105,114
+,100,115,32,111,102,32,116,104,101,68,117,114,105,110,103,32,116,104,105,115,32,
+116,105,109,101,44,100,117,114,105,110,103,32,116,104,101,32,112,101,114,105,111
+,100,97,110,110,111,117,110,99,101,100,32,116,104,97,116,32,104,101,116,104,101,
+32,105,110,116,101,114,110,97,116,105,111,110,97,108,97,110,100,32,109,111,114,
+101,32,114,101,99,101,110,116,108,121,98,101,108,105,101,118,101,100,32,116,104,
+97,116,32,116,104,101,99,111,110,115,99,105,111,117,115,110,101,115,115,32,97,
+110,100,102,111,114,109,101,114,108,121,32,107,110,111,119,110,32,97,115,115,117
+,114,114,111,117,110,100,101,100,32,98,121,32,116,104,101,102,105,114,115,116,32
+,97,112,112,101,97,114,101,100,32,105,110,111,99,99,97,115,105,111,110,97,108,
+108,121,32,117,115,101,100,112,111,115,105,116,105,111,110,58,97,98,115,111,108,
+117,116,101,59,34,32,116,97,114,103,101,116,61,34,95,98,108,97,110,107,34,32,112
+,111,115,105,116,105,111,110,58,114,101,108,97,116,105,118,101,59,116,101,120,
+116,45,97,108,105,103,110,58,99,101,110,116,101,114,59,106,97,120,47,108,105,98,
+115,47,106,113,117,101,114,121,47,49,46,98,97,99,107,103,114,111,117,110,100,45,
+99,111,108,111,114,58,35,116,121,112,101,61,34,97,112,112,108,105,99,97,116,105,
+111,110,47,97,110,103,117,97,103,101,34,32,99,111,110,116,101,110,116,61,34,60,
+109,101,116,97,32,104,116,116,112,45,101,113,117,105,118,61,34,80,114,105,118,97
+,99,121,32,80,111,108,105,99,121,60,47,97,62,101,40,34,37,51,67,115,99,114,105,
+112,116,32,115,114,99,61,39,34,32,116,97,114,103,101,116,61,34,95,98,108,97,110,
+107,34,62,79,110,32,116,104,101,32,111,116,104,101,114,32,104,97,110,100,44,46,
+106,112,103,124,116,104,117,109,98,124,114,105,103,104,116,124,50,60,47,100,105,
+118,62,60,100,105,118,32,99,108,97,115,115,61,34,60,100,105,118,32,115,116,121,
+108,101,61,34,102,108,111,97,116,58,110,105,110,101,116,101,101,110,116,104,32,
+99,101,110,116,117,114,121,60,47,98,111,100,121,62,13,10,60,47,104,116,109,108,
+62,13,10,60,105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,115,59,116,
+101,120,116,45,97,108,105,103,110,58,99,101,110,116,101,114,102,111,110,116,45,
+119,101,105,103,104,116,58,32,98,111,108,100,59,32,65,99,99,111,114,100,105,110,
+103,32,116,111,32,116,104,101,32,100,105,102,102,101,114,101,110,99,101,32,98,
+101,116,119,101,101,110,34,32,102,114,97,109,101,98,111,114,100,101,114,61,34,48
+,34,32,34,32,115,116,121,108,101,61,34,112,111,115,105,116,105,111,110,58,108,
+105,110,107,32,104,114,101,102,61,34,104,116,116,112,58,47,47,104,116,109,108,52
+,47,108,111,111,115,101,46,100,116,100,34,62,10,100,117,114,105,110,103,32,116,
+104,105,115,32,112,101,114,105,111,100,60,47,116,100,62,60,47,116,114,62,60,47,
+116,97,98,108,101,62,99,108,111,115,101,108,121,32,114,101,108,97,116,101,100,32
+,116,111,102,111,114,32,116,104,101,32,102,105,114,115,116,32,116,105,109,101,59
+,102,111,110,116,45,119,101,105,103,104,116,58,98,111,108,100,59,105,110,112,117
+,116,32,116,121,112,101,61,34,116,101,120,116,34,32,60,115,112,97,110,32,115,116
+,121,108,101,61,34,102,111,110,116,45,111,110,114,101,97,100,121,115,116,97,116,
+101,99,104,97,110,103,101,9,60,100,105,118,32,99,108,97,115,115,61,34,99,108,101
+,97,114,100,111,99,117,109,101,110,116,46,108,111,99,97,116,105,111,110,46,32,70
+,111,114,32,101,120,97,109,112,108,101,44,32,116,104,101,32,97,32,119,105,100,
+101,32,118,97,114,105,101,116,121,32,111,102,32,60,33,68,79,67,84,89,80,69,32,
+104,116,109,108,62,13,10,60,38,110,98,115,112,59,38,110,98,115,112,59,38,110,98,
+115,112,59,34,62,60,97,32,104,114,101,102,61,34,104,116,116,112,58,47,47,115,116
+,121,108,101,61,34,102,108,111,97,116,58,108,101,102,116,59,99,111,110,99,101,
+114,110,101,100,32,119,105,116,104,32,116,104,101,61,104,116,116,112,37,51,65,37
+,50,70,37,50,70,119,119,119,46,105,110,32,112,111,112,117,108,97,114,32,99,117,
+108,116,117,114,101,116,121,112,101,61,34,116,101,120,116,47,99,115,115,34,32,47
+,62,105,116,32,105,115,32,112,111,115,115,105,98,108,101,32,116,111,32,72,97,114
+,118,97,114,100,32,85,110,105,118,101,114,115,105,116,121,116,121,108,101,115,
+104,101,101,116,34,32,104,114,101,102,61,34,47,116,104,101,32,109,97,105,110,32,
+99,104,97,114,97,99,116,101,114,79,120,102,111,114,100,32,85,110,105,118,101,114
+,115,105,116,121,32,32,110,97,109,101,61,34,107,101,121,119,111,114,100,115,34,
+32,99,115,116,121,108,101,61,34,116,101,120,116,45,97,108,105,103,110,58,116,104
+,101,32,85,110,105,116,101,100,32,75,105,110,103,100,111,109,102,101,100,101,114
+,97,108,32,103,111,118,101,114,110,109,101,110,116,60,100,105,118,32,115,116,121
+,108,101,61,34,109,97,114,103,105,110,32,100,101,112,101,110,100,105,110,103,32,
+111,110,32,116,104,101,32,100,101,115,99,114,105,112,116,105,111,110,32,111,102,
+32,116,104,101,60,100,105,118,32,99,108,97,115,115,61,34,104,101,97,100,101,114,
+46,109,105,110,46,106,115,34,62,60,47,115,99,114,105,112,116,62,100,101,115,116,
+114,117,99,116,105,111,110,32,111,102,32,116,104,101,115,108,105,103,104,116,108
+,121,32,100,105,102,102,101,114,101,110,116,105,110,32,97,99,99,111,114,100,97,
+110,99,101,32,119,105,116,104,116,101,108,101,99,111,109,109,117,110,105,99,97,
+116,105,111,110,115,105,110,100,105,99,97,116,101,115,32,116,104,97,116,32,116,
+104,101,115,104,111,114,116,108,121,32,116,104,101,114,101,97,102,116,101,114,
+101,115,112,101,99,105,97,108,108,121,32,105,110,32,116,104,101,32,69,117,114,
+111,112,101,97,110,32,99,111,117,110,116,114,105,101,115,72,111,119,101,118,101,
+114,44,32,116,104,101,114,101,32,97,114,101,115,114,99,61,34,104,116,116,112,58,
+47,47,115,116,97,116,105,99,115,117,103,103,101,115,116,101,100,32,116,104,97,
+116,32,116,104,101,34,32,115,114,99,61,34,104,116,116,112,58,47,47,119,119,119,
+46,97,32,108,97,114,103,101,32,110,117,109,98,101,114,32,111,102,32,84,101,108,
+101,99,111,109,109,117,110,105,99,97,116,105,111,110,115,34,32,114,101,108,61,34
+,110,111,102,111,108,108,111,119,34,32,116,72,111,108,121,32,82,111,109,97,110,
+32,69,109,112,101,114,111,114,97,108,109,111,115,116,32,101,120,99,108,117,115,
+105,118,101,108,121,34,32,98,111,114,100,101,114,61,34,48,34,32,97,108,116,61,34
+,83,101,99,114,101,116,97,114,121,32,111,102,32,83,116,97,116,101,99,117,108,109
+,105,110,97,116,105,110,103,32,105,110,32,116,104,101,67,73,65,32,87,111,114,108
+,100,32,70,97,99,116,98,111,111,107,116,104,101,32,109,111,115,116,32,105,109,
+112,111,114,116,97,110,116,97,110,110,105,118,101,114,115,97,114,121,32,111,102,
+32,116,104,101,115,116,121,108,101,61,34,98,97,99,107,103,114,111,117,110,100,45
+,60,108,105,62,60,101,109,62,60,97,32,104,114,101,102,61,34,47,116,104,101,32,65
+,116,108,97,110,116,105,99,32,79,99,101,97,110,115,116,114,105,99,116,108,121,32
+,115,112,101,97,107,105,110,103,44,115,104,111,114,116,108,121,32,98,101,102,111
+,114,101,32,116,104,101,100,105,102,102,101,114,101,110,116,32,116,121,112,101,
+115,32,111,102,116,104,101,32,79,116,116,111,109,97,110,32,69,109,112,105,114,
+101,62,60,105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,65,110,32,73,
+110,116,114,111,100,117,99,116,105,111,110,32,116,111,99,111,110,115,101,113,117
+,101,110,99,101,32,111,102,32,116,104,101,100,101,112,97,114,116,117,114,101,32,
+102,114,111,109,32,116,104,101,67,111,110,102,101,100,101,114,97,116,101,32,83,
+116,97,116,101,115,105,110,100,105,103,101,110,111,117,115,32,112,101,111,112,
+108,101,115,80,114,111,99,101,101,100,105,110,103,115,32,111,102,32,116,104,101,
+105,110,102,111,114,109,97,116,105,111,110,32,111,110,32,116,104,101,116,104,101
+,111,114,105,101,115,32,104,97,118,101,32,98,101,101,110,105,110,118,111,108,118
+,101,109,101,110,116,32,105,110,32,116,104,101,100,105,118,105,100,101,100,32,
+105,110,116,111,32,116,104,114,101,101,97,100,106,97,99,101,110,116,32,99,111,
+117,110,116,114,105,101,115,105,115,32,114,101,115,112,111,110,115,105,98,108,
+101,32,102,111,114,100,105,115,115,111,108,117,116,105,111,110,32,111,102,32,116
+,104,101,99,111,108,108,97,98,111,114,97,116,105,111,110,32,119,105,116,104,119,
+105,100,101,108,121,32,114,101,103,97,114,100,101,100,32,97,115,104,105,115,32,
+99,111,110,116,101,109,112,111,114,97,114,105,101,115,102,111,117,110,100,105,
+110,103,32,109,101,109,98,101,114,32,111,102,68,111,109,105,110,105,99,97,110,32
+,82,101,112,117,98,108,105,99,103,101,110,101,114,97,108,108,121,32,97,99,99,101
+,112,116,101,100,116,104,101,32,112,111,115,115,105,98,105,108,105,116,121,32,
+111,102,97,114,101,32,97,108,115,111,32,97,118,97,105,108,97,98,108,101,117,110,
+100,101,114,32,99,111,110,115,116,114,117,99,116,105,111,110,114,101,115,116,111
+,114,97,116,105,111,110,32,111,102,32,116,104,101,116,104,101,32,103,101,110,101
+,114,97,108,32,112,117,98,108,105,99,105,115,32,97,108,109,111,115,116,32,101,
+110,116,105,114,101,108,121,112,97,115,115,101,115,32,116,104,114,111,117,103,
+104,32,116,104,101,104,97,115,32,98,101,101,110,32,115,117,103,103,101,115,116,
+101,100,99,111,109,112,117,116,101,114,32,97,110,100,32,118,105,100,101,111,71,
+101,114,109,97,110,105,99,32,108,97,110,103,117,97,103,101,115,32,97,99,99,111,
+114,100,105,110,103,32,116,111,32,116,104,101,32,100,105,102,102,101,114,101,110
+,116,32,102,114,111,109,32,116,104,101,115,104,111,114,116,108,121,32,97,102,116
+,101,114,119,97,114,100,115,104,114,101,102,61,34,104,116,116,112,115,58,47,47,
+119,119,119,46,114,101,99,101,110,116,32,100,101,118,101,108,111,112,109,101,110
+,116,66,111,97,114,100,32,111,102,32,68,105,114,101,99,116,111,114,115,60,100,
+105,118,32,99,108,97,115,115,61,34,115,101,97,114,99,104,124,32,60,97,32,104,114
+,101,102,61,34,104,116,116,112,58,47,47,73,110,32,112,97,114,116,105,99,117,108,
+97,114,44,32,116,104,101,77,117,108,116,105,112,108,101,32,102,111,111,116,110,
+111,116,101,115,111,114,32,111,116,104,101,114,32,115,117,98,115,116,97,110,99,
+101,116,104,111,117,115,97,110,100,115,32,111,102,32,121,101,97,114,115,116,114,
+97,110,115,108,97,116,105,111,110,32,111,102,32,116,104,101,60,47,100,105,118,62
+,13,10,60,47,100,105,118,62,13,10,13,10,60,97,32,104,114,101,102,61,34,105,110,
+100,101,120,46,112,104,112,119,97,115,32,101,115,116,97,98,108,105,115,104,101,
+100,32,105,110,109,105,110,46,106,115,34,62,60,47,115,99,114,105,112,116,62,10,
+112,97,114,116,105,99,105,112,97,116,101,32,105,110,32,116,104,101,97,32,115,116
+,114,111,110,103,32,105,110,102,108,117,101,110,99,101,115,116,121,108,101,61,34
+,109,97,114,103,105,110,45,116,111,112,58,114,101,112,114,101,115,101,110,116,
+101,100,32,98,121,32,116,104,101,103,114,97,100,117,97,116,101,100,32,102,114,
+111,109,32,116,104,101,84,114,97,100,105,116,105,111,110,97,108,108,121,44,32,
+116,104,101,69,108,101,109,101,110,116,40,34,115,99,114,105,112,116,34,41,59,72,
+111,119,101,118,101,114,44,32,115,105,110,99,101,32,116,104,101,47,100,105,118,
+62,10,60,47,100,105,118,62,10,60,100,105,118,32,108,101,102,116,59,32,109,97,114
+,103,105,110,45,108,101,102,116,58,112,114,111,116,101,99,116,105,111,110,32,97,
+103,97,105,110,115,116,48,59,32,118,101,114,116,105,99,97,108,45,97,108,105,103,
+110,58,85,110,102,111,114,116,117,110,97,116,101,108,121,44,32,116,104,101,116,
+121,112,101,61,34,105,109,97,103,101,47,120,45,105,99,111,110,47,100,105,118,62,
+10,60,100,105,118,32,99,108,97,115,115,61,34,32,99,108,97,115,115,61,34,99,108,
+101,97,114,102,105,120,34,62,60,100,105,118,32,99,108,97,115,115,61,34,102,111,
+111,116,101,114,9,9,60,47,100,105,118,62,10,9,9,60,47,100,105,118,62,10,116,104,
+101,32,109,111,116,105,111,110,32,112,105,99,116,117,114,101,208,145,209,138,208
+,187,208,179,208,176,209,128,209,129,208,186,208,184,208,177,209,138,208,187,208
+,179,208,176,209,128,209,129,208,186,208,184,208,164,208,181,208,180,208,181,209
+,128,208,176,209,134,208,184,208,184,208,189,208,181,209,129,208,186,208,190,208
+,187,209,140,208,186,208,190,209,129,208,190,208,190,208,177,209,137,208,181,208
+,189,208,184,208,181,209,129,208,190,208,190,208,177,209,137,208,181,208,189,208
+,184,209,143,208,191,209,128,208,190,208,179,209,128,208,176,208,188,208,188,209
+,139,208,158,209,130,208,191,209,128,208,176,208,178,208,184,209,130,209,140,208
+,177,208,181,209,129,208,191,208,187,208,176,209,130,208,189,208,190,208,188,208
+,176,209,130,208,181,209,128,208,184,208,176,208,187,209,139,208,191,208,190,208
+,183,208,178,208,190,208,187,209,143,208,181,209,130,208,191,208,190,209,129,208
+,187,208,181,208,180,208,189,208,184,208,181,209,128,208,176,208,183,208,187,208
+,184,209,135,208,189,209,139,209,133,208,191,209,128,208,190,208,180,209,131,208
+,186,209,134,208,184,208,184,208,191,209,128,208,190,208,179,209,128,208,176,208
+,188,208,188,208,176,208,191,208,190,208,187,208,189,208,190,209,129,209,130,209
+,140,209,142,208,189,208,176,209,133,208,190,208,180,208,184,209,130,209,129,209
+,143,208,184,208,183,208,177,209,128,208,176,208,189,208,189,208,190,208,181,208
+,189,208,176,209,129,208,181,208,187,208,181,208,189,208,184,209,143,208,184,208
+,183,208,188,208,181,208,189,208,181,208,189,208,184,209,143,208,186,208,176,209
+,130,208,181,208,179,208,190,209,128,208,184,208,184,208,144,208,187,208,181,208
+,186,209,129,208,176,208,189,208,180,209,128,224,164,166,224,165,141,224,164,181
+,224,164,190,224,164,176,224,164,190,224,164,174,224,165,136,224,164,168,224,165
+,129,224,164,133,224,164,178,224,164,170,224,165,141,224,164,176,224,164,166,224
+,164,190,224,164,168,224,164,173,224,164,190,224,164,176,224,164,164,224,165,128
+,224,164,175,224,164,133,224,164,168,224,165,129,224,164,166,224,165,135,224,164
+,182,224,164,185,224,164,191,224,164,168,224,165,141,224,164,166,224,165,128,224
+,164,135,224,164,130,224,164,161,224,164,191,224,164,175,224,164,190,224,164,166
+,224,164,191,224,164,178,224,165,141,224,164,178,224,165,128,224,164,133,224,164
+,167,224,164,191,224,164,149,224,164,190,224,164,176,224,164,181,224,165,128,224
+,164,161,224,164,191,224,164,175,224,165,139,224,164,154,224,164,191,224,164,159
+,224,165,141,224,164,160,224,165,135,224,164,184,224,164,174,224,164,190,224,164
+,154,224,164,190,224,164,176,224,164,156,224,164,130,224,164,149,224,165,141,224
+,164,182,224,164,168,224,164,166,224,165,129,224,164,168,224,164,191,224,164,175
+,224,164,190,224,164,170,224,165,141,224,164,176,224,164,175,224,165,139,224,164
+,151,224,164,133,224,164,168,224,165,129,224,164,184,224,164,190,224,164,176,224
+,164,145,224,164,168,224,164,178,224,164,190,224,164,135,224,164,168,224,164,170
+,224,164,190,224,164,176,224,165,141,224,164,159,224,165,128,224,164,182,224,164
+,176,224,165,141,224,164,164,224,165,139,224,164,130,224,164,178,224,165,139,224
+,164,149,224,164,184,224,164,173,224,164,190,224,164,171,224,164,188,224,165,141
+,224,164,178,224,165,136,224,164,182,224,164,182,224,164,176,224,165,141,224,164
+,164,224,165,135,224,164,130,224,164,170,224,165,141,224,164,176,224,164,166,224
+,165,135,224,164,182,224,164,170,224,165,141,224,164,178,224,165,135,224,164,175
+,224,164,176,224,164,149,224,165,135,224,164,130,224,164,166,224,165,141,224,164
+,176,224,164,184,224,165,141,224,164,165,224,164,191,224,164,164,224,164,191,224
+,164,137,224,164,164,224,165,141,224,164,170,224,164,190,224,164,166,224,164,137
+,224,164,168,224,165,141,224,164,185,224,165,135,224,164,130,224,164,154,224,164
+,191,224,164,159,224,165,141,224,164,160,224,164,190,224,164,175,224,164,190,224
+,164,164,224,165,141,224,164,176,224,164,190,224,164,156,224,165,141,224,164,175
+,224,164,190,224,164,166,224,164,190,224,164,170,224,165,129,224,164,176,224,164
+,190,224,164,168,224,165,135,224,164,156,224,165,139,224,164,161,224,164,188,224
+,165,135,224,164,130,224,164,133,224,164,168,224,165,129,224,164,181,224,164,190
+,224,164,166,224,164,182,224,165,141,224,164,176,224,165,135,224,164,163,224,165
+,128,224,164,182,224,164,191,224,164,149,224,165,141,224,164,183,224,164,190,224
+,164,184,224,164,176,224,164,149,224,164,190,224,164,176,224,165,128,224,164,184
+,224,164,130,224,164,151,224,165,141,224,164,176,224,164,185,224,164,170,224,164
+,176,224,164,191,224,164,163,224,164,190,224,164,174,224,164,172,224,165,141,224
+,164,176,224,164,190,224,164,130,224,164,161,224,164,172,224,164,154,224,165,141
+,224,164,154,224,165,139,224,164,130,224,164,137,224,164,170,224,164,178,224,164
+,172,224,165,141,224,164,167,224,164,174,224,164,130,224,164,164,224,165,141,224
+,164,176,224,165,128,224,164,184,224,164,130,224,164,170,224,164,176,224,165,141
+,224,164,149,224,164,137,224,164,174,224,165,141,224,164,174,224,165,128,224,164
+,166,224,164,174,224,164,190,224,164,167,224,165,141,224,164,175,224,164,174,224
+,164,184,224,164,185,224,164,190,224,164,175,224,164,164,224,164,190,224,164,182
+,224,164,172,224,165,141,224,164,166,224,165,139,224,164,130,224,164,174,224,165
+,128,224,164,161,224,164,191,224,164,175,224,164,190,224,164,134,224,164,136,224
+,164,170,224,165,128,224,164,143,224,164,178,224,164,174,224,165,139,224,164,172
+,224,164,190,224,164,135,224,164,178,224,164,184,224,164,130,224,164,150,224,165
+,141,224,164,175,224,164,190,224,164,134,224,164,170,224,164,176,224,165,135,224
+,164,182,224,164,168,224,164,133,224,164,168,224,165,129,224,164,172,224,164,130
+,224,164,167,224,164,172,224,164,190,224,164,156,224,164,188,224,164,190,224,164
+,176,224,164,168,224,164,181,224,165,128,224,164,168,224,164,164,224,164,174,224
+,164,170,224,165,141,224,164,176,224,164,174,224,165,129,224,164,150,224,164,170
+,224,165,141,224,164,176,224,164,182,224,165,141,224,164,168,224,164,170,224,164
+,176,224,164,191,224,164,181,224,164,190,224,164,176,224,164,168,224,165,129,224
+,164,149,224,164,184,224,164,190,224,164,168,224,164,184,224,164,174,224,164,176
+,224,165,141,224,164,165,224,164,168,224,164,134,224,164,175,224,165,139,224,164
+,156,224,164,191,224,164,164,224,164,184,224,165,139,224,164,174,224,164,181,224
+,164,190,224,164,176,216,167,217,132,217,133,216,180,216,167,216,177,217,131,216
+,167,216,170,216,167,217,132,217,133,217,134,216,170,216,175,217,138,216,167,216
+,170,216,167,217,132,217,131,217,133,216,168,217,138,217,136,216,170,216,177,216
+,167,217,132,217,133,216,180,216,167,217,135,216,175,216,167,216,170,216,185,216
+,175,216,175,216,167,217,132,216,178,217,136,216,167,216,177,216,185,216,175,216
+,175,216,167,217,132,216,177,216,175,217,136,216,175,216,167,217,132,216,165,216
+,179,217,132,216,167,217,133,217,138,216,169,216,167,217,132,217,129,217,136,216
+,170,217,136,216,180,217,136,216,168,216,167,217,132,217,133,216,179,216,167,216
+,168,217,130,216,167,216,170,216,167,217,132,217,133,216,185,217,132,217,136,217
+,133,216,167,216,170,216,167,217,132,217,133,216,179,217,132,216,179,217,132,216
+,167,216,170,216,167,217,132,216,172,216,177,216,167,217,129,217,138,217,131,216
+,179,216,167,217,132,216,167,216,179,217,132,216,167,217,133,217,138,216,169,216
+,167,217,132,216,167,216,170,216,181,216,167,217,132,216,167,216,170,107,101,121
+,119,111,114,100,115,34,32,99,111,110,116,101,110,116,61,34,119,51,46,111,114,
+103,47,49,57,57,57,47,120,104,116,109,108,34,62,60,97,32,116,97,114,103,101,116,
+61,34,95,98,108,97,110,107,34,32,116,101,120,116,47,104,116,109,108,59,32,99,104
+,97,114,115,101,116,61,34,32,116,97,114,103,101,116,61,34,95,98,108,97,110,107,
+34,62,60,116,97,98,108,101,32,99,101,108,108,112,97,100,100,105,110,103,61,34,97
+,117,116,111,99,111,109,112,108,101,116,101,61,34,111,102,102,34,32,116,101,120,
+116,45,97,108,105,103,110,58,32,99,101,110,116,101,114,59,116,111,32,108,97,115,
+116,32,118,101,114,115,105,111,110,32,98,121,32,98,97,99,107,103,114,111,117,110
+,100,45,99,111,108,111,114,58,32,35,34,32,104,114,101,102,61,34,104,116,116,112,
+58,47,47,119,119,119,46,47,100,105,118,62,60,47,100,105,118,62,60,100,105,118,32
+,105,100,61,60,97,32,104,114,101,102,61,34,35,34,32,99,108,97,115,115,61,34,34,
+62,60,105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,99,114,105,112,
+116,34,32,115,114,99,61,34,104,116,116,112,58,47,47,10,60,115,99,114,105,112,116
+,32,108,97,110,103,117,97,103,101,61,34,47,47,69,78,34,32,34,104,116,116,112,58,
+47,47,119,119,119,46,119,101,110,99,111,100,101,85,82,73,67,111,109,112,111,110,
+101,110,116,40,34,32,104,114,101,102,61,34,106,97,118,97,115,99,114,105,112,116,
+58,60,100,105,118,32,99,108,97,115,115,61,34,99,111,110,116,101,110,116,100,111,
+99,117,109,101,110,116,46,119,114,105,116,101,40,39,60,115,99,112,111,115,105,
+116,105,111,110,58,32,97,98,115,111,108,117,116,101,59,115,99,114,105,112,116,32
+,115,114,99,61,34,104,116,116,112,58,47,47,32,115,116,121,108,101,61,34,109,97,
+114,103,105,110,45,116,111,112,58,46,109,105,110,46,106,115,34,62,60,47,115,99,
+114,105,112,116,62,10,60,47,100,105,118,62,10,60,100,105,118,32,99,108,97,115,
+115,61,34,119,51,46,111,114,103,47,49,57,57,57,47,120,104,116,109,108,34,32,10,
+13,10,60,47,98,111,100,121,62,13,10,60,47,104,116,109,108,62,100,105,115,116,105
+,110,99,116,105,111,110,32,98,101,116,119,101,101,110,47,34,32,116,97,114,103,
+101,116,61,34,95,98,108,97,110,107,34,62,60,108,105,110,107,32,104,114,101,102,
+61,34,104,116,116,112,58,47,47,101,110,99,111,100,105,110,103,61,34,117,116,102,
+45,56,34,63,62,10,119,46,97,100,100,69,118,101,110,116,76,105,115,116,101,110,
+101,114,63,97,99,116,105,111,110,61,34,104,116,116,112,58,47,47,119,119,119,46,
+105,99,111,110,34,32,104,114,101,102,61,34,104,116,116,112,58,47,47,32,115,116,
+121,108,101,61,34,98,97,99,107,103,114,111,117,110,100,58,116,121,112,101,61,34,
+116,101,120,116,47,99,115,115,34,32,47,62,10,109,101,116,97,32,112,114,111,112,
+101,114,116,121,61,34,111,103,58,116,60,105,110,112,117,116,32,116,121,112,101,
+61,34,116,101,120,116,34,32,32,115,116,121,108,101,61,34,116,101,120,116,45,97,
+108,105,103,110,58,116,104,101,32,100,101,118,101,108,111,112,109,101,110,116,32
+,111,102,32,116,121,108,101,115,104,101,101,116,34,32,116,121,112,101,61,34,116,
+101,104,116,109,108,59,32,99,104,97,114,115,101,116,61,117,116,102,45,56,105,115
+,32,99,111,110,115,105,100,101,114,101,100,32,116,111,32,98,101,116,97,98,108,
+101,32,119,105,100,116,104,61,34,49,48,48,37,34,32,73,110,32,97,100,100,105,116,
+105,111,110,32,116,111,32,116,104,101,32,99,111,110,116,114,105,98,117,116,101,
+100,32,116,111,32,116,104,101,32,100,105,102,102,101,114,101,110,99,101,115,32,
+98,101,116,119,101,101,110,100,101,118,101,108,111,112,109,101,110,116,32,111,
+102,32,116,104,101,32,73,116,32,105,115,32,105,109,112,111,114,116,97,110,116,32
+,116,111,32,60,47,115,99,114,105,112,116,62,10,10,60,115,99,114,105,112,116,32,
+32,115,116,121,108,101,61,34,102,111,110,116,45,115,105,122,101,58,49,62,60,47,
+115,112,97,110,62,60,115,112,97,110,32,105,100,61,103,98,76,105,98,114,97,114,
+121,32,111,102,32,67,111,110,103,114,101,115,115,60,105,109,103,32,115,114,99,61
+,34,104,116,116,112,58,47,47,105,109,69,110,103,108,105,115,104,32,116,114,97,
+110,115,108,97,116,105,111,110,65,99,97,100,101,109,121,32,111,102,32,83,99,105,
+101,110,99,101,115,100,105,118,32,115,116,121,108,101,61,34,100,105,115,112,108,
+97,121,58,99,111,110,115,116,114,117,99,116,105,111,110,32,111,102,32,116,104,
+101,46,103,101,116,69,108,101,109,101,110,116,66,121,73,100,40,105,100,41,105,
+110,32,99,111,110,106,117,110,99,116,105,111,110,32,119,105,116,104,69,108,101,
+109,101,110,116,40,39,115,99,114,105,112,116,39,41,59,32,60,109,101,116,97,32,
+112,114,111,112,101,114,116,121,61,34,111,103,58,208,145,209,138,208,187,208,179
+,208,176,209,128,209,129,208,186,208,184,10,32,116,121,112,101,61,34,116,101,120
+,116,34,32,110,97,109,101,61,34,62,80,114,105,118,97,99,121,32,80,111,108,105,99
+,121,60,47,97,62,97,100,109,105,110,105,115,116,101,114,101,100,32,98,121,32,116
+,104,101,101,110,97,98,108,101,83,105,110,103,108,101,82,101,113,117,101,115,116
+,115,116,121,108,101,61,38,113,117,111,116,59,109,97,114,103,105,110,58,60,47,
+100,105,118,62,60,47,100,105,118,62,60,47,100,105,118,62,60,62,60,105,109,103,32
+,115,114,99,61,34,104,116,116,112,58,47,47,105,32,115,116,121,108,101,61,38,113,
+117,111,116,59,102,108,111,97,116,58,114,101,102,101,114,114,101,100,32,116,111,
+32,97,115,32,116,104,101,32,116,111,116,97,108,32,112,111,112,117,108,97,116,105
+,111,110,32,111,102,105,110,32,87,97,115,104,105,110,103,116,111,110,44,32,68,46
+,67,46,32,115,116,121,108,101,61,34,98,97,99,107,103,114,111,117,110,100,45,97,
+109,111,110,103,32,111,116,104,101,114,32,116,104,105,110,103,115,44,111,114,103
+,97,110,105,122,97,116,105,111,110,32,111,102,32,116,104,101,112,97,114,116,105,
+99,105,112,97,116,101,100,32,105,110,32,116,104,101,116,104,101,32,105,110,116,
+114,111,100,117,99,116,105,111,110,32,111,102,105,100,101,110,116,105,102,105,
+101,100,32,119,105,116,104,32,116,104,101,102,105,99,116,105,111,110,97,108,32,
+99,104,97,114,97,99,116,101,114,32,79,120,102,111,114,100,32,85,110,105,118,101,
+114,115,105,116,121,32,109,105,115,117,110,100,101,114,115,116,97,110,100,105,
+110,103,32,111,102,84,104,101,114,101,32,97,114,101,44,32,104,111,119,101,118,
+101,114,44,115,116,121,108,101,115,104,101,101,116,34,32,104,114,101,102,61,34,
+47,67,111,108,117,109,98,105,97,32,85,110,105,118,101,114,115,105,116,121,101,
+120,112,97,110,100,101,100,32,116,111,32,105,110,99,108,117,100,101,117,115,117,
+97,108,108,121,32,114,101,102,101,114,114,101,100,32,116,111,105,110,100,105,99,
+97,116,105,110,103,32,116,104,97,116,32,116,104,101,104,97,118,101,32,115,117,
+103,103,101,115,116,101,100,32,116,104,97,116,97,102,102,105,108,105,97,116,101,
+100,32,119,105,116,104,32,116,104,101,99,111,114,114,101,108,97,116,105,111,110,
+32,98,101,116,119,101,101,110,110,117,109,98,101,114,32,111,102,32,100,105,102,
+102,101,114,101,110,116,62,60,47,116,100,62,60,47,116,114,62,60,47,116,97,98,108
+,101,62,82,101,112,117,98,108,105,99,32,111,102,32,73,114,101,108,97,110,100,10,
+60,47,115,99,114,105,112,116,62,10,60,115,99,114,105,112,116,32,117,110,100,101,
+114,32,116,104,101,32,105,110,102,108,117,101,110,99,101,99,111,110,116,114,105,
+98,117,116,105,111,110,32,116,111,32,116,104,101,79,102,102,105,99,105,97,108,32
+,119,101,98,115,105,116,101,32,111,102,104,101,97,100,113,117,97,114,116,101,114
+,115,32,111,102,32,116,104,101,99,101,110,116,101,114,101,100,32,97,114,111,117,
+110,100,32,116,104,101,105,109,112,108,105,99,97,116,105,111,110,115,32,111,102,
+32,116,104,101,104,97,118,101,32,98,101,101,110,32,100,101,118,101,108,111,112,
+101,100,70,101,100,101,114,97,108,32,82,101,112,117,98,108,105,99,32,111,102,98,
+101,99,97,109,101,32,105,110,99,114,101,97,115,105,110,103,108,121,99,111,110,
+116,105,110,117,97,116,105,111,110,32,111,102,32,116,104,101,78,111,116,101,44,
+32,104,111,119,101,118,101,114,44,32,116,104,97,116,115,105,109,105,108,97,114,
+32,116,111,32,116,104,97,116,32,111,102,32,99,97,112,97,98,105,108,105,116,105,
+101,115,32,111,102,32,116,104,101,97,99,99,111,114,100,97,110,99,101,32,119,105,
+116,104,32,116,104,101,112,97,114,116,105,99,105,112,97,110,116,115,32,105,110,
+32,116,104,101,102,117,114,116,104,101,114,32,100,101,118,101,108,111,112,109,
+101,110,116,117,110,100,101,114,32,116,104,101,32,100,105,114,101,99,116,105,111
+,110,105,115,32,111,102,116,101,110,32,99,111,110,115,105,100,101,114,101,100,
+104,105,115,32,121,111,117,110,103,101,114,32,98,114,111,116,104,101,114,60,47,
+116,100,62,60,47,116,114,62,60,47,116,97,98,108,101,62,60,97,32,104,116,116,112,
+45,101,113,117,105,118,61,34,88,45,85,65,45,112,104,121,115,105,99,97,108,32,112
+,114,111,112,101,114,116,105,101,115,111,102,32,66,114,105,116,105,115,104,32,67
+,111,108,117,109,98,105,97,104,97,115,32,98,101,101,110,32,99,114,105,116,105,99
+,105,122,101,100,40,119,105,116,104,32,116,104,101,32,101,120,99,101,112,116,105
+,111,110,113,117,101,115,116,105,111,110,115,32,97,98,111,117,116,32,116,104,101
+,112,97,115,115,105,110,103,32,116,104,114,111,117,103,104,32,116,104,101,48,34,
+32,99,101,108,108,112,97,100,100,105,110,103,61,34,48,34,32,116,104,111,117,115,
+97,110,100,115,32,111,102,32,112,101,111,112,108,101,114,101,100,105,114,101,99,
+116,115,32,104,101,114,101,46,32,70,111,114,104,97,118,101,32,99,104,105,108,100
+,114,101,110,32,117,110,100,101,114,37,51,69,37,51,67,47,115,99,114,105,112,116,
+37,51,69,34,41,41,59,60,97,32,104,114,101,102,61,34,104,116,116,112,58,47,47,119
+,119,119,46,60,108,105,62,60,97,32,104,114,101,102,61,34,104,116,116,112,58,47,
+47,115,105,116,101,95,110,97,109,101,34,32,99,111,110,116,101,110,116,61,34,116,
+101,120,116,45,100,101,99,111,114,97,116,105,111,110,58,110,111,110,101,115,116,
+121,108,101,61,34,100,105,115,112,108,97,121,58,32,110,111,110,101,60,109,101,
+116,97,32,104,116,116,112,45,101,113,117,105,118,61,34,88,45,110,101,119,32,68,
+97,116,101,40,41,46,103,101,116,84,105,109,101,40,41,32,116,121,112,101,61,34,
+105,109,97,103,101,47,120,45,105,99,111,110,34,60,47,115,112,97,110,62,60,115,
+112,97,110,32,99,108,97,115,115,61,34,108,97,110,103,117,97,103,101,61,34,106,97
+,118,97,115,99,114,105,112,116,119,105,110,100,111,119,46,108,111,99,97,116,105,
+111,110,46,104,114,101,102,60,97,32,104,114,101,102,61,34,106,97,118,97,115,99,
+114,105,112,116,58,45,45,62,13,10,60,115,99,114,105,112,116,32,116,121,112,101,
+61,34,116,60,97,32,104,114,101,102,61,39,104,116,116,112,58,47,47,119,119,119,46
+,104,111,114,116,99,117,116,32,105,99,111,110,34,32,104,114,101,102,61,34,60,47,
+100,105,118,62,13,10,60,100,105,118,32,99,108,97,115,115,61,34,60,115,99,114,105
+,112,116,32,115,114,99,61,34,104,116,116,112,58,47,47,34,32,114,101,108,61,34,
+115,116,121,108,101,115,104,101,101,116,34,32,116,60,47,100,105,118,62,10,60,115
+,99,114,105,112,116,32,116,121,112,101,61,47,97,62,32,60,97,32,104,114,101,102,
+61,34,104,116,116,112,58,47,47,32,97,108,108,111,119,84,114,97,110,115,112,97,
+114,101,110,99,121,61,34,88,45,85,65,45,67,111,109,112,97,116,105,98,108,101,34,
+32,99,111,110,114,101,108,97,116,105,111,110,115,104,105,112,32,98,101,116,119,
+101,101,110,10,60,47,115,99,114,105,112,116,62,13,10,60,115,99,114,105,112,116,
+32,60,47,97,62,60,47,108,105,62,60,47,117,108,62,60,47,100,105,118,62,97,115,115
+,111,99,105,97,116,101,100,32,119,105,116,104,32,116,104,101,32,112,114,111,103,
+114,97,109,109,105,110,103,32,108,97,110,103,117,97,103,101,60,47,97,62,60,97,32
+,104,114,101,102,61,34,104,116,116,112,58,47,47,60,47,97,62,60,47,108,105,62,60,
+108,105,32,99,108,97,115,115,61,34,102,111,114,109,32,97,99,116,105,111,110,61,
+34,104,116,116,112,58,47,47,60,100,105,118,32,115,116,121,108,101,61,34,100,105,
+115,112,108,97,121,58,116,121,112,101,61,34,116,101,120,116,34,32,110,97,109,101
+,61,34,113,34,60,116,97,98,108,101,32,119,105,100,116,104,61,34,49,48,48,37,34,
+32,98,97,99,107,103,114,111,117,110,100,45,112,111,115,105,116,105,111,110,58,34
+,32,98,111,114,100,101,114,61,34,48,34,32,119,105,100,116,104,61,34,114,101,108,
+61,34,115,104,111,114,116,99,117,116,32,105,99,111,110,34,32,104,54,62,60,117,
+108,62,60,108,105,62,60,97,32,104,114,101,102,61,34,32,32,60,109,101,116,97,32,
+104,116,116,112,45,101,113,117,105,118,61,34,99,115,115,34,32,109,101,100,105,97
+,61,34,115,99,114,101,101,110,34,32,114,101,115,112,111,110,115,105,98,108,101,
+32,102,111,114,32,116,104,101,32,34,32,116,121,112,101,61,34,97,112,112,108,105,
+99,97,116,105,111,110,47,34,32,115,116,121,108,101,61,34,98,97,99,107,103,114,
+111,117,110,100,45,104,116,109,108,59,32,99,104,97,114,115,101,116,61,117,116,
+102,45,56,34,32,97,108,108,111,119,116,114,97,110,115,112,97,114,101,110,99,121,
+61,34,115,116,121,108,101,115,104,101,101,116,34,32,116,121,112,101,61,34,116,
+101,13,10,60,109,101,116,97,32,104,116,116,112,45,101,113,117,105,118,61,34,62,
+60,47,115,112,97,110,62,60,115,112,97,110,32,99,108,97,115,115,61,34,48,34,32,99
+,101,108,108,115,112,97,99,105,110,103,61,34,48,34,62,59,10,60,47,115,99,114,105
+,112,116,62,10,60,115,99,114,105,112,116,32,115,111,109,101,116,105,109,101,115,
+32,99,97,108,108,101,100,32,116,104,101,100,111,101,115,32,110,111,116,32,110,
+101,99,101,115,115,97,114,105,108,121,70,111,114,32,109,111,114,101,32,105,110,
+102,111,114,109,97,116,105,111,110,97,116,32,116,104,101,32,98,101,103,105,110,
+110,105,110,103,32,111,102,32,60,33,68,79,67,84,89,80,69,32,104,116,109,108,62,
+60,104,116,109,108,112,97,114,116,105,99,117,108,97,114,108,121,32,105,110,32,
+116,104,101,32,116,121,112,101,61,34,104,105,100,100,101,110,34,32,110,97,109,
+101,61,34,106,97,118,97,115,99,114,105,112,116,58,118,111,105,100,40,48,41,59,34
+,101,102,102,101,99,116,105,118,101,110,101,115,115,32,111,102,32,116,104,101,32
+,97,117,116,111,99,111,109,112,108,101,116,101,61,34,111,102,102,34,32,103,101,
+110,101,114,97,108,108,121,32,99,111,110,115,105,100,101,114,101,100,62,60,105,
+110,112,117,116,32,116,121,112,101,61,34,116,101,120,116,34,32,34,62,60,47,115,
+99,114,105,112,116,62,13,10,60,115,99,114,105,112,116,116,104,114,111,117,103,
+104,111,117,116,32,116,104,101,32,119,111,114,108,100,99,111,109,109,111,110,32,
+109,105,115,99,111,110,99,101,112,116,105,111,110,97,115,115,111,99,105,97,116,
+105,111,110,32,119,105,116,104,32,116,104,101,60,47,100,105,118,62,10,60,47,100,
+105,118,62,10,60,100,105,118,32,99,100,117,114,105,110,103,32,104,105,115,32,108
+,105,102,101,116,105,109,101,44,99,111,114,114,101,115,112,111,110,100,105,110,
+103,32,116,111,32,116,104,101,116,121,112,101,61,34,105,109,97,103,101,47,120,45
+,105,99,111,110,34,32,97,110,32,105,110,99,114,101,97,115,105,110,103,32,110,117
+,109,98,101,114,100,105,112,108,111,109,97,116,105,99,32,114,101,108,97,116,105,
+111,110,115,97,114,101,32,111,102,116,101,110,32,99,111,110,115,105,100,101,114,
+101,100,109,101,116,97,32,99,104,97,114,115,101,116,61,34,117,116,102,45,56,34,
+32,60,105,110,112,117,116,32,116,121,112,101,61,34,116,101,120,116,34,32,101,120
+,97,109,112,108,101,115,32,105,110,99,108,117,100,101,32,116,104,101,34,62,60,
+105,109,103,32,115,114,99,61,34,104,116,116,112,58,47,47,105,112,97,114,116,105,
+99,105,112,97,116,105,111,110,32,105,110,32,116,104,101,116,104,101,32,101,115,
+116,97,98,108,105,115,104,109,101,110,116,32,111,102,10,60,47,100,105,118,62,10,
+60,100,105,118,32,99,108,97,115,115,61,34,38,97,109,112,59,110,98,115,112,59,38,
+97,109,112,59,110,98,115,112,59,116,111,32,100,101,116,101,114,109,105,110,101,
+32,119,104,101,116,104,101,114,113,117,105,116,101,32,100,105,102,102,101,114,
+101,110,116,32,102,114,111,109,109,97,114,107,101,100,32,116,104,101,32,98,101,
+103,105,110,110,105,110,103,100,105,115,116,97,110,99,101,32,98,101,116,119,101,
+101,110,32,116,104,101,99,111,110,116,114,105,98,117,116,105,111,110,115,32,116,
+111,32,116,104,101,99,111,110,102,108,105,99,116,32,98,101,116,119,101,101,110,
+32,116,104,101,119,105,100,101,108,121,32,99,111,110,115,105,100,101,114,101,100
+,32,116,111,119,97,115,32,111,110,101,32,111,102,32,116,104,101,32,102,105,114,
+115,116,119,105,116,104,32,118,97,114,121,105,110,103,32,100,101,103,114,101,101
+,115,104,97,118,101,32,115,112,101,99,117,108,97,116,101,100,32,116,104,97,116,
+40,100,111,99,117,109,101,110,116,46,103,101,116,69,108,101,109,101,110,116,112,
+97,114,116,105,99,105,112,97,116,105,110,103,32,105,110,32,116,104,101,111,114,
+105,103,105,110,97,108,108,121,32,100,101,118,101,108,111,112,101,100,101,116,97
+,32,99,104,97,114,115,101,116,61,34,117,116,102,45,56,34,62,32,116,121,112,101,
+61,34,116,101,120,116,47,99,115,115,34,32,47,62,10,105,110,116,101,114,99,104,97
+,110,103,101,97,98,108,121,32,119,105,116,104,109,111,114,101,32,99,108,111,115,
+101,108,121,32,114,101,108,97,116,101,100,115,111,99,105,97,108,32,97,110,100,32
+,112,111,108,105,116,105,99,97,108,116,104,97,116,32,119,111,117,108,100,32,111,
+116,104,101,114,119,105,115,101,112,101,114,112,101,110,100,105,99,117,108,97,
+114,32,116,111,32,116,104,101,115,116,121,108,101,32,116,121,112,101,61,34,116,
+101,120,116,47,99,115,115,116,121,112,101,61,34,115,117,98,109,105,116,34,32,110
+,97,109,101,61,34,102,97,109,105,108,105,101,115,32,114,101,115,105,100,105,110,
+103,32,105,110,100,101,118,101,108,111,112,105,110,103,32,99,111,117,110,116,114
+,105,101,115,99,111,109,112,117,116,101,114,32,112,114,111,103,114,97,109,109,
+105,110,103,101,99,111,110,111,109,105,99,32,100,101,118,101,108,111,112,109,101
+,110,116,100,101,116,101,114,109,105,110,97,116,105,111,110,32,111,102,32,116,
+104,101,102,111,114,32,109,111,114,101,32,105,110,102,111,114,109,97,116,105,111
+,110,111,110,32,115,101,118,101,114,97,108,32,111,99,99,97,115,105,111,110,115,
+112,111,114,116,117,103,117,195,170,115,32,40,69,117,114,111,112,101,117,41,208,
+163,208,186,209,128,208,176,209,151,208,189,209,129,209,140,208,186,208,176,209,
+131,208,186,209,128,208,176,209,151,208,189,209,129,209,140,208,186,208,176,208,
+160,208,190,209,129,209,129,208,184,208,185,209,129,208,186,208,190,208,185,208,
+188,208,176,209,130,208,181,209,128,208,184,208,176,208,187,208,190,208,178,208,
+184,208,189,209,132,208,190,209,128,208,188,208,176,209,134,208,184,208,184,209,
+131,208,191,209,128,208,176,208,178,208,187,208,181,208,189,208,184,209,143,208,
+189,208,181,208,190,208,177,209,133,208,190,208,180,208,184,208,188,208,190,208,
+184,208,189,209,132,208,190,209,128,208,188,208,176,209,134,208,184,209,143,208,
+152,208,189,209,132,208,190,209,128,208,188,208,176,209,134,208,184,209,143,208,
+160,208,181,209,129,208,191,209,131,208,177,208,187,208,184,208,186,208,184,208,
+186,208,190,208,187,208,184,209,135,208,181,209,129,209,130,208,178,208,190,208,
+184,208,189,209,132,208,190,209,128,208,188,208,176,209,134,208,184,209,142,209,
+130,208,181,209,128,209,128,208,184,209,130,208,190,209,128,208,184,208,184,208,
+180,208,190,209,129,209,130,208,176,209,130,208,190,209,135,208,189,208,190,216,
+167,217,132,217,133,216,170,217,136,216,167,216,172,216,175,217,136,217,134,216,
+167,217,132,216,167,216,180,216,170,216,177,216,167,217,131,216,167,216,170,216,
+167,217,132,216,167,217,130,216,170,216,177,216,167,216,173,216,167,216,170,104,
+116,109,108,59,32,99,104,97,114,115,101,116,61,85,84,70,45,56,34,32,115,101,116,
+84,105,109,101,111,117,116,40,102,117,110,99,116,105,111,110,40,41,100,105,115,
+112,108,97,121,58,105,110,108,105,110,101,45,98,108,111,99,107,59,60,105,110,112
+,117,116,32,116,121,112,101,61,34,115,117,98,109,105,116,34,32,116,121,112,101,
+32,61,32,39,116,101,120,116,47,106,97,118,97,115,99,114,105,60,105,109,103,32,
+115,114,99,61,34,104,116,116,112,58,47,47,119,119,119,46,34,32,34,104,116,116,
+112,58,47,47,119,119,119,46,119,51,46,111,114,103,47,115,104,111,114,116,99,117,
+116,32,105,99,111,110,34,32,104,114,101,102,61,34,34,32,97,117,116,111,99,111,
+109,112,108,101,116,101,61,34,111,102,102,34,32,60,47,97,62,60,47,100,105,118,62
+,60,100,105,118,32,99,108,97,115,115,61,60,47,97,62,60,47,108,105,62,10,60,108,
+105,32,99,108,97,115,115,61,34,99,115,115,34,32,116,121,112,101,61,34,116,101,
+120,116,47,99,115,115,34,32,60,102,111,114,109,32,97,99,116,105,111,110,61,34,
+104,116,116,112,58,47,47,120,116,47,99,115,115,34,32,104,114,101,102,61,34,104,
+116,116,112,58,47,47,108,105,110,107,32,114,101,108,61,34,97,108,116,101,114,110
+,97,116,101,34,32,13,10,60,115,99,114,105,112,116,32,116,121,112,101,61,34,116,
+101,120,116,47,32,111,110,99,108,105,99,107,61,34,106,97,118,97,115,99,114,105,
+112,116,58,40,110,101,119,32,68,97,116,101,41,46,103,101,116,84,105,109,101,40,
+41,125,104,101,105,103,104,116,61,34,49,34,32,119,105,100,116,104,61,34,49,34,32
+,80,101,111,112,108,101,39,115,32,82,101,112,117,98,108,105,99,32,111,102,32,32,
+60,97,32,104,114,101,102,61,34,104,116,116,112,58,47,47,119,119,119,46,116,101,
+120,116,45,100,101,99,111,114,97,116,105,111,110,58,117,110,100,101,114,116,104,
+101,32,98,101,103,105,110,110,105,110,103,32,111,102,32,116,104,101,32,60,47,100
+,105,118,62,10,60,47,100,105,118,62,10,60,47,100,105,118,62,10,101,115,116,97,98
+,108,105,115,104,109,101,110,116,32,111,102,32,116,104,101,32,60,47,100,105,118,
+62,60,47,100,105,118,62,60,47,100,105,118,62,60,47,100,35,118,105,101,119,112,
+111,114,116,123,109,105,110,45,104,101,105,103,104,116,58,10,60,115,99,114,105,
+112,116,32,115,114,99,61,34,104,116,116,112,58,47,47,111,112,116,105,111,110,62,
+60,111,112,116,105,111,110,32,118,97,108,117,101,61,111,102,116,101,110,32,114,
+101,102,101,114,114,101,100,32,116,111,32,97,115,32,47,111,112,116,105,111,110,
+62,10,60,111,112,116,105,111,110,32,118,97,108,117,60,33,68,79,67,84,89,80,69,32
+,104,116,109,108,62,10,60,33,45,45,91,73,110,116,101,114,110,97,116,105,111,110,
+97,108,32,65,105,114,112,111,114,116,62,10,60,97,32,104,114,101,102,61,34,104,
+116,116,112,58,47,47,119,119,119,60,47,97,62,60,97,32,104,114,101,102,61,34,104,
+116,116,112,58,47,47,119,224,184,160,224,184,178,224,184,169,224,184,178,224,185
+,132,224,184,151,224,184,162,225,131,165,225,131,144,225,131,160,225,131,151,225
+,131,163,225,131,154,225,131,152,230,173,163,233,171,148,228,184,173,230,150,135
+,32,40,231,185,129,233,171,148,41,224,164,168,224,164,191,224,164,176,224,165,
+141,224,164,166,224,165,135,224,164,182,224,164,161,224,164,190,224,164,137,224,
+164,168,224,164,178,224,165,139,224,164,161,224,164,149,224,165,141,224,164,183,
+224,165,135,224,164,164,224,165,141,224,164,176,224,164,156,224,164,190,224,164,
+168,224,164,149,224,164,190,224,164,176,224,165,128,224,164,184,224,164,130,224,
+164,172,224,164,130,224,164,167,224,164,191,224,164,164,224,164,184,224,165,141,
+224,164,165,224,164,190,224,164,170,224,164,168,224,164,190,224,164,184,224,165,
+141,224,164,181,224,165,128,224,164,149,224,164,190,224,164,176,224,164,184,224,
+164,130,224,164,184,224,165,141,224,164,149,224,164,176,224,164,163,224,164,184,
+224,164,190,224,164,174,224,164,151,224,165,141,224,164,176,224,165,128,224,164,
+154,224,164,191,224,164,159,224,165,141,224,164,160,224,165,139,224,164,130,224,
+164,181,224,164,191,224,164,156,224,165,141,224,164,158,224,164,190,224,164,168,
+224,164,133,224,164,174,224,165,135,224,164,176,224,164,191,224,164,149,224,164,
+190,224,164,181,224,164,191,224,164,173,224,164,191,224,164,168,224,165,141,224,
+164,168,224,164,151,224,164,190,224,164,161,224,164,191,224,164,175,224,164,190,
+224,164,129,224,164,149,224,165,141,224,164,175,224,165,139,224,164,130,224,164,
+149,224,164,191,224,164,184,224,165,129,224,164,176,224,164,149,224,165,141,224,
+164,183,224,164,190,224,164,170,224,164,185,224,165,129,224,164,129,224,164,154,
+224,164,164,224,165,128,224,164,170,224,165,141,224,164,176,224,164,172,224,164,
+130,224,164,167,224,164,168,224,164,159,224,164,191,224,164,170,224,165,141,224,
+164,170,224,164,163,224,165,128,224,164,149,224,165,141,224,164,176,224,164,191,
+224,164,149,224,165,135,224,164,159,224,164,170,224,165,141,224,164,176,224,164,
+190,224,164,176,224,164,130,224,164,173,224,164,170,224,165,141,224,164,176,224,
+164,190,224,164,170,224,165,141,224,164,164,224,164,174,224,164,190,224,164,178,
+224,164,191,224,164,149,224,165,139,224,164,130,224,164,176,224,164,171,224,164,
+188,224,165,141,224,164,164,224,164,190,224,164,176,224,164,168,224,164,191,224,
+164,176,224,165,141,224,164,174,224,164,190,224,164,163,224,164,178,224,164,191,
+224,164,174,224,164,191,224,164,159,224,165,135,224,164,161,100,101,115,99,114,
+105,112,116,105,111,110,34,32,99,111,110,116,101,110,116,61,34,100,111,99,117,
+109,101,110,116,46,108,111,99,97,116,105,111,110,46,112,114,111,116,46,103,101,
+116,69,108,101,109,101,110,116,115,66,121,84,97,103,78,97,109,101,40,60,33,68,79
+,67,84,89,80,69,32,104,116,109,108,62,10,60,104,116,109,108,32,60,109,101,116,97
+,32,99,104,97,114,115,101,116,61,34,117,116,102,45,56,34,62,58,117,114,108,34,32
+,99,111,110,116,101,110,116,61,34,104,116,116,112,58,47,47,46,99,115,115,34,32,
+114,101,108,61,34,115,116,121,108,101,115,104,101,101,116,34,115,116,121,108,101
+,32,116,121,112,101,61,34,116,101,120,116,47,99,115,115,34,62,116,121,112,101,61
+,34,116,101,120,116,47,99,115,115,34,32,104,114,101,102,61,34,119,51,46,111,114,
+103,47,49,57,57,57,47,120,104,116,109,108,34,32,120,109,108,116,121,112,101,61,
+34,116,101,120,116,47,106,97,118,97,115,99,114,105,112,116,34,32,109,101,116,104
+,111,100,61,34,103,101,116,34,32,97,99,116,105,111,110,61,34,108,105,110,107,32,
+114,101,108,61,34,115,116,121,108,101,115,104,101,101,116,34,32,32,61,32,100,111
+,99,117,109,101,110,116,46,103,101,116,69,108,101,109,101,110,116,116,121,112,
+101,61,34,105,109,97,103,101,47,120,45,105,99,111,110,34,32,47,62,99,101,108,108
+,112,97,100,100,105,110,103,61,34,48,34,32,99,101,108,108,115,112,46,99,115,115,
+34,32,116,121,112,101,61,34,116,101,120,116,47,99,115,115,34,32,60,47,97,62,60,
+47,108,105,62,60,108,105,62,60,97,32,104,114,101,102,61,34,34,32,119,105,100,116
+,104,61,34,49,34,32,104,101,105,103,104,116,61,34,49,34,34,62,60,97,32,104,114,
+101,102,61,34,104,116,116,112,58,47,47,119,119,119,46,115,116,121,108,101,61,34,
+100,105,115,112,108,97,121,58,110,111,110,101,59,34,62,97,108,116,101,114,110,97
+,116,101,34,32,116,121,112,101,61,34,97,112,112,108,105,45,47,47,87,51,67,47,47,
+68,84,68,32,88,72,84,77,76,32,49,46,48,32,101,108,108,115,112,97,99,105,110,103,
+61,34,48,34,32,99,101,108,108,112,97,100,32,116,121,112,101,61,34,104,105,100,
+100,101,110,34,32,118,97,108,117,101,61,34,47,97,62,38,110,98,115,112,59,60,115,
+112,97,110,32,114,111,108,101,61,34,115,10,60,105,110,112,117,116,32,116,121,112
+,101,61,34,104,105,100,100,101,110,34,32,108,97,110,103,117,97,103,101,61,34,74,
+97,118,97,83,99,114,105,112,116,34,32,32,100,111,99,117,109,101,110,116,46,103,
+101,116,69,108,101,109,101,110,116,115,66,103,61,34,48,34,32,99,101,108,108,115,
+112,97,99,105,110,103,61,34,48,34,32,121,112,101,61,34,116,101,120,116,47,99,115
+,115,34,32,109,101,100,105,97,61,34,116,121,112,101,61,39,116,101,120,116,47,106
+,97,118,97,115,99,114,105,112,116,39,119,105,116,104,32,116,104,101,32,101,120,
+99,101,112,116,105,111,110,32,111,102,32,121,112,101,61,34,116,101,120,116,47,99
+,115,115,34,32,114,101,108,61,34,115,116,32,104,101,105,103,104,116,61,34,49,34,
+32,119,105,100,116,104,61,34,49,34,32,61,39,43,101,110,99,111,100,101,85,82,73,
+67,111,109,112,111,110,101,110,116,40,60,108,105,110,107,32,114,101,108,61,34,97
+,108,116,101,114,110,97,116,101,34,32,10,98,111,100,121,44,32,116,114,44,32,105,
+110,112,117,116,44,32,116,101,120,116,109,101,116,97,32,110,97,109,101,61,34,114
+,111,98,111,116,115,34,32,99,111,110,109,101,116,104,111,100,61,34,112,111,115,
+116,34,32,97,99,116,105,111,110,61,34,62,10,60,97,32,104,114,101,102,61,34,104,
+116,116,112,58,47,47,119,119,119,46,99,115,115,34,32,114,101,108,61,34,115,116,
+121,108,101,115,104,101,101,116,34,32,60,47,100,105,118,62,60,47,100,105,118,62,
+60,100,105,118,32,99,108,97,115,115,108,97,110,103,117,97,103,101,61,34,106,97,
+118,97,115,99,114,105,112,116,34,62,97,114,105,97,45,104,105,100,100,101,110,61,
+34,116,114,117,101,34,62,194,183,60,114,105,112,116,34,32,116,121,112,101,61,34,
+116,101,120,116,47,106,97,118,97,115,108,61,48,59,125,41,40,41,59,10,40,102,117,
+110,99,116,105,111,110,40,41,123,98,97,99,107,103,114,111,117,110,100,45,105,109
+,97,103,101,58,32,117,114,108,40,47,97,62,60,47,108,105,62,60,108,105,62,60,97,
+32,104,114,101,102,61,34,104,9,9,60,108,105,62,60,97,32,104,114,101,102,61,34,
+104,116,116,112,58,47,47,97,116,111,114,34,32,97,114,105,97,45,104,105,100,100,
+101,110,61,34,116,114,117,62,32,60,97,32,104,114,101,102,61,34,104,116,116,112,
+58,47,47,119,119,119,46,108,97,110,103,117,97,103,101,61,34,106,97,118,97,115,99
+,114,105,112,116,34,32,47,111,112,116,105,111,110,62,10,60,111,112,116,105,111,
+110,32,118,97,108,117,101,47,100,105,118,62,60,47,100,105,118,62,60,100,105,118,
+32,99,108,97,115,115,61,114,97,116,111,114,34,32,97,114,105,97,45,104,105,100,
+100,101,110,61,34,116,114,101,61,40,110,101,119,32,68,97,116,101,41,46,103,101,
+116,84,105,109,101,40,41,112,111,114,116,117,103,117,195,170,115,32,40,100,111,
+32,66,114,97,115,105,108,41,208,190,209,128,208,179,208,176,208,189,208,184,208,
+183,208,176,209,134,208,184,208,184,208,178,208,190,208,183,208,188,208,190,208,
+182,208,189,208,190,209,129,209,130,209,140,208,190,208,177,209,128,208,176,208,
+183,208,190,208,178,208,176,208,189,208,184,209,143,209,128,208,181,208,179,208,
+184,209,129,209,130,209,128,208,176,209,134,208,184,208,184,208,178,208,190,208,
+183,208,188,208,190,208,182,208,189,208,190,209,129,209,130,208,184,208,190,208,
+177,209,143,208,183,208,176,209,130,208,181,208,187,209,140,208,189,208,176,60,
+33,68,79,67,84,89,80,69,32,104,116,109,108,32,80,85,66,76,73,67,32,34,110,116,45
+,84,121,112,101,34,32,99,111,110,116,101,110,116,61,34,116,101,120,116,47,60,109
+,101,116,97,32,104,116,116,112,45,101,113,117,105,118,61,34,67,111,110,116,101,
+114,97,110,115,105,116,105,111,110,97,108,47,47,69,78,34,32,34,104,116,116,112,
+58,60,104,116,109,108,32,120,109,108,110,115,61,34,104,116,116,112,58,47,47,119,
+119,119,45,47,47,87,51,67,47,47,68,84,68,32,88,72,84,77,76,32,49,46,48,32,84,68,
+84,68,47,120,104,116,109,108,49,45,116,114,97,110,115,105,116,105,111,110,97,108
+,47,47,119,119,119,46,119,51,46,111,114,103,47,84,82,47,120,104,116,109,108,49,
+47,112,101,32,61,32,39,116,101,120,116,47,106,97,118,97,115,99,114,105,112,116,
+39,59,60,109,101,116,97,32,110,97,109,101,61,34,100,101,115,99,114,105,112,116,
+105,111,110,112,97,114,101,110,116,78,111,100,101,46,105,110,115,101,114,116,66,
+101,102,111,114,101,60,105,110,112,117,116,32,116,121,112,101,61,34,104,105,100,
+100,101,110,34,32,110,97,106,115,34,32,116,121,112,101,61,34,116,101,120,116,47,
+106,97,118,97,115,99,114,105,40,100,111,99,117,109,101,110,116,41,46,114,101,97,
+100,121,40,102,117,110,99,116,105,115,99,114,105,112,116,32,116,121,112,101,61,
+34,116,101,120,116,47,106,97,118,97,115,105,109,97,103,101,34,32,99,111,110,116,
+101,110,116,61,34,104,116,116,112,58,47,47,85,65,45,67,111,109,112,97,116,105,98
+,108,101,34,32,99,111,110,116,101,110,116,61,116,109,108,59,32,99,104,97,114,115
+,101,116,61,117,116,102,45,56,34,32,47,62,10,108,105,110,107,32,114,101,108,61,
+34,115,104,111,114,116,99,117,116,32,105,99,111,110,60,108,105,110,107,32,114,
+101,108,61,34,115,116,121,108,101,115,104,101,101,116,34,32,60,47,115,99,114,105
+,112,116,62,10,60,115,99,114,105,112,116,32,116,121,112,101,61,61,32,100,111,99,
+117,109,101,110,116,46,99,114,101,97,116,101,69,108,101,109,101,110,60,97,32,116
+,97,114,103,101,116,61,34,95,98,108,97,110,107,34,32,104,114,101,102,61,32,100,
+111,99,117,109,101,110,116,46,103,101,116,69,108,101,109,101,110,116,115,66,105,
+110,112,117,116,32,116,121,112,101,61,34,116,101,120,116,34,32,110,97,109,101,61
+,97,46,116,121,112,101,32,61,32,39,116,101,120,116,47,106,97,118,97,115,99,114,
+105,110,112,117,116,32,116,121,112,101,61,34,104,105,100,100,101,110,34,32,110,
+97,109,101,104,116,109,108,59,32,99,104,97,114,115,101,116,61,117,116,102,45,56,
+34,32,47,62,100,116,100,34,62,10,60,104,116,109,108,32,120,109,108,110,115,61,34
+,104,116,116,112,45,47,47,87,51,67,47,47,68,84,68,32,72,84,77,76,32,52,46,48,49,
+32,84,101,110,116,115,66,121,84,97,103,78,97,109,101,40,39,115,99,114,105,112,
+116,39,41,105,110,112,117,116,32,116,121,112,101,61,34,104,105,100,100,101,110,
+34,32,110,97,109,60,115,99,114,105,112,116,32,116,121,112,101,61,34,116,101,120,
+116,47,106,97,118,97,115,34,32,115,116,121,108,101,61,34,100,105,115,112,108,97,
+121,58,110,111,110,101,59,34,62,100,111,99,117,109,101,110,116,46,103,101,116,69
+,108,101,109,101,110,116,66,121,73,100,40,61,100,111,99,117,109,101,110,116,46,
+99,114,101,97,116,101,69,108,101,109,101,110,116,40,39,32,116,121,112,101,61,39,
+116,101,120,116,47,106,97,118,97,115,99,114,105,112,116,39,105,110,112,117,116,
+32,116,121,112,101,61,34,116,101,120,116,34,32,110,97,109,101,61,34,100,46,103,
+101,116,69,108,101,109,101,110,116,115,66,121,84,97,103,78,97,109,101,40,115,110
+,105,99,97,108,34,32,104,114,101,102,61,34,104,116,116,112,58,47,47,119,119,119,
+46,67,47,47,68,84,68,32,72,84,77,76,32,52,46,48,49,32,84,114,97,110,115,105,116,
+60,115,116,121,108,101,32,116,121,112,101,61,34,116,101,120,116,47,99,115,115,34
+,62,10,10,60,115,116,121,108,101,32,116,121,112,101,61,34,116,101,120,116,47,99,
+115,115,34,62,105,111,110,97,108,46,100,116,100,34,62,10,60,104,116,109,108,32,
+120,109,108,110,115,61,104,116,116,112,45,101,113,117,105,118,61,34,67,111,110,
+116,101,110,116,45,84,121,112,101,100,105,110,103,61,34,48,34,32,99,101,108,108,
+115,112,97,99,105,110,103,61,34,48,34,104,116,109,108,59,32,99,104,97,114,115,
+101,116,61,117,116,102,45,56,34,32,47,62,10,32,115,116,121,108,101,61,34,100,105
+,115,112,108,97,121,58,110,111,110,101,59,34,62,60,60,108,105,62,60,97,32,104,
+114,101,102,61,34,104,116,116,112,58,47,47,119,119,119,46,32,116,121,112,101,61,
+39,116,101,120,116,47,106,97,118,97,115,99,114,105,112,116,39,62,208,180,208,181
+,209,143,209,130,208,181,208,187,209,140,208,189,208,190,209,129,209,130,208,184
+,209,129,208,190,208,190,209,130,208,178,208,181,209,130,209,129,209,130,208,178
+,208,184,208,184,208,191,209,128,208,190,208,184,208,183,208,178,208,190,208,180
+,209,129,209,130,208,178,208,176,208,177,208,181,208,183,208,190,208,191,208,176
+,209,129,208,189,208,190,209,129,209,130,208,184,224,164,170,224,165,129,224,164
+,184,224,165,141,224,164,164,224,164,191,224,164,149,224,164,190,224,164,149,224
+,164,190,224,164,130,224,164,151,224,165,141,224,164,176,224,165,135,224,164,184
+,224,164,137,224,164,168,224,165,141,224,164,185,224,165,139,224,164,130,224,164
+,168,224,165,135,224,164,181,224,164,191,224,164,167,224,164,190,224,164,168,224
+,164,184,224,164,173,224,164,190,224,164,171,224,164,191,224,164,149,224,165,141
+,224,164,184,224,164,191,224,164,130,224,164,151,224,164,184,224,165,129,224,164
+,176,224,164,149,224,165,141,224,164,183,224,164,191,224,164,164,224,164,149,224
+,165,137,224,164,170,224,165,128,224,164,176,224,164,190,224,164,135,224,164,159
+,224,164,181,224,164,191,224,164,156,224,165,141,224,164,158,224,164,190,224,164
+,170,224,164,168,224,164,149,224,164,190,224,164,176,224,165,141,224,164,176,224
+,164,181,224,164,190,224,164,136,224,164,184,224,164,149,224,165,141,224,164,176
+,224,164,191,224,164,175,224,164,164,224,164,190
+}
+;
+#endif  /* !BROTLI_EXTERNAL_DICTIONARY_DATA */
+
+static BrotliDictionary kBrotliDictionary = {
+  /* size_bits_by_length */
+  {
+    0, 0, 0, 0, 10, 10, 11, 11,
+    10, 10, 10, 10, 10, 9, 9, 8,
+    7, 7, 8, 7, 7, 6, 6, 5,
+    5, 0, 0, 0, 0, 0, 0, 0
+  },
+
+  /* offsets_by_length */
+  {
+    0, 0, 0, 0, 0, 4096, 9216, 21504,
+    35840, 44032, 53248, 63488, 74752, 87040, 93696, 100864,
+    104704, 106752, 108928, 113536, 115968, 118528, 119872, 121280,
+    122016, 122784, 122784, 122784, 122784, 122784, 122784, 122784
+  },
+
+  /* data_size ==  sizeof(kBrotliDictionaryData) */
+  122784,
+
+  /* data */
+#ifdef BROTLI_EXTERNAL_DICTIONARY_DATA
+  NULL
+#else
+  kBrotliDictionaryData
+#endif
+};
+
+const BrotliDictionary* BrotliGetDictionary() {
+  return &kBrotliDictionary;
+}
+
+void BrotliSetDictionaryData(const uint8_t* data) {
+  if (!!data && !kBrotliDictionary.data) {
+    kBrotliDictionary.data = data;
+  }
+}
+
+#if defined(__cplusplus) || defined(c_plusplus)
+}  /* extern "C" */
+#endif
diff --git a/Source/ThirdParty/brotli/common/dictionary.h b/Source/ThirdParty/brotli/common/dictionary.h
new file mode 100644
index 000000000..46fe533cc
--- /dev/null
+++ b/Source/ThirdParty/brotli/common/dictionary.h
@@ -0,0 +1,64 @@
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+   Distributed under MIT license.
+   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Collection of static dictionary words. */
+
+#ifndef BROTLI_COMMON_DICTIONARY_H_
+#define BROTLI_COMMON_DICTIONARY_H_
+
+#include <brotli/port.h>
+#include <brotli/types.h>
+
+#if defined(__cplusplus) || defined(c_plusplus)
+extern "C" {
+#endif
+
+typedef struct BrotliDictionary {
+  /**
+   * Number of bits to encode index of dictionary word in a bucket.
+   *
+   * Specification: Appendix A. Static Dictionary Data
+   *
+   * Words in a dictionary are bucketed by length.
+   * @c 0 means that there are no words of a given length.
+   * Dictionary consists of words with length of [4..24] bytes.
+   * Values at [0..3] and [25..31] indices should not be addressed.
+   */
+  const uint8_t size_bits_by_length[32];
+
+  /* assert(offset[i + 1] == offset[i] + (bits[i] ? (i << bits[i]) : 0)) */
+  const uint32_t offsets_by_length[32];
+
+  /* assert(data_size == offsets_by_length[31]) */
+  const size_t data_size;
+
+  /* Data array is not bound, and should obey to size_bits_by_length values.
+     Specified size matches default (RFC 7932) dictionary. Its size is
+     defined by data_size */
+  const uint8_t* data;
+} BrotliDictionary;
+
+BROTLI_COMMON_API extern const BrotliDictionary* BrotliGetDictionary(void);
+
+/**
+ * Sets dictionary data.
+ *
+ * When dictionary data is already set / present, this method is no-op.
+ *
+ * Dictionary data MUST be provided before BrotliGetDictionary is invoked.
+ * This method is used ONLY in multi-client environment (e.g. C + Java),
+ * to reduce storage by sharing single dictionary between implementations.
+ */
+BROTLI_COMMON_API void BrotliSetDictionaryData(const uint8_t* data);
+
+#define BROTLI_MIN_DICTIONARY_WORD_LENGTH 4
+#define BROTLI_MAX_DICTIONARY_WORD_LENGTH 24
+
+#if defined(__cplusplus) || defined(c_plusplus)
+}  /* extern "C" */
+#endif
+
+#endif  /* BROTLI_COMMON_DICTIONARY_H_ */
diff --git a/Source/ThirdParty/brotli/common/version.h b/Source/ThirdParty/brotli/common/version.h
new file mode 100755
index 000000000..c63f685ce
--- /dev/null
+++ b/Source/ThirdParty/brotli/common/version.h
@@ -0,0 +1,19 @@
+/* Copyright 2016 Google Inc. All Rights Reserved.
+
+   Distributed under MIT license.
+   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Version definition. */
+
+#ifndef BROTLI_COMMON_VERSION_H_
+#define BROTLI_COMMON_VERSION_H_
+
+/* This macro should only be used when library is compiled together with client.
+   If library is dynamically linked, use BrotliDecoderVersion and
+   BrotliEncoderVersion methods. */
+
+/* Semantic version, calculated as (MAJOR << 24) | (MINOR << 12) | PATCH */
+#define BROTLI_VERSION 0x1000001
+
+#endif  /* BROTLI_COMMON_VERSION_H_ */
diff --git a/Source/ThirdParty/brotli/dec/bit_reader.c b/Source/ThirdParty/brotli/dec/bit_reader.c
index cde90af56..9925ba4b3 100644
--- a/Source/ThirdParty/brotli/dec/bit_reader.c
+++ b/Source/ThirdParty/brotli/dec/bit_reader.c
@@ -8,8 +8,8 @@
 
 #include "./bit_reader.h"
 
+#include <brotli/types.h>
 #include "./port.h"
-#include "./types.h"
 
 #if defined(__cplusplus) || defined(c_plusplus)
 extern "C" {
@@ -20,27 +20,27 @@ void BrotliInitBitReader(BrotliBitReader* const br) {
   br->bit_pos_ = sizeof(br->val_) << 3;
 }
 
-int BrotliWarmupBitReader(BrotliBitReader* const br) {
+BROTLI_BOOL BrotliWarmupBitReader(BrotliBitReader* const br) {
   size_t aligned_read_mask = (sizeof(br->val_) >> 1) - 1;
   /* Fixing alignment after unaligned BrotliFillWindow would result accumulator
      overflow. If unalignment is caused by BrotliSafeReadBits, then there is
-     enough space in accumulator to fix aligment. */
+     enough space in accumulator to fix alignment. */
   if (!BROTLI_ALIGNED_READ) {
     aligned_read_mask = 0;
   }
   if (BrotliGetAvailableBits(br) == 0) {
     if (!BrotliPullByte(br)) {
-      return 0;
+      return BROTLI_FALSE;
     }
   }
 
   while ((((size_t)br->next_in) & aligned_read_mask) != 0) {
     if (!BrotliPullByte(br)) {
       /* If we consumed all the input, we don't care about the alignment. */
-      return 1;
+      return BROTLI_TRUE;
     }
   }
-  return 1;
+  return BROTLI_TRUE;
 }
 
 #if defined(__cplusplus) || defined(c_plusplus)
diff --git a/Source/ThirdParty/brotli/dec/bit_reader.h b/Source/ThirdParty/brotli/dec/bit_reader.h
index 7096afaa3..30e6761b2 100644
--- a/Source/ThirdParty/brotli/dec/bit_reader.h
+++ b/Source/ThirdParty/brotli/dec/bit_reader.h
@@ -11,20 +11,14 @@
 
 #include <string.h>  /* memcpy */
 
+#include <brotli/types.h>
 #include "./port.h"
-#include "./types.h"
 
 #if defined(__cplusplus) || defined(c_plusplus)
 extern "C" {
 #endif
 
-#if (BROTLI_64_BITS)
-#define BROTLI_SHORT_FILL_BIT_WINDOW_READ 4
-typedef uint64_t reg_t;
-#else
-#define BROTLI_SHORT_FILL_BIT_WINDOW_READ 2
-typedef uint32_t reg_t;
-#endif
+#define BROTLI_SHORT_FILL_BIT_WINDOW_READ (sizeof(reg_t) >> 1)
 
 static const uint32_t kBitMask[33] = { 0x0000,
     0x00000001, 0x00000003, 0x00000007, 0x0000000F,
@@ -61,14 +55,14 @@ typedef struct {
   size_t avail_in;
 } BrotliBitReaderState;
 
-/* Initializes the bitreader fields. */
+/* Initializes the BrotliBitReader fields. */
 BROTLI_INTERNAL void BrotliInitBitReader(BrotliBitReader* const br);
 
 /* Ensures that accumulator is not empty. May consume one byte of input.
    Returns 0 if data is required but there is no input available.
    For BROTLI_ALIGNED_READ this function also prepares bit reader for aligned
    reading. */
-BROTLI_INTERNAL int BrotliWarmupBitReader(BrotliBitReader* const br);
+BROTLI_INTERNAL BROTLI_BOOL BrotliWarmupBitReader(BrotliBitReader* const br);
 
 static BROTLI_INLINE void BrotliBitReaderSaveState(
     BrotliBitReader* const from, BrotliBitReaderState* to) {
@@ -97,11 +91,11 @@ static BROTLI_INLINE size_t BrotliGetRemainingBytes(BrotliBitReader* br) {
   return br->avail_in + (BrotliGetAvailableBits(br) >> 3);
 }
 
-/* Checks if there is at least num bytes left in the input ringbuffer (excluding
-   the bits remaining in br->val_). */
-static BROTLI_INLINE int BrotliCheckInputAmount(
+/* Checks if there is at least |num| bytes left in the input ring-buffer
+   (excluding the bits remaining in br->val_). */
+static BROTLI_INLINE BROTLI_BOOL BrotliCheckInputAmount(
     BrotliBitReader* const br, size_t num) {
-  return br->avail_in >= num;
+  return TO_BROTLI_BOOL(br->avail_in >= num);
 }
 
 static BROTLI_INLINE uint16_t BrotliLoad16LE(const uint8_t* in) {
@@ -163,7 +157,7 @@ static BROTLI_INLINE uint64_t BrotliLoad64LE(const uint8_t* in) {
 /* Guarantees that there are at least n_bits + 1 bits in accumulator.
    Precondition: accumulator contains at least 1 bit.
    n_bits should be in the range [1..24] for regular build. For portable
-   non-64-bit little endian build only 16 bits are safe to request. */
+   non-64-bit little-endian build only 16 bits are safe to request. */
 static BROTLI_INLINE void BrotliFillBitWindow(
     BrotliBitReader* const br, uint32_t n_bits) {
 #if (BROTLI_64_BITS)
@@ -213,16 +207,16 @@ static BROTLI_INLINE void BrotliFillBitWindow(
 #endif
 }
 
-/* Mosltly like BrotliFillBitWindow, but guarantees only 16 bits and reads no
+/* Mostly like BrotliFillBitWindow, but guarantees only 16 bits and reads no
    more than BROTLI_SHORT_FILL_BIT_WINDOW_READ bytes of input. */
 static BROTLI_INLINE void BrotliFillBitWindow16(BrotliBitReader* const br) {
   BrotliFillBitWindow(br, 17);
 }
 
 /* Pulls one byte of input to accumulator. */
-static BROTLI_INLINE int BrotliPullByte(BrotliBitReader* const br) {
+static BROTLI_INLINE BROTLI_BOOL BrotliPullByte(BrotliBitReader* const br) {
   if (br->avail_in == 0) {
-    return 0;
+    return BROTLI_FALSE;
   }
   br->val_ >>= 8;
 #if (BROTLI_64_BITS)
@@ -233,11 +227,11 @@ static BROTLI_INLINE int BrotliPullByte(BrotliBitReader* const br) {
   br->bit_pos_ -= 8;
   --br->avail_in;
   ++br->next_in;
-  return 1;
+  return BROTLI_TRUE;
 }
 
 /* Returns currently available bits.
-   The number of valid bits could be calclulated by BrotliGetAvailableBits. */
+   The number of valid bits could be calculated by BrotliGetAvailableBits. */
 static BROTLI_INLINE reg_t BrotliGetBitsUnmasked(BrotliBitReader* const br) {
   return br->val_ >> br->bit_pos_;
 }
@@ -250,7 +244,7 @@ static BROTLI_INLINE uint32_t BrotliGet16BitsUnmasked(
   return (uint32_t)BrotliGetBitsUnmasked(br);
 }
 
-/* Returns the specified number of bits from br without advancing bit pos. */
+/* Returns the specified number of bits from |br| without advancing bit pos. */
 static BROTLI_INLINE uint32_t BrotliGetBits(
     BrotliBitReader* const br, uint32_t n_bits) {
   BrotliFillBitWindow(br, n_bits);
@@ -259,15 +253,15 @@ static BROTLI_INLINE uint32_t BrotliGetBits(
 
 /* Tries to peek the specified amount of bits. Returns 0, if there is not
    enough input. */
-static BROTLI_INLINE int BrotliSafeGetBits(
+static BROTLI_INLINE BROTLI_BOOL BrotliSafeGetBits(
     BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
   while (BrotliGetAvailableBits(br) < n_bits) {
     if (!BrotliPullByte(br)) {
-      return 0;
+      return BROTLI_FALSE;
     }
   }
   *val = (uint32_t)BrotliGetBitsUnmasked(br) & BitMask(n_bits);
-  return 1;
+  return BROTLI_TRUE;
 }
 
 /* Advances the bit pos by n_bits. */
@@ -289,7 +283,7 @@ static BROTLI_INLINE void BrotliBitReaderUnload(BrotliBitReader* br) {
   br->bit_pos_ += unused_bits;
 }
 
-/* Reads the specified number of bits from br and advances the bit pos.
+/* Reads the specified number of bits from |br| and advances the bit pos.
    Precondition: accumulator MUST contain at least n_bits. */
 static BROTLI_INLINE void BrotliTakeBits(
   BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
@@ -299,7 +293,7 @@ static BROTLI_INLINE void BrotliTakeBits(
   BrotliDropBits(br, n_bits);
 }
 
-/* Reads the specified number of bits from br and advances the bit pos.
+/* Reads the specified number of bits from |br| and advances the bit pos.
    Assumes that there is enough input to perform BrotliFillBitWindow. */
 static BROTLI_INLINE uint32_t BrotliReadBits(
     BrotliBitReader* const br, uint32_t n_bits) {
@@ -321,43 +315,26 @@ static BROTLI_INLINE uint32_t BrotliReadBits(
 
 /* Tries to read the specified amount of bits. Returns 0, if there is not
    enough input. n_bits MUST be positive. */
-static BROTLI_INLINE int BrotliSafeReadBits(
+static BROTLI_INLINE BROTLI_BOOL BrotliSafeReadBits(
     BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
   while (BrotliGetAvailableBits(br) < n_bits) {
     if (!BrotliPullByte(br)) {
-      return 0;
+      return BROTLI_FALSE;
     }
   }
   BrotliTakeBits(br, n_bits, val);
-  return 1;
+  return BROTLI_TRUE;
 }
 
 /* Advances the bit reader position to the next byte boundary and verifies
    that any skipped bits are set to zero. */
-static BROTLI_INLINE int BrotliJumpToByteBoundary(BrotliBitReader* br) {
+static BROTLI_INLINE BROTLI_BOOL BrotliJumpToByteBoundary(BrotliBitReader* br) {
   uint32_t pad_bits_count = BrotliGetAvailableBits(br) & 0x7;
   uint32_t pad_bits = 0;
   if (pad_bits_count != 0) {
     BrotliTakeBits(br, pad_bits_count, &pad_bits);
   }
-  return pad_bits == 0;
-}
-
-/* Peeks a byte at specified offset.
-   Precondition: bit reader is parked to a byte boundary.
-   Returns -1 if operation is not feasible. */
-static BROTLI_INLINE int BrotliPeekByte(BrotliBitReader* br, size_t offset) {
-  uint32_t available_bits = BrotliGetAvailableBits(br);
-  size_t bytes_left = available_bits >> 3;
-  BROTLI_DCHECK((available_bits & 7) == 0);
-  if (offset < bytes_left) {
-    return (BrotliGetBitsUnmasked(br) >> (unsigned)(offset << 3)) & 0xFF;
-  }
-  offset -= bytes_left;
-  if (offset < br->avail_in) {
-    return br->next_in[offset];
-  }
-  return -1;
+  return TO_BROTLI_BOOL(pad_bits == 0);
 }
 
 /* Copies remaining input bytes stored in the bit reader to the output. Value
diff --git a/Source/ThirdParty/brotli/dec/context.h b/Source/ThirdParty/brotli/dec/context.h
index 37ebe6aeb..9402cbedf 100644
--- a/Source/ThirdParty/brotli/dec/context.h
+++ b/Source/ThirdParty/brotli/dec/context.h
@@ -99,7 +99,7 @@
 #ifndef BROTLI_DEC_CONTEXT_H_
 #define BROTLI_DEC_CONTEXT_H_
 
-#include "./types.h"
+#include <brotli/types.h>
 
 enum ContextType {
   CONTEXT_LSB6 = 0,
diff --git a/Source/ThirdParty/brotli/dec/decode.c b/Source/ThirdParty/brotli/dec/decode.c
index d184f24cb..be8de42fb 100644
--- a/Source/ThirdParty/brotli/dec/decode.c
+++ b/Source/ThirdParty/brotli/dec/decode.c
@@ -4,7 +4,7 @@
    See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
 */
 
-#include "./decode.h"
+#include <brotli/decode.h>
 
 #ifdef __ARM_NEON__
 #include <arm_neon.h>
@@ -13,9 +13,11 @@
 #include <stdlib.h>  /* free, malloc */
 #include <string.h>  /* memcpy, memset */
 
+#include "../common/constants.h"
+#include "../common/dictionary.h"
+#include "../common/version.h"
 #include "./bit_reader.h"
 #include "./context.h"
-#include "./dictionary.h"
 #include "./huffman.h"
 #include "./port.h"
 #include "./prefix.h"
@@ -34,19 +36,15 @@ extern "C" {
   BROTLI_LOG(("[%s] %s[%lu] = %lu\n", __func__, #array_name,        \
          (unsigned long)(idx), (unsigned long)array_name[idx]))
 
-static const uint32_t kDefaultCodeLength = 8;
-static const uint32_t kCodeLengthRepeatCode = 16;
-static const uint32_t kNumLiteralCodes = 256;
-static const uint32_t kNumInsertAndCopyCodes = 704;
-static const uint32_t kNumBlockLengthCodes = 26;
-static const int kLiteralContextBits = 6;
-static const int kDistanceContextBits = 2;
-
 #define HUFFMAN_TABLE_BITS 8U
 #define HUFFMAN_TABLE_MASK 0xff
 
-#define CODE_LENGTH_CODES 18
-static const uint8_t kCodeLengthCodeOrder[CODE_LENGTH_CODES] = {
+/* We need the slack region for the following reasons:
+    - doing up to two 16-byte copies for fast backward copying
+    - inserting transformed dictionary word (5 prefix + 24 base + 8 suffix) */
+static const uint32_t kRingBufferWriteAheadSlack = 42;
+
+static const uint8_t kCodeLengthCodeOrder[BROTLI_CODE_LENGTH_CODES] = {
   1, 2, 3, 4, 0, 5, 17, 6, 16, 7, 8, 9, 10, 11, 12, 13, 14, 15,
 };
 
@@ -59,46 +57,59 @@ static const uint8_t kCodeLengthPrefixValue[16] = {
   0, 4, 3, 2, 0, 4, 3, 1, 0, 4, 3, 2, 0, 4, 3, 5,
 };
 
-#define NUM_DISTANCE_SHORT_CODES 16
+BROTLI_BOOL BrotliDecoderSetParameter(
+    BrotliDecoderState* state, BrotliDecoderParameter p, uint32_t value) {
+  switch (p) {
+    case BROTLI_DECODER_PARAM_DISABLE_RING_BUFFER_REALLOCATION:
+      state->canny_ringbuffer_allocation = !!value ? 0 : 1;
+      return BROTLI_TRUE;
+
+    default: return BROTLI_FALSE;
+  }
+}
 
-BrotliState* BrotliCreateState(
+BrotliDecoderState* BrotliDecoderCreateInstance(
     brotli_alloc_func alloc_func, brotli_free_func free_func, void* opaque) {
-  BrotliState* state = 0;
+  BrotliDecoderState* state = 0;
   if (!alloc_func && !free_func) {
-    state = (BrotliState*)malloc(sizeof(BrotliState));
+    state = (BrotliDecoderState*)malloc(sizeof(BrotliDecoderState));
   } else if (alloc_func && free_func) {
-    state = (BrotliState*)alloc_func(opaque, sizeof(BrotliState));
+    state = (BrotliDecoderState*)alloc_func(opaque, sizeof(BrotliDecoderState));
   }
   if (state == 0) {
     BROTLI_DUMP();
     return 0;
   }
-  BrotliStateInitWithCustomAllocators(state, alloc_func, free_func, opaque);
-  state->error_code = BROTLI_NO_ERROR;
+  BrotliDecoderStateInitWithCustomAllocators(
+      state, alloc_func, free_func, opaque);
   return state;
 }
 
-/* Deinitializes and frees BrotliState instance. */
-void BrotliDestroyState(BrotliState* state) {
+/* Deinitializes and frees BrotliDecoderState instance. */
+void BrotliDecoderDestroyInstance(BrotliDecoderState* state) {
   if (!state) {
     return;
   } else {
     brotli_free_func free_func = state->free_func;
     void* opaque = state->memory_manager_opaque;
-    BrotliStateCleanup(state);
+    BrotliDecoderStateCleanup(state);
     free_func(opaque, state);
   }
 }
 
-/* Saves error code and converts it to BrotliResult */
-static BROTLI_NOINLINE BrotliResult SaveErrorCode(
-    BrotliState* s, BrotliErrorCode e) {
+/* Saves error code and converts it to BrotliDecoderResult */
+static BROTLI_NOINLINE BrotliDecoderResult SaveErrorCode(
+    BrotliDecoderState* s, BrotliDecoderErrorCode e) {
   s->error_code = (int)e;
   switch (e) {
-    case BROTLI_SUCCESS: return BROTLI_RESULT_SUCCESS;
-    case BROTLI_NEEDS_MORE_INPUT: return BROTLI_RESULT_NEEDS_MORE_INPUT;
-    case BROTLI_NEEDS_MORE_OUTPUT: return BROTLI_RESULT_NEEDS_MORE_OUTPUT;
-    default: return BROTLI_RESULT_ERROR;
+    case BROTLI_DECODER_SUCCESS:
+      return BROTLI_DECODER_RESULT_SUCCESS;
+    case BROTLI_DECODER_NEEDS_MORE_INPUT:
+      return BROTLI_DECODER_RESULT_NEEDS_MORE_INPUT;
+    case BROTLI_DECODER_NEEDS_MORE_OUTPUT:
+      return BROTLI_DECODER_RESULT_NEEDS_MORE_OUTPUT;
+    default:
+      return BROTLI_DECODER_RESULT_ERROR;
   }
 }
 
@@ -132,60 +143,61 @@ static BROTLI_INLINE void memmove16(uint8_t* dst, uint8_t* src) {
 }
 
 /* Decodes a number in the range [0..255], by reading 1 - 11 bits. */
-static BROTLI_NOINLINE BrotliErrorCode DecodeVarLenUint8(BrotliState* s,
-    BrotliBitReader* br, uint32_t* value) {
+static BROTLI_NOINLINE BrotliDecoderErrorCode DecodeVarLenUint8(
+    BrotliDecoderState* s, BrotliBitReader* br, uint32_t* value) {
   uint32_t bits;
   switch (s->substate_decode_uint8) {
     case BROTLI_STATE_DECODE_UINT8_NONE:
-      if (PREDICT_FALSE(!BrotliSafeReadBits(br, 1, &bits))) {
-        return BROTLI_NEEDS_MORE_INPUT;
+      if (BROTLI_PREDICT_FALSE(!BrotliSafeReadBits(br, 1, &bits))) {
+        return BROTLI_DECODER_NEEDS_MORE_INPUT;
       }
       if (bits == 0) {
         *value = 0;
-        return BROTLI_SUCCESS;
+        return BROTLI_DECODER_SUCCESS;
       }
       /* No break, transit to the next state. */
 
     case BROTLI_STATE_DECODE_UINT8_SHORT:
-      if (PREDICT_FALSE(!BrotliSafeReadBits(br, 3, &bits))) {
+      if (BROTLI_PREDICT_FALSE(!BrotliSafeReadBits(br, 3, &bits))) {
         s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_SHORT;
-        return BROTLI_NEEDS_MORE_INPUT;
+        return BROTLI_DECODER_NEEDS_MORE_INPUT;
       }
       if (bits == 0) {
         *value = 1;
         s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_NONE;
-        return BROTLI_SUCCESS;
+        return BROTLI_DECODER_SUCCESS;
       }
       /* Use output value as a temporary storage. It MUST be persisted. */
       *value = bits;
       /* No break, transit to the next state. */
 
     case BROTLI_STATE_DECODE_UINT8_LONG:
-      if (PREDICT_FALSE(!BrotliSafeReadBits(br, *value, &bits))) {
+      if (BROTLI_PREDICT_FALSE(!BrotliSafeReadBits(br, *value, &bits))) {
         s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_LONG;
-        return BROTLI_NEEDS_MORE_INPUT;
+        return BROTLI_DECODER_NEEDS_MORE_INPUT;
       }
       *value = (1U << *value) + bits;
       s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_NONE;
-      return BROTLI_SUCCESS;
+      return BROTLI_DECODER_SUCCESS;
 
     default:
-      return BROTLI_FAILURE(BROTLI_ERROR_UNREACHABLE);
+      return
+          BROTLI_FAILURE(BROTLI_DECODER_ERROR_UNREACHABLE);
   }
 }
 
 /* Decodes a metablock length and flags by reading 2 - 31 bits. */
-static BrotliErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
-    BrotliState* s, BrotliBitReader* br) {
+static BrotliDecoderErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
+    BrotliDecoderState* s, BrotliBitReader* br) {
   uint32_t bits;
   int i;
   for (;;) {
     switch (s->substate_metablock_header) {
       case BROTLI_STATE_METABLOCK_HEADER_NONE:
         if (!BrotliSafeReadBits(br, 1, &bits)) {
-          return BROTLI_NEEDS_MORE_INPUT;
+          return BROTLI_DECODER_NEEDS_MORE_INPUT;
         }
-        s->is_last_metablock = (uint8_t)bits;
+        s->is_last_metablock = bits ? 1 : 0;
         s->meta_block_remaining_len = 0;
         s->is_uncompressed = 0;
         s->is_metadata = 0;
@@ -198,18 +210,18 @@ static BrotliErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
 
       case BROTLI_STATE_METABLOCK_HEADER_EMPTY:
         if (!BrotliSafeReadBits(br, 1, &bits)) {
-          return BROTLI_NEEDS_MORE_INPUT;
+          return BROTLI_DECODER_NEEDS_MORE_INPUT;
         }
         if (bits) {
           s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
-          return BROTLI_SUCCESS;
+          return BROTLI_DECODER_SUCCESS;
         }
         s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NIBBLES;
         /* No break, transit to the next state. */
 
       case BROTLI_STATE_METABLOCK_HEADER_NIBBLES:
         if (!BrotliSafeReadBits(br, 2, &bits)) {
-          return BROTLI_NEEDS_MORE_INPUT;
+          return BROTLI_DECODER_NEEDS_MORE_INPUT;
         }
         s->size_nibbles = (uint8_t)(bits + 4);
         s->loop_counter = 0;
@@ -223,13 +235,13 @@ static BrotliErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
 
       case BROTLI_STATE_METABLOCK_HEADER_SIZE:
         i = s->loop_counter;
-        for (; i < s->size_nibbles; ++i) {
+        for (; i < (int)s->size_nibbles; ++i) {
           if (!BrotliSafeReadBits(br, 4, &bits)) {
             s->loop_counter = i;
-            return BROTLI_NEEDS_MORE_INPUT;
+            return BROTLI_DECODER_NEEDS_MORE_INPUT;
           }
           if (i + 1 == s->size_nibbles && s->size_nibbles > 4 && bits == 0) {
-            return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_EXUBERANT_NIBBLE);
+            return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_EXUBERANT_NIBBLE);
           }
           s->meta_block_remaining_len |= (int)(bits << (i * 4));
         }
@@ -240,31 +252,31 @@ static BrotliErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
       case BROTLI_STATE_METABLOCK_HEADER_UNCOMPRESSED:
         if (!s->is_last_metablock) {
           if (!BrotliSafeReadBits(br, 1, &bits)) {
-            return BROTLI_NEEDS_MORE_INPUT;
+            return BROTLI_DECODER_NEEDS_MORE_INPUT;
           }
-          s->is_uncompressed = (uint8_t)bits;
+          s->is_uncompressed = bits ? 1 : 0;
         }
         ++s->meta_block_remaining_len;
         s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
-        return BROTLI_SUCCESS;
+        return BROTLI_DECODER_SUCCESS;
 
       case BROTLI_STATE_METABLOCK_HEADER_RESERVED:
         if (!BrotliSafeReadBits(br, 1, &bits)) {
-          return BROTLI_NEEDS_MORE_INPUT;
+          return BROTLI_DECODER_NEEDS_MORE_INPUT;
         }
         if (bits != 0) {
-          return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_RESERVED);
+          return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_RESERVED);
         }
         s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_BYTES;
         /* No break, transit to the next state. */
 
       case BROTLI_STATE_METABLOCK_HEADER_BYTES:
         if (!BrotliSafeReadBits(br, 2, &bits)) {
-          return BROTLI_NEEDS_MORE_INPUT;
+          return BROTLI_DECODER_NEEDS_MORE_INPUT;
         }
         if (bits == 0) {
           s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
-          return BROTLI_SUCCESS;
+          return BROTLI_DECODER_SUCCESS;
         }
         s->size_nibbles = (uint8_t)bits;
         s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_METADATA;
@@ -272,22 +284,24 @@ static BrotliErrorCode BROTLI_NOINLINE DecodeMetaBlockLength(
 
       case BROTLI_STATE_METABLOCK_HEADER_METADATA:
         i = s->loop_counter;
-        for (; i < s->size_nibbles; ++i) {
+        for (; i < (int)s->size_nibbles; ++i) {
           if (!BrotliSafeReadBits(br, 8, &bits)) {
             s->loop_counter = i;
-            return BROTLI_NEEDS_MORE_INPUT;
+            return BROTLI_DECODER_NEEDS_MORE_INPUT;
           }
           if (i + 1 == s->size_nibbles && s->size_nibbles > 1 && bits == 0) {
-            return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_EXUBERANT_META_NIBBLE);
+            return BROTLI_FAILURE(
+                BROTLI_DECODER_ERROR_FORMAT_EXUBERANT_META_NIBBLE);
           }
           s->meta_block_remaining_len |= (int)(bits << (i * 8));
         }
         ++s->meta_block_remaining_len;
         s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
-        return BROTLI_SUCCESS;
+        return BROTLI_DECODER_SUCCESS;
 
       default:
-        return BROTLI_FAILURE(BROTLI_ERROR_UNREACHABLE);
+        return
+            BROTLI_FAILURE(BROTLI_DECODER_ERROR_UNREACHABLE);
     }
   }
 }
@@ -319,17 +333,16 @@ static BROTLI_INLINE uint32_t ReadSymbol(const HuffmanCode* table,
 
 /* Same as DecodeSymbol, but it is known that there is less than 15 bits of
    input are currently available. */
-static BROTLI_NOINLINE int SafeDecodeSymbol(const HuffmanCode* table,
-                                            BrotliBitReader* br,
-                                            uint32_t* result) {
+static BROTLI_NOINLINE BROTLI_BOOL SafeDecodeSymbol(
+    const HuffmanCode* table, BrotliBitReader* br, uint32_t* result) {
   uint32_t val;
   uint32_t available_bits = BrotliGetAvailableBits(br);
   if (available_bits == 0) {
     if (table->bits == 0) {
       *result = table->value;
-      return 1;
+      return BROTLI_TRUE;
     }
-    return 0; /* No valid bits at all. */
+    return BROTLI_FALSE; /* No valid bits at all. */
   }
   val = (uint32_t)BrotliGetBitsUnmasked(br);
   table += val & HUFFMAN_TABLE_MASK;
@@ -337,13 +350,13 @@ static BROTLI_NOINLINE int SafeDecodeSymbol(const HuffmanCode* table,
     if (table->bits <= available_bits) {
       BrotliDropBits(br, table->bits);
       *result = table->value;
-      return 1;
+      return BROTLI_TRUE;
     } else {
-      return 0; /* Not enough bits for the first level. */
+      return BROTLI_FALSE; /* Not enough bits for the first level. */
     }
   }
   if (available_bits <= HUFFMAN_TABLE_BITS) {
-    return 0; /* Not enough bits to move to the second level. */
+    return BROTLI_FALSE; /* Not enough bits to move to the second level. */
   }
 
   /* Speculatively drop HUFFMAN_TABLE_BITS. */
@@ -351,21 +364,20 @@ static BROTLI_NOINLINE int SafeDecodeSymbol(const HuffmanCode* table,
   available_bits -= HUFFMAN_TABLE_BITS;
   table += table->value + val;
   if (available_bits < table->bits) {
-    return 0; /* Not enough bits for the second level. */
+    return BROTLI_FALSE; /* Not enough bits for the second level. */
   }
 
   BrotliDropBits(br, HUFFMAN_TABLE_BITS + table->bits);
   *result = table->value;
-  return 1;
+  return BROTLI_TRUE;
 }
 
-static BROTLI_INLINE int SafeReadSymbol(const HuffmanCode* table,
-                                        BrotliBitReader* br,
-                                        uint32_t* result) {
+static BROTLI_INLINE BROTLI_BOOL SafeReadSymbol(
+    const HuffmanCode* table, BrotliBitReader* br, uint32_t* result) {
   uint32_t val;
-  if (PREDICT_TRUE(BrotliSafeGetBits(br, 15, &val))) {
+  if (BROTLI_PREDICT_TRUE(BrotliSafeGetBits(br, 15, &val))) {
     *result = DecodeSymbol(val, table, br);
-    return 1;
+    return BROTLI_TRUE;
   }
   return SafeDecodeSymbol(table, br, result);
 }
@@ -391,7 +403,7 @@ static BROTLI_INLINE uint32_t ReadPreloadedSymbol(const HuffmanCode* table,
                                                   uint32_t* bits,
                                                   uint32_t* value) {
   uint32_t result = *value;
-  if (PREDICT_FALSE(*bits > HUFFMAN_TABLE_BITS)) {
+  if (BROTLI_PREDICT_FALSE(*bits > HUFFMAN_TABLE_BITS)) {
     uint32_t val = BrotliGet16BitsUnmasked(br);
     const HuffmanCode* ext = table + (val & HUFFMAN_TABLE_MASK) + *value;
     uint32_t mask = BitMask((*bits - HUFFMAN_TABLE_BITS));
@@ -419,8 +431,8 @@ static BROTLI_INLINE uint32_t Log2Floor(uint32_t x) {
    Totally 1..4 symbols are read, 1..10 bits each.
    The list of symbols MUST NOT contain duplicates.
  */
-static BrotliErrorCode ReadSimpleHuffmanSymbols(uint32_t alphabet_size,
-                                                BrotliState* s) {
+static BrotliDecoderErrorCode ReadSimpleHuffmanSymbols(
+    uint32_t alphabet_size, BrotliDecoderState* s) {
   /* max_bits == 1..10; symbol == 0..3; 1..40 bits will be read. */
   BrotliBitReader* br = &s->br;
   uint32_t max_bits = Log2Floor(alphabet_size - 1);
@@ -428,13 +440,14 @@ static BrotliErrorCode ReadSimpleHuffmanSymbols(uint32_t alphabet_size,
   uint32_t num_symbols = s->symbol;
   while (i <= num_symbols) {
     uint32_t v;
-    if (PREDICT_FALSE(!BrotliSafeReadBits(br, max_bits, &v))) {
+    if (BROTLI_PREDICT_FALSE(!BrotliSafeReadBits(br, max_bits, &v))) {
       s->sub_loop_counter = i;
       s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_READ;
-      return BROTLI_NEEDS_MORE_INPUT;
+      return BROTLI_DECODER_NEEDS_MORE_INPUT;
     }
     if (v >= alphabet_size) {
-      return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_SIMPLE_HUFFMAN_ALPHABET);
+      return
+          BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_SIMPLE_HUFFMAN_ALPHABET);
     }
     s->symbols_lists_array[i] = (uint16_t)v;
     BROTLI_LOG_UINT(s->symbols_lists_array[i]);
@@ -445,19 +458,19 @@ static BrotliErrorCode ReadSimpleHuffmanSymbols(uint32_t alphabet_size,
     uint32_t k = i + 1;
     for (; k <= num_symbols; ++k) {
       if (s->symbols_lists_array[i] == s->symbols_lists_array[k]) {
-        return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_SIMPLE_HUFFMAN_SAME);
+        return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_SIMPLE_HUFFMAN_SAME);
       }
     }
   }
 
-  return BROTLI_SUCCESS;
+  return BROTLI_DECODER_SUCCESS;
 }
 
 /* Process single decoded symbol code length:
     A) reset the repeat variable
     B) remember code length (if it is not 0)
-    C) extend corredponding index-chain
-    D) reduce the huffman space
+    C) extend corresponding index-chain
+    D) reduce the Huffman space
     E) update the histogram
  */
 static BROTLI_INLINE void ProcessSingleCodeLength(uint32_t code_len,
@@ -478,12 +491,14 @@ static BROTLI_INLINE void ProcessSingleCodeLength(uint32_t code_len,
 
 /* Process repeated symbol code length.
     A) Check if it is the extension of previous repeat sequence; if the decoded
-       value is not kCodeLengthRepeatCode, then it is a new symbol-skip
+       value is not BROTLI_REPEAT_PREVIOUS_CODE_LENGTH, then it is a new
+       symbol-skip
     B) Update repeat variable
-    C) Check if operation is feasible (fits alphapet)
+    C) Check if operation is feasible (fits alphabet)
     D) For each symbol do the same operations as in ProcessSingleCodeLength
 
-   PRECONDITION: code_len == kCodeLengthRepeatCode or kCodeLengthRepeatCode + 1
+   PRECONDITION: code_len == BROTLI_REPEAT_PREVIOUS_CODE_LENGTH or
+                 code_len == BROTLI_REPEAT_ZERO_CODE_LENGTH
  */
 static BROTLI_INLINE void ProcessRepeatedCodeLength(uint32_t code_len,
     uint32_t repeat_delta, uint32_t alphabet_size, uint32_t* symbol,
@@ -491,9 +506,11 @@ static BROTLI_INLINE void ProcessRepeatedCodeLength(uint32_t code_len,
     uint32_t* repeat_code_len, uint16_t* symbol_lists,
     uint16_t* code_length_histo, int* next_symbol) {
   uint32_t old_repeat;
-  uint32_t new_len = 0;
-  if (code_len == kCodeLengthRepeatCode) {
+  uint32_t extra_bits = 3;  /* for BROTLI_REPEAT_ZERO_CODE_LENGTH */
+  uint32_t new_len = 0;  /* for BROTLI_REPEAT_ZERO_CODE_LENGTH */
+  if (code_len == BROTLI_REPEAT_PREVIOUS_CODE_LENGTH) {
     new_len = *prev_code_len;
+    extra_bits = 2;
   }
   if (*repeat_code_len != new_len) {
     *repeat = 0;
@@ -502,7 +519,7 @@ static BROTLI_INLINE void ProcessRepeatedCodeLength(uint32_t code_len,
   old_repeat = *repeat;
   if (*repeat > 0) {
     *repeat -= 2;
-    *repeat <<= code_len - 14U;
+    *repeat <<= extra_bits;
   }
   *repeat += repeat_delta + 3U;
   repeat_delta = *repeat - old_repeat;
@@ -531,8 +548,8 @@ static BROTLI_INLINE void ProcessRepeatedCodeLength(uint32_t code_len,
 }
 
 /* Reads and decodes symbol codelengths. */
-static BrotliErrorCode ReadSymbolCodeLengths(
-    uint32_t alphabet_size, BrotliState* s) {
+static BrotliDecoderErrorCode ReadSymbolCodeLengths(
+    uint32_t alphabet_size, BrotliDecoderState* s) {
   BrotliBitReader* br = &s->br;
   uint32_t symbol = s->symbol;
   uint32_t repeat = s->repeat;
@@ -543,7 +560,7 @@ static BrotliErrorCode ReadSymbolCodeLengths(
   uint16_t* code_length_histo = s->code_length_histo;
   int* next_symbol = s->next_symbol;
   if (!BrotliWarmupBitReader(br)) {
-    return BROTLI_NEEDS_MORE_INPUT;
+    return BROTLI_DECODER_NEEDS_MORE_INPUT;
   }
   while (symbol < alphabet_size && space > 0) {
     const HuffmanCode* p = s->table;
@@ -554,44 +571,53 @@ static BrotliErrorCode ReadSymbolCodeLengths(
       s->prev_code_len = prev_code_len;
       s->repeat_code_len = repeat_code_len;
       s->space = space;
-      return BROTLI_NEEDS_MORE_INPUT;
+      return BROTLI_DECODER_NEEDS_MORE_INPUT;
     }
     BrotliFillBitWindow16(br);
     p += BrotliGetBitsUnmasked(br) &
         BitMask(BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH);
     BrotliDropBits(br, p->bits);  /* Use 1..5 bits */
     code_len = p->value;  /* code_len == 0..17 */
-    if (code_len < kCodeLengthRepeatCode) {
+    if (code_len < BROTLI_REPEAT_PREVIOUS_CODE_LENGTH) {
       ProcessSingleCodeLength(code_len, &symbol, &repeat, &space,
           &prev_code_len, symbol_lists, code_length_histo, next_symbol);
     } else { /* code_len == 16..17, extra_bits == 2..3 */
+      uint32_t extra_bits =
+          (code_len == BROTLI_REPEAT_PREVIOUS_CODE_LENGTH) ? 2 : 3;
       uint32_t repeat_delta =
-          (uint32_t)BrotliGetBitsUnmasked(br) & BitMask(code_len - 14U);
-      BrotliDropBits(br, code_len - 14U);
+          (uint32_t)BrotliGetBitsUnmasked(br) & BitMask(extra_bits);
+      BrotliDropBits(br, extra_bits);
       ProcessRepeatedCodeLength(code_len, repeat_delta, alphabet_size,
           &symbol, &repeat, &space, &prev_code_len, &repeat_code_len,
           symbol_lists, code_length_histo, next_symbol);
     }
   }
   s->space = space;
-  return BROTLI_SUCCESS;
+  return BROTLI_DECODER_SUCCESS;
 }
 
-static BrotliErrorCode SafeReadSymbolCodeLengths(
-    uint32_t alphabet_size, BrotliState* s) {
+static BrotliDecoderErrorCode SafeReadSymbolCodeLengths(
+    uint32_t alphabet_size, BrotliDecoderState* s) {
   BrotliBitReader* br = &s->br;
+  BROTLI_BOOL get_byte = BROTLI_FALSE;
   while (s->symbol < alphabet_size && s->space > 0) {
     const HuffmanCode* p = s->table;
     uint32_t code_len;
+    uint32_t available_bits;
     uint32_t bits = 0;
-    uint32_t available_bits = BrotliGetAvailableBits(br);
+    if (get_byte && !BrotliPullByte(br)) return BROTLI_DECODER_NEEDS_MORE_INPUT;
+    get_byte = BROTLI_FALSE;
+    available_bits = BrotliGetAvailableBits(br);
     if (available_bits != 0) {
       bits = (uint32_t)BrotliGetBitsUnmasked(br);
     }
     p += bits & BitMask(BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH);
-    if (p->bits > available_bits) goto pullMoreInput;
+    if (p->bits > available_bits) {
+      get_byte = BROTLI_TRUE;
+      continue;
+    }
     code_len = p->value; /* code_len == 0..17 */
-    if (code_len < kCodeLengthRepeatCode) {
+    if (code_len < BROTLI_REPEAT_PREVIOUS_CODE_LENGTH) {
       BrotliDropBits(br, p->bits);
       ProcessSingleCodeLength(code_len, &s->symbol, &s->repeat, &s->space,
           &s->prev_code_len, s->symbol_lists, s->code_length_histo,
@@ -599,35 +625,32 @@ static BrotliErrorCode SafeReadSymbolCodeLengths(
     } else { /* code_len == 16..17, extra_bits == 2..3 */
       uint32_t extra_bits = code_len - 14U;
       uint32_t repeat_delta = (bits >> p->bits) & BitMask(extra_bits);
-      if (available_bits < p->bits + extra_bits) goto pullMoreInput;
+      if (available_bits < p->bits + extra_bits) {
+        get_byte = BROTLI_TRUE;
+        continue;
+      }
       BrotliDropBits(br, p->bits + extra_bits);
       ProcessRepeatedCodeLength(code_len, repeat_delta, alphabet_size,
           &s->symbol, &s->repeat, &s->space, &s->prev_code_len,
           &s->repeat_code_len, s->symbol_lists, s->code_length_histo,
           s->next_symbol);
     }
-    continue;
-
-pullMoreInput:
-    if (!BrotliPullByte(br)) {
-      return BROTLI_NEEDS_MORE_INPUT;
-    }
   }
-  return BROTLI_SUCCESS;
+  return BROTLI_DECODER_SUCCESS;
 }
 
 /* Reads and decodes 15..18 codes using static prefix code.
    Each code is 2..4 bits long. In total 30..72 bits are used. */
-static BrotliErrorCode ReadCodeLengthCodeLengths(BrotliState* s) {
+static BrotliDecoderErrorCode ReadCodeLengthCodeLengths(BrotliDecoderState* s) {
   BrotliBitReader* br = &s->br;
   uint32_t num_codes = s->repeat;
   unsigned space = s->space;
   uint32_t i = s->sub_loop_counter;
-  for (; i < CODE_LENGTH_CODES; ++i) {
+  for (; i < BROTLI_CODE_LENGTH_CODES; ++i) {
     const uint8_t code_len_idx = kCodeLengthCodeOrder[i];
     uint32_t ix;
     uint32_t v;
-    if (PREDICT_FALSE(!BrotliSafeGetBits(br, 4, &ix))) {
+    if (BROTLI_PREDICT_FALSE(!BrotliSafeGetBits(br, 4, &ix))) {
       uint32_t available_bits = BrotliGetAvailableBits(br);
       if (available_bits != 0) {
         ix = BrotliGetBitsUnmasked(br) & 0xF;
@@ -639,7 +662,7 @@ static BrotliErrorCode ReadCodeLengthCodeLengths(BrotliState* s) {
         s->repeat = num_codes;
         s->space = space;
         s->substate_huffman = BROTLI_STATE_HUFFMAN_COMPLEX;
-        return BROTLI_NEEDS_MORE_INPUT;
+        return BROTLI_DECODER_NEEDS_MORE_INPUT;
       }
     }
     v = kCodeLengthPrefixValue[ix];
@@ -657,9 +680,9 @@ static BrotliErrorCode ReadCodeLengthCodeLengths(BrotliState* s) {
     }
   }
   if (!(num_codes == 1 || space == 0)) {
-    return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_CL_SPACE);
+    return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_CL_SPACE);
   }
-  return BROTLI_SUCCESS;
+  return BROTLI_DECODER_SUCCESS;
 }
 
 /* Decodes the Huffman tables.
@@ -674,119 +697,123 @@ static BrotliErrorCode ReadCodeLengthCodeLengths(BrotliState* s) {
     B.2) Decoded table is used to decode code lengths of symbols in resulting
          Huffman table. In worst case 3520 bits are read.
 */
-static BrotliErrorCode ReadHuffmanCode(uint32_t alphabet_size,
-                                       HuffmanCode* table,
-                                       uint32_t* opt_table_size,
-                                       BrotliState* s) {
+static BrotliDecoderErrorCode ReadHuffmanCode(uint32_t alphabet_size,
+                                              HuffmanCode* table,
+                                              uint32_t* opt_table_size,
+                                              BrotliDecoderState* s) {
   BrotliBitReader* br = &s->br;
   /* Unnecessary masking, but might be good for safety. */
   alphabet_size &= 0x3ff;
   /* State machine */
-  switch (s->substate_huffman) {
-    case BROTLI_STATE_HUFFMAN_NONE:
-      if (!BrotliSafeReadBits(br, 2, &s->sub_loop_counter)) {
-        return BROTLI_NEEDS_MORE_INPUT;
-      }
-      BROTLI_LOG_UINT(s->sub_loop_counter);
-      /* The value is used as follows:
-         1 for simple code;
-         0 for no skipping, 2 skips 2 code lengths, 3 skips 3 code lengths */
-      if (s->sub_loop_counter != 1) {
-        s->space = 32;
-        s->repeat = 0; /* num_codes */
-        memset(&s->code_length_histo[0], 0, sizeof(s->code_length_histo[0]) *
-            (BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH + 1));
-        memset(&s->code_length_code_lengths[0], 0,
-            sizeof(s->code_length_code_lengths));
-        s->substate_huffman = BROTLI_STATE_HUFFMAN_COMPLEX;
-        goto Complex;
-      }
-      /* No break, transit to the next state. */
+  for (;;) {
+    switch (s->substate_huffman) {
+      case BROTLI_STATE_HUFFMAN_NONE:
+        if (!BrotliSafeReadBits(br, 2, &s->sub_loop_counter)) {
+          return BROTLI_DECODER_NEEDS_MORE_INPUT;
+        }
+        BROTLI_LOG_UINT(s->sub_loop_counter);
+        /* The value is used as follows:
+           1 for simple code;
+           0 for no skipping, 2 skips 2 code lengths, 3 skips 3 code lengths */
+        if (s->sub_loop_counter != 1) {
+          s->space = 32;
+          s->repeat = 0; /* num_codes */
+          memset(&s->code_length_histo[0], 0, sizeof(s->code_length_histo[0]) *
+              (BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH + 1));
+          memset(&s->code_length_code_lengths[0], 0,
+              sizeof(s->code_length_code_lengths));
+          s->substate_huffman = BROTLI_STATE_HUFFMAN_COMPLEX;
+          continue;
+        }
+        /* No break, transit to the next state. */
 
-    case BROTLI_STATE_HUFFMAN_SIMPLE_SIZE:
-      /* Read symbols, codes & code lengths directly. */
-      if (!BrotliSafeReadBits(br, 2, &s->symbol)) { /* num_symbols */
-        s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_SIZE;
-        return BROTLI_NEEDS_MORE_INPUT;
-      }
-      s->sub_loop_counter = 0;
-      /* No break, transit to the next state. */
-    case BROTLI_STATE_HUFFMAN_SIMPLE_READ: {
-      BrotliErrorCode result = ReadSimpleHuffmanSymbols(alphabet_size, s);
-      if (result != BROTLI_SUCCESS) {
-        return result;
-      }
-      /* No break, transit to the next state. */
-    }
-    case BROTLI_STATE_HUFFMAN_SIMPLE_BUILD: {
-      uint32_t table_size;
-      if (s->symbol == 3) {
-        uint32_t bits;
-        if (!BrotliSafeReadBits(br, 1, &bits)) {
-          s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_BUILD;
-          return BROTLI_NEEDS_MORE_INPUT;
+      case BROTLI_STATE_HUFFMAN_SIMPLE_SIZE:
+        /* Read symbols, codes & code lengths directly. */
+        if (!BrotliSafeReadBits(br, 2, &s->symbol)) { /* num_symbols */
+          s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_SIZE;
+          return BROTLI_DECODER_NEEDS_MORE_INPUT;
         }
-        s->symbol += bits;
+        s->sub_loop_counter = 0;
+        /* No break, transit to the next state. */
+      case BROTLI_STATE_HUFFMAN_SIMPLE_READ: {
+        BrotliDecoderErrorCode result =
+            ReadSimpleHuffmanSymbols(alphabet_size, s);
+        if (result != BROTLI_DECODER_SUCCESS) {
+          return result;
+        }
+        /* No break, transit to the next state. */
       }
-      BROTLI_LOG_UINT(s->symbol);
-      table_size = BrotliBuildSimpleHuffmanTable(
-          table, HUFFMAN_TABLE_BITS, s->symbols_lists_array, s->symbol);
-      if (opt_table_size) {
-        *opt_table_size = table_size;
+      case BROTLI_STATE_HUFFMAN_SIMPLE_BUILD: {
+        uint32_t table_size;
+        if (s->symbol == 3) {
+          uint32_t bits;
+          if (!BrotliSafeReadBits(br, 1, &bits)) {
+            s->substate_huffman = BROTLI_STATE_HUFFMAN_SIMPLE_BUILD;
+            return BROTLI_DECODER_NEEDS_MORE_INPUT;
+          }
+          s->symbol += bits;
+        }
+        BROTLI_LOG_UINT(s->symbol);
+        table_size = BrotliBuildSimpleHuffmanTable(
+            table, HUFFMAN_TABLE_BITS, s->symbols_lists_array, s->symbol);
+        if (opt_table_size) {
+          *opt_table_size = table_size;
+        }
+        s->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
+        return BROTLI_DECODER_SUCCESS;
       }
-      s->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
-      return BROTLI_SUCCESS;
-    }
 
-Complex: /* Decode Huffman-coded code lengths. */
-    case BROTLI_STATE_HUFFMAN_COMPLEX: {
-      uint32_t i;
-      BrotliErrorCode result = ReadCodeLengthCodeLengths(s);
-      if (result != BROTLI_SUCCESS) {
-        return result;
-      }
-      BrotliBuildCodeLengthsHuffmanTable(s->table,
-                                         s->code_length_code_lengths,
-                                         s->code_length_histo);
-      memset(&s->code_length_histo[0], 0, sizeof(s->code_length_histo));
-      for (i = 0; i <= BROTLI_HUFFMAN_MAX_CODE_LENGTH; ++i) {
-        s->next_symbol[i] = (int)i - (BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1);
-        s->symbol_lists[(int)i - (BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1)] = 0xFFFF;
-      }
+      /* Decode Huffman-coded code lengths. */
+      case BROTLI_STATE_HUFFMAN_COMPLEX: {
+        uint32_t i;
+        BrotliDecoderErrorCode result = ReadCodeLengthCodeLengths(s);
+        if (result != BROTLI_DECODER_SUCCESS) {
+          return result;
+        }
+        BrotliBuildCodeLengthsHuffmanTable(s->table,
+                                           s->code_length_code_lengths,
+                                           s->code_length_histo);
+        memset(&s->code_length_histo[0], 0, sizeof(s->code_length_histo));
+        for (i = 0; i <= BROTLI_HUFFMAN_MAX_CODE_LENGTH; ++i) {
+          s->next_symbol[i] = (int)i - (BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1);
+          s->symbol_lists[s->next_symbol[i]] = 0xFFFF;
+        }
 
-      s->symbol = 0;
-      s->prev_code_len = kDefaultCodeLength;
-      s->repeat = 0;
-      s->repeat_code_len = 0;
-      s->space = 32768;
-      s->substate_huffman = BROTLI_STATE_HUFFMAN_LENGTH_SYMBOLS;
-      /* No break, transit to the next state. */
-    }
-    case BROTLI_STATE_HUFFMAN_LENGTH_SYMBOLS: {
-      uint32_t table_size;
-      BrotliErrorCode result = ReadSymbolCodeLengths(alphabet_size, s);
-      if (result == BROTLI_NEEDS_MORE_INPUT) {
-        result = SafeReadSymbolCodeLengths(alphabet_size, s);
-      }
-      if (result != BROTLI_SUCCESS) {
-        return result;
+        s->symbol = 0;
+        s->prev_code_len = BROTLI_INITIAL_REPEATED_CODE_LENGTH;
+        s->repeat = 0;
+        s->repeat_code_len = 0;
+        s->space = 32768;
+        s->substate_huffman = BROTLI_STATE_HUFFMAN_LENGTH_SYMBOLS;
+        /* No break, transit to the next state. */
       }
+      case BROTLI_STATE_HUFFMAN_LENGTH_SYMBOLS: {
+        uint32_t table_size;
+        BrotliDecoderErrorCode result = ReadSymbolCodeLengths(alphabet_size, s);
+        if (result == BROTLI_DECODER_NEEDS_MORE_INPUT) {
+          result = SafeReadSymbolCodeLengths(alphabet_size, s);
+        }
+        if (result != BROTLI_DECODER_SUCCESS) {
+          return result;
+        }
 
-      if (s->space != 0) {
-        BROTLI_LOG(("[ReadHuffmanCode] space = %d\n", s->space));
-        return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_HUFFMAN_SPACE);
-      }
-      table_size = BrotliBuildHuffmanTable(
-          table, HUFFMAN_TABLE_BITS, s->symbol_lists, s->code_length_histo);
-      if (opt_table_size) {
-        *opt_table_size = table_size;
+        if (s->space != 0) {
+          BROTLI_LOG(("[ReadHuffmanCode] space = %d\n", s->space));
+          return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_HUFFMAN_SPACE);
+        }
+        table_size = BrotliBuildHuffmanTable(
+            table, HUFFMAN_TABLE_BITS, s->symbol_lists, s->code_length_histo);
+        if (opt_table_size) {
+          *opt_table_size = table_size;
+        }
+        s->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
+        return BROTLI_DECODER_SUCCESS;
       }
-      s->substate_huffman = BROTLI_STATE_HUFFMAN_NONE;
-      return BROTLI_SUCCESS;
-    }
 
-    default:
-      return BROTLI_FAILURE(BROTLI_ERROR_UNREACHABLE);
+      default:
+        return
+            BROTLI_FAILURE(BROTLI_DECODER_ERROR_UNREACHABLE);
+    }
   }
 }
 
@@ -802,14 +829,13 @@ static BROTLI_INLINE uint32_t ReadBlockLength(const HuffmanCode* table,
 
 /* WARNING: if state is not BROTLI_STATE_READ_BLOCK_LENGTH_NONE, then
    reading can't be continued with ReadBlockLength. */
-static BROTLI_INLINE int SafeReadBlockLength(BrotliState* s,
-                                             uint32_t* result,
-                                             const HuffmanCode* table,
-                                             BrotliBitReader* br) {
+static BROTLI_INLINE BROTLI_BOOL SafeReadBlockLength(
+    BrotliDecoderState* s, uint32_t* result, const HuffmanCode* table,
+    BrotliBitReader* br) {
   uint32_t index;
   if (s->substate_read_block_length == BROTLI_STATE_READ_BLOCK_LENGTH_NONE) {
     if (!SafeReadSymbol(table, br, &index)) {
-      return 0;
+      return BROTLI_FALSE;
     }
   } else {
     index = s->block_length_index;
@@ -820,11 +846,11 @@ static BROTLI_INLINE int SafeReadBlockLength(BrotliState* s,
     if (!BrotliSafeReadBits(br, nbits, &bits)) {
       s->block_length_index = index;
       s->substate_read_block_length = BROTLI_STATE_READ_BLOCK_LENGTH_SUFFIX;
-      return 0;
+      return BROTLI_FALSE;
     }
     *result = kBlockLengthPrefixCode[index].offset + bits;
     s->substate_read_block_length = BROTLI_STATE_READ_BLOCK_LENGTH_NONE;
-    return 1;
+    return BROTLI_TRUE;
   }
 }
 
@@ -843,45 +869,46 @@ static BROTLI_INLINE int SafeReadBlockLength(BrotliState* s,
    Most of input values are 0 and 1. To reduce number of branches, we replace
    inner for loop with do-while.
  */
-static BROTLI_NOINLINE void InverseMoveToFrontTransform(uint8_t* v,
-    uint32_t v_len, BrotliState* state) {
+static BROTLI_NOINLINE void InverseMoveToFrontTransform(
+    uint8_t* v, uint32_t v_len, BrotliDecoderState* state) {
   /* Reinitialize elements that could have been changed. */
-  uint32_t i = 4;
+  uint32_t i = 1;
   uint32_t upper_bound = state->mtf_upper_bound;
-  uint8_t* mtf = &state->mtf[4];  /* Make mtf[-1] addressable. */
+  uint32_t* mtf = &state->mtf[1];  /* Make mtf[-1] addressable. */
+  uint8_t* mtf_u8 = (uint8_t*)mtf;
   /* Load endian-aware constant. */
   const uint8_t b0123[4] = {0, 1, 2, 3};
   uint32_t pattern;
   memcpy(&pattern, &b0123, 4);
 
   /* Initialize list using 4 consequent values pattern. */
-  *(uint32_t*)mtf = pattern;
+  mtf[0] = pattern;
   do {
     pattern += 0x04040404; /* Advance all 4 values by 4. */
-    *(uint32_t*)(mtf + i) = pattern;
-    i += 4;
+    mtf[i] = pattern;
+    i++;
   } while (i <= upper_bound);
 
   /* Transform the input. */
   upper_bound = 0;
   for (i = 0; i < v_len; ++i) {
     int index = v[i];
-    uint8_t value = mtf[index];
+    uint8_t value = mtf_u8[index];
     upper_bound |= v[i];
     v[i] = value;
-    mtf[-1] = value;
+    mtf_u8[-1] = value;
     do {
       index--;
-      mtf[index + 1] = mtf[index];
+      mtf_u8[index + 1] = mtf_u8[index];
     } while (index >= 0);
   }
   /* Remember amount of elements to be reinitialized. */
-  state->mtf_upper_bound = upper_bound;
+  state->mtf_upper_bound = upper_bound >> 2;
 }
 
 /* Decodes a series of Huffman table using ReadHuffmanCode function. */
-static BrotliErrorCode HuffmanTreeGroupDecode(HuffmanTreeGroup* group,
-                                              BrotliState* s) {
+static BrotliDecoderErrorCode HuffmanTreeGroupDecode(
+    HuffmanTreeGroup* group, BrotliDecoderState* s) {
   if (s->substate_tree_group != BROTLI_STATE_TREE_GROUP_LOOP) {
     s->next = group->codes;
     s->htree_index = 0;
@@ -889,15 +916,15 @@ static BrotliErrorCode HuffmanTreeGroupDecode(HuffmanTreeGroup* group,
   }
   while (s->htree_index < group->num_htrees) {
     uint32_t table_size;
-    BrotliErrorCode result =
+    BrotliDecoderErrorCode result =
         ReadHuffmanCode(group->alphabet_size, s->next, &table_size, s);
-    if (result != BROTLI_SUCCESS) return result;
+    if (result != BROTLI_DECODER_SUCCESS) return result;
     group->htrees[s->htree_index] = s->next;
     s->next += table_size;
     ++s->htree_index;
   }
   s->substate_tree_group = BROTLI_STATE_TREE_GROUP_NONE;
-  return BROTLI_SUCCESS;
+  return BROTLI_DECODER_SUCCESS;
 }
 
 /* Decodes a context map.
@@ -909,17 +936,17 @@ static BrotliErrorCode HuffmanTreeGroupDecode(HuffmanTreeGroup* group,
     3) Read context map items; "0" values could be run-length encoded.
     4) Optionally, apply InverseMoveToFront transform to the resulting map.
  */
-static BrotliErrorCode DecodeContextMap(uint32_t context_map_size,
-                                        uint32_t* num_htrees,
-                                        uint8_t** context_map_arg,
-                                        BrotliState* s) {
+static BrotliDecoderErrorCode DecodeContextMap(uint32_t context_map_size,
+                                               uint32_t* num_htrees,
+                                               uint8_t** context_map_arg,
+                                               BrotliDecoderState* s) {
   BrotliBitReader* br = &s->br;
-  BrotliErrorCode result = BROTLI_SUCCESS;
+  BrotliDecoderErrorCode result = BROTLI_DECODER_SUCCESS;
 
   switch ((int)s->substate_context_map) {
     case BROTLI_STATE_CONTEXT_MAP_NONE:
       result = DecodeVarLenUint8(s, br, num_htrees);
-      if (result != BROTLI_SUCCESS) {
+      if (result != BROTLI_DECODER_SUCCESS) {
         return result;
       }
       (*num_htrees)++;
@@ -928,11 +955,11 @@ static BrotliErrorCode DecodeContextMap(uint32_t context_map_size,
       BROTLI_LOG_UINT(*num_htrees);
       *context_map_arg = (uint8_t*)BROTLI_ALLOC(s, (size_t)context_map_size);
       if (*context_map_arg == 0) {
-        return BROTLI_FAILURE(BROTLI_ERROR_ALLOC_CONTEXT_MAP);
+        return BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_CONTEXT_MAP);
       }
       if (*num_htrees <= 1) {
         memset(*context_map_arg, 0, (size_t)context_map_size);
-        return BROTLI_SUCCESS;
+        return BROTLI_DECODER_SUCCESS;
       }
       s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_READ_PREFIX;
       /* No break, continue to next state. */
@@ -941,9 +968,9 @@ static BrotliErrorCode DecodeContextMap(uint32_t context_map_size,
       /* In next stage ReadHuffmanCode uses at least 4 bits, so it is safe
          to peek 4 bits ahead. */
       if (!BrotliSafeGetBits(br, 5, &bits)) {
-        return BROTLI_NEEDS_MORE_INPUT;
+        return BROTLI_DECODER_NEEDS_MORE_INPUT;
       }
-      if ((bits & 1) != 0) { /* Use RLE for zeroes. */
+      if ((bits & 1) != 0) { /* Use RLE for zeros. */
         s->max_run_length_prefix = (bits >> 1) + 1;
         BrotliDropBits(br, 5);
       } else {
@@ -957,7 +984,7 @@ static BrotliErrorCode DecodeContextMap(uint32_t context_map_size,
     case BROTLI_STATE_CONTEXT_MAP_HUFFMAN:
       result = ReadHuffmanCode(*num_htrees + s->max_run_length_prefix,
                                s->context_map_table, NULL, s);
-      if (result != BROTLI_SUCCESS) return result;
+      if (result != BROTLI_DECODER_SUCCESS) return result;
       s->code = 0xFFFF;
       s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_DECODE;
       /* No break, continue to next state. */
@@ -966,38 +993,41 @@ static BrotliErrorCode DecodeContextMap(uint32_t context_map_size,
       uint32_t max_run_length_prefix = s->max_run_length_prefix;
       uint8_t* context_map = *context_map_arg;
       uint32_t code = s->code;
-      if (code != 0xFFFF) {
-        goto rleCode;
-      }
-      while (context_index < context_map_size) {
-        if (!SafeReadSymbol(s->context_map_table, br, &code)) {
-          s->code = 0xFFFF;
-          s->context_index = context_index;
-          return BROTLI_NEEDS_MORE_INPUT;
-        }
-        BROTLI_LOG_UINT(code);
+      BROTLI_BOOL skip_preamble = (code != 0xFFFF);
+      while (context_index < context_map_size || skip_preamble) {
+        if (!skip_preamble) {
+          if (!SafeReadSymbol(s->context_map_table, br, &code)) {
+            s->code = 0xFFFF;
+            s->context_index = context_index;
+            return BROTLI_DECODER_NEEDS_MORE_INPUT;
+          }
+          BROTLI_LOG_UINT(code);
 
-        if (code == 0) {
-          context_map[context_index++] = 0;
-          continue;
-        }
-        if (code > max_run_length_prefix) {
-          context_map[context_index++] =
-              (uint8_t)(code - max_run_length_prefix);
-          continue;
+          if (code == 0) {
+            context_map[context_index++] = 0;
+            continue;
+          }
+          if (code > max_run_length_prefix) {
+            context_map[context_index++] =
+                (uint8_t)(code - max_run_length_prefix);
+            continue;
+          }
+        } else {
+          skip_preamble = BROTLI_FALSE;
         }
-rleCode:
+        /* RLE sub-stage. */
         {
           uint32_t reps;
           if (!BrotliSafeReadBits(br, code, &reps)) {
             s->code = code;
             s->context_index = context_index;
-            return BROTLI_NEEDS_MORE_INPUT;
+            return BROTLI_DECODER_NEEDS_MORE_INPUT;
           }
           reps += 1U << code;
           BROTLI_LOG_UINT(reps);
           if (context_index + reps > context_map_size) {
-            return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_CONTEXT_MAP_REPEAT);
+            return
+                BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_CONTEXT_MAP_REPEAT);
           }
           do {
             context_map[context_index++] = 0;
@@ -1010,23 +1040,24 @@ rleCode:
       uint32_t bits;
       if (!BrotliSafeReadBits(br, 1, &bits)) {
         s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_TRANSFORM;
-        return BROTLI_NEEDS_MORE_INPUT;
+        return BROTLI_DECODER_NEEDS_MORE_INPUT;
       }
       if (bits != 0) {
         InverseMoveToFrontTransform(*context_map_arg, context_map_size, s);
       }
       s->substate_context_map = BROTLI_STATE_CONTEXT_MAP_NONE;
-      return BROTLI_SUCCESS;
+      return BROTLI_DECODER_SUCCESS;
     }
     default:
-      return BROTLI_FAILURE(BROTLI_ERROR_UNREACHABLE);
+      return
+          BROTLI_FAILURE(BROTLI_DECODER_ERROR_UNREACHABLE);
   }
 }
 
-/* Decodes a command or literal and updates block type ringbuffer.
+/* Decodes a command or literal and updates block type ring-buffer.
    Reads 3..54 bits. */
-static BROTLI_INLINE int DecodeBlockTypeAndLength(int safe,
-    BrotliState* s, int tree_type) {
+static BROTLI_INLINE BROTLI_BOOL DecodeBlockTypeAndLength(
+    int safe, BrotliDecoderState* s, int tree_type) {
   uint32_t max_block_type = s->num_block_types[tree_type];
   const HuffmanCode* type_tree = &s->block_type_trees[
       tree_type * BROTLI_HUFFMAN_MAX_SIZE_258];
@@ -1043,11 +1074,11 @@ static BROTLI_INLINE int DecodeBlockTypeAndLength(int safe,
   } else {
     BrotliBitReaderState memento;
     BrotliBitReaderSaveState(br, &memento);
-    if (!SafeReadSymbol(type_tree, br, &block_type)) return 0;
+    if (!SafeReadSymbol(type_tree, br, &block_type)) return BROTLI_FALSE;
     if (!SafeReadBlockLength(s, &s->block_length[tree_type], len_tree, br)) {
       s->substate_read_block_length = BROTLI_STATE_READ_BLOCK_LENGTH_NONE;
       BrotliBitReaderRestoreState(br, &memento);
-      return 0;
+      return BROTLI_FALSE;
     }
   }
 
@@ -1063,18 +1094,19 @@ static BROTLI_INLINE int DecodeBlockTypeAndLength(int safe,
   }
   ringbuffer[0] = ringbuffer[1];
   ringbuffer[1] = block_type;
-  return 1;
+  return BROTLI_TRUE;
 }
 
-static BROTLI_INLINE void DetectTrivialLiteralBlockTypes(BrotliState* s) {
+static BROTLI_INLINE void DetectTrivialLiteralBlockTypes(
+    BrotliDecoderState* s) {
   size_t i;
   for (i = 0; i < 8; ++i) s->trivial_literal_contexts[i] = 0;
   for (i = 0; i < s->num_block_types[0]; i++) {
-    size_t offset = i << kLiteralContextBits;
+    size_t offset = i << BROTLI_LITERAL_CONTEXT_BITS;
     size_t error = 0;
     size_t sample = s->context_map[offset];
     size_t j;
-    for (j = 0; j < (1u << kLiteralContextBits);) {
+    for (j = 0; j < (1u << BROTLI_LITERAL_CONTEXT_BITS);) {
       BROTLI_REPEAT(4, error |= s->context_map[offset + j++] ^ sample;)
     }
     if (error == 0) {
@@ -1083,11 +1115,11 @@ static BROTLI_INLINE void DetectTrivialLiteralBlockTypes(BrotliState* s) {
   }
 }
 
-static BROTLI_INLINE void PrepareLiteralDecoding(BrotliState* s) {
+static BROTLI_INLINE void PrepareLiteralDecoding(BrotliDecoderState* s) {
   uint8_t context_mode;
   size_t trivial;
   uint32_t block_type = s->block_type_rb[1];
-  uint32_t context_offset = block_type << kLiteralContextBits;
+  uint32_t context_offset = block_type << BROTLI_LITERAL_CONTEXT_BITS;
   s->context_map_slice = s->context_map + context_offset;
   trivial = s->trivial_literal_contexts[block_type >> 5];
   s->trivial_literal_context = (trivial >> (block_type & 31)) & 1;
@@ -1099,135 +1131,171 @@ static BROTLI_INLINE void PrepareLiteralDecoding(BrotliState* s) {
 
 /* Decodes the block type and updates the state for literal context.
    Reads 3..54 bits. */
-static BROTLI_INLINE int DecodeLiteralBlockSwitchInternal(int safe,
-    BrotliState* s) {
+static BROTLI_INLINE BROTLI_BOOL DecodeLiteralBlockSwitchInternal(
+    int safe, BrotliDecoderState* s) {
   if (!DecodeBlockTypeAndLength(safe, s, 0)) {
-    return 0;
+    return BROTLI_FALSE;
   }
   PrepareLiteralDecoding(s);
-  return 1;
+  return BROTLI_TRUE;
 }
 
-static void BROTLI_NOINLINE DecodeLiteralBlockSwitch(BrotliState* s) {
+static void BROTLI_NOINLINE DecodeLiteralBlockSwitch(BrotliDecoderState* s) {
   DecodeLiteralBlockSwitchInternal(0, s);
 }
 
-static int BROTLI_NOINLINE SafeDecodeLiteralBlockSwitch(BrotliState* s) {
+static BROTLI_BOOL BROTLI_NOINLINE SafeDecodeLiteralBlockSwitch(
+    BrotliDecoderState* s) {
   return DecodeLiteralBlockSwitchInternal(1, s);
 }
 
 /* Block switch for insert/copy length.
    Reads 3..54 bits. */
-static BROTLI_INLINE int DecodeCommandBlockSwitchInternal(int safe,
-    BrotliState* s) {
+static BROTLI_INLINE BROTLI_BOOL DecodeCommandBlockSwitchInternal(
+    int safe, BrotliDecoderState* s) {
   if (!DecodeBlockTypeAndLength(safe, s, 1)) {
-    return 0;
+    return BROTLI_FALSE;
   }
   s->htree_command = s->insert_copy_hgroup.htrees[s->block_type_rb[3]];
-  return 1;
+  return BROTLI_TRUE;
 }
 
-static void BROTLI_NOINLINE DecodeCommandBlockSwitch(BrotliState* s) {
+static void BROTLI_NOINLINE DecodeCommandBlockSwitch(BrotliDecoderState* s) {
   DecodeCommandBlockSwitchInternal(0, s);
 }
-static int BROTLI_NOINLINE SafeDecodeCommandBlockSwitch(BrotliState* s) {
+static BROTLI_BOOL BROTLI_NOINLINE SafeDecodeCommandBlockSwitch(
+    BrotliDecoderState* s) {
   return DecodeCommandBlockSwitchInternal(1, s);
 }
 
 /* Block switch for distance codes.
    Reads 3..54 bits. */
-static BROTLI_INLINE int DecodeDistanceBlockSwitchInternal(int safe,
-    BrotliState* s) {
+static BROTLI_INLINE BROTLI_BOOL DecodeDistanceBlockSwitchInternal(
+    int safe, BrotliDecoderState* s) {
   if (!DecodeBlockTypeAndLength(safe, s, 2)) {
-    return 0;
+    return BROTLI_FALSE;
   }
-  s->dist_context_map_slice =
-      s->dist_context_map + (s->block_type_rb[5] << kDistanceContextBits);
+  s->dist_context_map_slice = s->dist_context_map +
+      (s->block_type_rb[5] << BROTLI_DISTANCE_CONTEXT_BITS);
   s->dist_htree_index = s->dist_context_map_slice[s->distance_context];
-  return 1;
+  return BROTLI_TRUE;
 }
 
-static void BROTLI_NOINLINE DecodeDistanceBlockSwitch(BrotliState* s) {
+static void BROTLI_NOINLINE DecodeDistanceBlockSwitch(BrotliDecoderState* s) {
   DecodeDistanceBlockSwitchInternal(0, s);
 }
 
-static int BROTLI_NOINLINE SafeDecodeDistanceBlockSwitch(BrotliState* s) {
+static BROTLI_BOOL BROTLI_NOINLINE SafeDecodeDistanceBlockSwitch(
+    BrotliDecoderState* s) {
   return DecodeDistanceBlockSwitchInternal(1, s);
 }
 
-static BrotliErrorCode BROTLI_NOINLINE WriteRingBuffer(size_t* available_out,
-    uint8_t** next_out, size_t* total_out, BrotliState* s) {
-  size_t pos = (s->pos > s->ringbuffer_size) ? (size_t)s->ringbuffer_size
-                                             : (size_t)(s->pos);
+static size_t UnwrittenBytes(const BrotliDecoderState* s, BROTLI_BOOL wrap) {
+  size_t pos = wrap && s->pos > s->ringbuffer_size ?
+      (size_t)s->ringbuffer_size : (size_t)(s->pos);
+  size_t partial_pos_rb = (s->rb_roundtrips * (size_t)s->ringbuffer_size) + pos;
+  return partial_pos_rb - s->partial_pos_out;
+}
+
+/* Dumps output.
+   Returns BROTLI_DECODER_NEEDS_MORE_OUTPUT only if there is more output to push
+   and either ring-buffer is as big as window size, or |force| is true.
+ */
+static BrotliDecoderErrorCode BROTLI_NOINLINE WriteRingBuffer(
+    BrotliDecoderState* s, size_t* available_out, uint8_t** next_out,
+    size_t* total_out, BROTLI_BOOL force) {
   uint8_t* start =
       s->ringbuffer + (s->partial_pos_out & (size_t)s->ringbuffer_mask);
-  size_t partial_pos_rb = (s->rb_roundtrips * (size_t)s->ringbuffer_size) + pos;
-  size_t to_write = (partial_pos_rb - s->partial_pos_out);
+  size_t to_write = UnwrittenBytes(s, BROTLI_TRUE);
   size_t num_written = *available_out;
   if (num_written > to_write) {
     num_written = to_write;
   }
   if (s->meta_block_remaining_len < 0) {
-    return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_BLOCK_LENGTH_1);
+    return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_BLOCK_LENGTH_1);
+  }
+  if (next_out && !*next_out) {
+    *next_out = start;
+  } else {
+    if (next_out) {
+      memcpy(*next_out, start, num_written);
+      *next_out += num_written;
+    }
   }
-  memcpy(*next_out, start, num_written);
-  *next_out += num_written;
   *available_out -= num_written;
   BROTLI_LOG_UINT(to_write);
   BROTLI_LOG_UINT(num_written);
   s->partial_pos_out += num_written;
-  if (total_out) *total_out = s->partial_pos_out;
+  if (total_out) {
+    *total_out = s->partial_pos_out;
+  }
   if (num_written < to_write) {
-    return BROTLI_NEEDS_MORE_OUTPUT;
+    if (s->ringbuffer_size == (1 << s->window_bits) || force) {
+      return BROTLI_DECODER_NEEDS_MORE_OUTPUT;
+    } else {
+      return BROTLI_DECODER_SUCCESS;
+    }
   }
-
-  if (s->pos >= s->ringbuffer_size) {
+  /* Wrap ring buffer only if it has reached its maximal size. */
+  if (s->ringbuffer_size == (1 << s->window_bits) &&
+      s->pos >= s->ringbuffer_size) {
     s->pos -= s->ringbuffer_size;
     s->rb_roundtrips++;
+    s->should_wrap_ringbuffer = (size_t)s->pos != 0 ? 1 : 0;
   }
-  return BROTLI_SUCCESS;
+  return BROTLI_DECODER_SUCCESS;
 }
 
-/* Allocates ringbuffer.
+static void BROTLI_NOINLINE WrapRingBuffer(BrotliDecoderState* s) {
+  if (s->should_wrap_ringbuffer) {
+    memcpy(s->ringbuffer, s->ringbuffer_end, (size_t)s->pos);
+    s->should_wrap_ringbuffer = 0;
+  }
+}
 
-  s->ringbuffer_size MUST be updated by BrotliCalculateRingBufferSize before
-  this function is called.
+/* Allocates ring-buffer.
 
-   Last two bytes of ringbuffer are initialized to 0, so context calculation
-   could be done uniformly for the first two and all other positions.
+   s->ringbuffer_size MUST be updated by BrotliCalculateRingBufferSize before
+   this function is called.
 
-   Custom dictionary, if any, is copied to the end of ringbuffer.
+   Last two bytes of ring-buffer are initialized to 0, so context calculation
+   could be done uniformly for the first two and all other positions.
 */
-static int BROTLI_NOINLINE BrotliAllocateRingBuffer(BrotliState* s) {
-  /* We need the slack region for the following reasons:
-      - doing up to two 16-byte copies for fast backward copying
-      - inserting transformed dictionary word (5 prefix + 24 base + 8 suffix) */
-  static const int kRingBufferWriteAheadSlack = 42;
-  s->ringbuffer = (uint8_t*)BROTLI_ALLOC(s, (size_t)(s->ringbuffer_size +
-      kRingBufferWriteAheadSlack));
-  if (s->ringbuffer == 0) {
-    return 0;
+static BROTLI_BOOL BROTLI_NOINLINE BrotliEnsureRingBuffer(
+    BrotliDecoderState* s) {
+  uint8_t* old_ringbuffer = s->ringbuffer;
+  if (s->ringbuffer_size == s->new_ringbuffer_size) {
+    return BROTLI_TRUE;
   }
 
-  s->ringbuffer_end = s->ringbuffer + s->ringbuffer_size;
-
-  s->ringbuffer[s->ringbuffer_size - 2] = 0;
-  s->ringbuffer[s->ringbuffer_size - 1] = 0;
+  s->ringbuffer = (uint8_t*)BROTLI_ALLOC(s, (size_t)(s->new_ringbuffer_size) +
+      kRingBufferWriteAheadSlack);
+  if (s->ringbuffer == 0) {
+    /* Restore previous value. */
+    s->ringbuffer = old_ringbuffer;
+    return BROTLI_FALSE;
+  }
+  s->ringbuffer[s->new_ringbuffer_size - 2] = 0;
+  s->ringbuffer[s->new_ringbuffer_size - 1] = 0;
 
-  if (s->custom_dict) {
-    memcpy(&s->ringbuffer[(-s->custom_dict_size) & s->ringbuffer_mask],
-           s->custom_dict, (size_t)s->custom_dict_size);
+  if (!!old_ringbuffer) {
+    memcpy(s->ringbuffer, old_ringbuffer, (size_t)s->pos);
+    BROTLI_FREE(s, old_ringbuffer);
   }
 
-  return 1;
+  s->ringbuffer_size = s->new_ringbuffer_size;
+  s->ringbuffer_mask = s->new_ringbuffer_size - 1;
+  s->ringbuffer_end = s->ringbuffer + s->ringbuffer_size;
+
+  return BROTLI_TRUE;
 }
 
-static BrotliErrorCode BROTLI_NOINLINE CopyUncompressedBlockToOutput(
+static BrotliDecoderErrorCode BROTLI_NOINLINE CopyUncompressedBlockToOutput(
     size_t* available_out, uint8_t** next_out, size_t* total_out,
-    BrotliState* s) {
+    BrotliDecoderState* s) {
   /* TODO: avoid allocation for single uncompressed block. */
-  if (!s->ringbuffer && !BrotliAllocateRingBuffer(s)) {
-    return BROTLI_FAILURE(BROTLI_ERROR_ALLOC_RING_BUFFER_1);
+  if (!BrotliEnsureRingBuffer(s)) {
+    return BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_RING_BUFFER_1);
   }
 
   /* State machine */
@@ -1241,26 +1309,29 @@ static BrotliErrorCode BROTLI_NOINLINE CopyUncompressedBlockToOutput(
         if (s->pos + nbytes > s->ringbuffer_size) {
           nbytes = s->ringbuffer_size - s->pos;
         }
-        /* Copy remaining bytes from s->br.buf_ to ringbuffer. */
+        /* Copy remaining bytes from s->br.buf_ to ring-buffer. */
         BrotliCopyBytes(&s->ringbuffer[s->pos], &s->br, (size_t)nbytes);
         s->pos += nbytes;
         s->meta_block_remaining_len -= nbytes;
-        if (s->pos < s->ringbuffer_size) {
+        if (s->pos < 1 << s->window_bits) {
           if (s->meta_block_remaining_len == 0) {
-            return BROTLI_SUCCESS;
+            return BROTLI_DECODER_SUCCESS;
           }
-          return BROTLI_NEEDS_MORE_INPUT;
+          return BROTLI_DECODER_NEEDS_MORE_INPUT;
         }
         s->substate_uncompressed = BROTLI_STATE_UNCOMPRESSED_WRITE;
         /* No break, continue to next state */
       }
       case BROTLI_STATE_UNCOMPRESSED_WRITE: {
-        BrotliErrorCode result =
-            WriteRingBuffer(available_out, next_out, total_out, s);
-        if (result != BROTLI_SUCCESS) {
+        BrotliDecoderErrorCode result;
+        result = WriteRingBuffer(
+            s, available_out, next_out, total_out, BROTLI_FALSE);
+        if (result != BROTLI_DECODER_SUCCESS) {
           return result;
         }
-        s->max_distance = s->max_backward_distance;
+        if (s->ringbuffer_size == 1 << s->window_bits) {
+          s->max_distance = s->max_backward_distance;
+        }
         s->substate_uncompressed = BROTLI_STATE_UNCOMPRESSED_NONE;
         break;
       }
@@ -1269,69 +1340,54 @@ static BrotliErrorCode BROTLI_NOINLINE CopyUncompressedBlockToOutput(
   BROTLI_DCHECK(0);  /* Unreachable */
 }
 
-int BrotliDecompressedSize(size_t encoded_size,
-                           const uint8_t* encoded_buffer,
-                           size_t* decoded_size) {
-  BrotliState s;
-  int next_block_header;
-  BrotliStateInit(&s);
-  s.br.next_in = encoded_buffer;
-  s.br.avail_in = encoded_size;
-  if (!BrotliWarmupBitReader(&s.br)) {
-    return 0;
-  }
-  DecodeWindowBits(&s.br);
-  if (DecodeMetaBlockLength(&s, &s.br) != BROTLI_SUCCESS) {
-    return 0;
-  }
-  *decoded_size = (size_t)s.meta_block_remaining_len;
-  if (s.is_last_metablock) {
-    return 1;
-  }
-  if (!s.is_uncompressed || !BrotliJumpToByteBoundary(&s.br)) {
-    return 0;
-  }
-  next_block_header = BrotliPeekByte(&s.br, (size_t)s.meta_block_remaining_len);
-  return (next_block_header != -1) && ((next_block_header & 3) == 3);
-}
-
 /* Calculates the smallest feasible ring buffer.
 
-   If we know the data size is small, do not allocate more ringbuffer
+   If we know the data size is small, do not allocate more ring buffer
    size than needed to reduce memory usage.
 
    When this method is called, metablock size and flags MUST be decoded.
 */
-static void BROTLI_NOINLINE BrotliCalculateRingBufferSize(BrotliState* s,
-    BrotliBitReader* br) {
-  int is_last = s->is_last_metablock;
+static void BROTLI_NOINLINE BrotliCalculateRingBufferSize(
+    BrotliDecoderState* s) {
   int window_size = 1 << s->window_bits;
-  s->ringbuffer_size = window_size;
-
-  if (s->is_uncompressed) {
-    int next_block_header =
-        BrotliPeekByte(br, (size_t)s->meta_block_remaining_len);
-    if (next_block_header != -1) {  /* Peek succeeded */
-      if ((next_block_header & 3) == 3) {  /* ISLAST and ISEMPTY */
-        is_last = 1;
-      }
-    }
-  }
-
+  int new_ringbuffer_size = window_size;
   /* We need at least 2 bytes of ring buffer size to get the last two
      bytes for context from there */
-  if (is_last) {
-    int min_size_x2 = (s->meta_block_remaining_len + s->custom_dict_size) * 2;
-    while (s->ringbuffer_size >= min_size_x2 && s->ringbuffer_size > 32) {
-      s->ringbuffer_size >>= 1;
+  int min_size = s->ringbuffer_size ? s->ringbuffer_size : 1024;
+  int output_size;
+
+  /* If maximum is already reached, no further extension is retired. */
+  if (s->ringbuffer_size == window_size) {
+    return;
+  }
+
+  /* Metadata blocks does not touch ring buffer. */
+  if (s->is_metadata) {
+    return;
+  }
+
+  if (!s->ringbuffer) {
+    output_size = 0;
+  } else {
+    output_size = s->pos;
+  }
+  output_size += s->meta_block_remaining_len;
+  min_size = min_size < output_size ? output_size : min_size;
+
+  if (!!s->canny_ringbuffer_allocation) {
+    /* Reduce ring buffer size to save memory when server is unscrupulous.
+       In worst case memory usage might be 1.5x bigger for a short period of
+       ring buffer reallocation.*/
+    while ((new_ringbuffer_size >> 1) >= min_size) {
+      new_ringbuffer_size >>= 1;
     }
   }
 
-  s->ringbuffer_mask = s->ringbuffer_size - 1;
+  s->new_ringbuffer_size = new_ringbuffer_size;
 }
 
 /* Reads 1..256 2-bit context modes. */
-static BrotliErrorCode ReadContextModes(BrotliState* s) {
+static BrotliDecoderErrorCode ReadContextModes(BrotliDecoderState* s) {
   BrotliBitReader* br = &s->br;
   int i = s->loop_counter;
 
@@ -1339,19 +1395,21 @@ static BrotliErrorCode ReadContextModes(BrotliState* s) {
     uint32_t bits;
     if (!BrotliSafeReadBits(br, 2, &bits)) {
       s->loop_counter = i;
-      return BROTLI_NEEDS_MORE_INPUT;
+      return BROTLI_DECODER_NEEDS_MORE_INPUT;
     }
     s->context_modes[i] = (uint8_t)(bits << 1);
     BROTLI_LOG_ARRAY_INDEX(s->context_modes, i);
     i++;
   }
-  return BROTLI_SUCCESS;
+  return BROTLI_DECODER_SUCCESS;
 }
 
-static BROTLI_INLINE void TakeDistanceFromRingBuffer(BrotliState* s) {
+static BROTLI_INLINE void TakeDistanceFromRingBuffer(BrotliDecoderState* s) {
   if (s->distance_code == 0) {
     --s->dist_rb_idx;
     s->distance_code = s->dist_rb[s->dist_rb_idx & 3];
+    /* Compensate double distance-ring-buffer roll for dictionary items. */
+    s->distance_context = 1;
   } else {
     int distance_code = s->distance_code << 1;
     /* kDistanceShortCodeIndexOffset has 2-bit values from LSB: */
@@ -1377,19 +1435,19 @@ static BROTLI_INLINE void TakeDistanceFromRingBuffer(BrotliState* s) {
   }
 }
 
-static BROTLI_INLINE int SafeReadBits(
+static BROTLI_INLINE BROTLI_BOOL SafeReadBits(
     BrotliBitReader* const br, uint32_t n_bits, uint32_t* val) {
   if (n_bits != 0) {
     return BrotliSafeReadBits(br, n_bits, val);
   } else {
     *val = 0;
-    return 1;
+    return BROTLI_TRUE;
   }
 }
 
 /* Precondition: s->distance_code < 0 */
-static BROTLI_INLINE int ReadDistanceInternal(int safe,
-    BrotliState* s, BrotliBitReader* br) {
+static BROTLI_INLINE BROTLI_BOOL ReadDistanceInternal(
+    int safe, BrotliDecoderState* s, BrotliBitReader* br) {
   int distval;
   BrotliBitReaderState memento;
   HuffmanCode* distance_tree = s->distance_hgroup.htrees[s->dist_htree_index];
@@ -1399,16 +1457,17 @@ static BROTLI_INLINE int ReadDistanceInternal(int safe,
     uint32_t code;
     BrotliBitReaderSaveState(br, &memento);
     if (!SafeReadSymbol(distance_tree, br, &code)) {
-      return 0;
+      return BROTLI_FALSE;
     }
     s->distance_code = (int)code;
   }
   /* Convert the distance code to the actual distance by possibly */
   /* looking up past distances from the s->ringbuffer. */
+  s->distance_context = 0;
   if ((s->distance_code & ~0xf) == 0) {
     TakeDistanceFromRingBuffer(s);
     --s->block_length[2];
-    return 1;
+    return BROTLI_TRUE;
   }
   distval = s->distance_code - (int)s->num_direct_distance_codes;
   if (distval >= 0) {
@@ -1430,7 +1489,7 @@ static BROTLI_INLINE int ReadDistanceInternal(int safe,
         if (!SafeReadBits(br, nbits, &bits)) {
           s->distance_code = -1; /* Restore precondition. */
           BrotliBitReaderRestoreState(br, &memento);
-          return 0;
+          return BROTLI_FALSE;
         }
       } else {
         bits = BrotliReadBits(br, nbits);
@@ -1440,21 +1499,23 @@ static BROTLI_INLINE int ReadDistanceInternal(int safe,
           ((offset + (int)bits) << s->distance_postfix_bits) + postfix;
     }
   }
-  s->distance_code = s->distance_code - NUM_DISTANCE_SHORT_CODES + 1;
+  s->distance_code = s->distance_code - BROTLI_NUM_DISTANCE_SHORT_CODES + 1;
   --s->block_length[2];
-  return 1;
+  return BROTLI_TRUE;
 }
 
-static BROTLI_INLINE void ReadDistance(BrotliState* s, BrotliBitReader* br) {
+static BROTLI_INLINE void ReadDistance(
+    BrotliDecoderState* s, BrotliBitReader* br) {
   ReadDistanceInternal(0, s, br);
 }
 
-static BROTLI_INLINE int SafeReadDistance(BrotliState* s, BrotliBitReader* br) {
+static BROTLI_INLINE BROTLI_BOOL SafeReadDistance(
+    BrotliDecoderState* s, BrotliBitReader* br) {
   return ReadDistanceInternal(1, s, br);
 }
 
-static BROTLI_INLINE int ReadCommandInternal(int safe,
-    BrotliState* s, BrotliBitReader* br, int* insert_length) {
+static BROTLI_INLINE BROTLI_BOOL ReadCommandInternal(
+    int safe, BrotliDecoderState* s, BrotliBitReader* br, int* insert_length) {
   uint32_t cmd_code;
   uint32_t insert_len_extra = 0;
   uint32_t copy_length;
@@ -1465,7 +1526,7 @@ static BROTLI_INLINE int ReadCommandInternal(int safe,
   } else {
     BrotliBitReaderSaveState(br, &memento);
     if (!SafeReadSymbol(s->htree_command, br, &cmd_code)) {
-      return 0;
+      return BROTLI_FALSE;
     }
   }
   v = kCmdLut[cmd_code];
@@ -1474,7 +1535,7 @@ static BROTLI_INLINE int ReadCommandInternal(int safe,
   s->dist_htree_index = s->dist_context_map_slice[s->distance_context];
   *insert_length = v.insert_len_offset;
   if (!safe) {
-    if (PREDICT_FALSE(v.insert_len_extra_bits != 0)) {
+    if (BROTLI_PREDICT_FALSE(v.insert_len_extra_bits != 0)) {
       insert_len_extra = BrotliReadBits(br, v.insert_len_extra_bits);
     }
     copy_length = BrotliReadBits(br, v.copy_len_extra_bits);
@@ -1482,54 +1543,54 @@ static BROTLI_INLINE int ReadCommandInternal(int safe,
     if (!SafeReadBits(br, v.insert_len_extra_bits, &insert_len_extra) ||
         !SafeReadBits(br, v.copy_len_extra_bits, &copy_length)) {
       BrotliBitReaderRestoreState(br, &memento);
-      return 0;
+      return BROTLI_FALSE;
     }
   }
   s->copy_length = (int)copy_length + v.copy_len_offset;
   --s->block_length[1];
   *insert_length += (int)insert_len_extra;
-  return 1;
+  return BROTLI_TRUE;
 }
 
-static BROTLI_INLINE void ReadCommand(BrotliState* s, BrotliBitReader* br,
-    int* insert_length) {
+static BROTLI_INLINE void ReadCommand(
+    BrotliDecoderState* s, BrotliBitReader* br, int* insert_length) {
   ReadCommandInternal(0, s, br, insert_length);
 }
 
-static BROTLI_INLINE int SafeReadCommand(BrotliState* s, BrotliBitReader* br,
-    int* insert_length) {
+static BROTLI_INLINE BROTLI_BOOL SafeReadCommand(
+    BrotliDecoderState* s, BrotliBitReader* br, int* insert_length) {
   return ReadCommandInternal(1, s, br, insert_length);
 }
 
-static BROTLI_INLINE int CheckInputAmount(int safe,
-    BrotliBitReader* const br, size_t num) {
+static BROTLI_INLINE BROTLI_BOOL CheckInputAmount(
+    int safe, BrotliBitReader* const br, size_t num) {
   if (safe) {
-    return 1;
+    return BROTLI_TRUE;
   }
   return BrotliCheckInputAmount(br, num);
 }
 
-#define BROTLI_SAFE(METHOD)               \
-  {                                       \
-    if (safe) {                           \
-      if (!Safe##METHOD) {                \
-        result = BROTLI_NEEDS_MORE_INPUT; \
-        goto saveStateAndReturn;          \
-      }                                   \
-    } else {                              \
-      METHOD;                             \
-    }                                     \
+#define BROTLI_SAFE(METHOD)                       \
+  {                                               \
+    if (safe) {                                   \
+      if (!Safe##METHOD) {                        \
+        result = BROTLI_DECODER_NEEDS_MORE_INPUT; \
+        goto saveStateAndReturn;                  \
+      }                                           \
+    } else {                                      \
+      METHOD;                                     \
+    }                                             \
   }
 
-static BROTLI_INLINE BrotliErrorCode ProcessCommandsInternal(int safe,
-    BrotliState* s) {
+static BROTLI_INLINE BrotliDecoderErrorCode ProcessCommandsInternal(
+    int safe, BrotliDecoderState* s) {
   int pos = s->pos;
   int i = s->loop_counter;
-  BrotliErrorCode result = BROTLI_SUCCESS;
+  BrotliDecoderErrorCode result = BROTLI_DECODER_SUCCESS;
   BrotliBitReader* br = &s->br;
 
   if (!CheckInputAmount(safe, br, 28)) {
-    result = BROTLI_NEEDS_MORE_INPUT;
+    result = BROTLI_DECODER_NEEDS_MORE_INPUT;
     goto saveStateAndReturn;
   }
   if (!safe) {
@@ -1546,7 +1607,7 @@ static BROTLI_INLINE BrotliErrorCode ProcessCommandsInternal(int safe,
   } else if (s->state == BROTLI_STATE_COMMAND_POST_WRAP_COPY) {
     goto CommandPostWrapCopy;
   } else {
-    return BROTLI_FAILURE(BROTLI_ERROR_UNREACHABLE);
+    return BROTLI_FAILURE(BROTLI_DECODER_ERROR_UNREACHABLE);
   }
 
 CommandBegin:
@@ -1555,10 +1616,10 @@ CommandBegin:
   }
   if (!CheckInputAmount(safe, br, 28)) { /* 156 bits + 7 bytes */
     s->state = BROTLI_STATE_COMMAND_BEGIN;
-    result = BROTLI_NEEDS_MORE_INPUT;
+    result = BROTLI_DECODER_NEEDS_MORE_INPUT;
     goto saveStateAndReturn;
   }
-  if (PREDICT_FALSE(s->block_length[1] == 0)) {
+  if (BROTLI_PREDICT_FALSE(s->block_length[1] == 0)) {
     BROTLI_SAFE(DecodeCommandBlockSwitch(s));
     goto CommandBegin;
   }
@@ -1583,10 +1644,10 @@ CommandInner:
     do {
       if (!CheckInputAmount(safe, br, 28)) { /* 162 bits + 7 bytes */
         s->state = BROTLI_STATE_COMMAND_INNER;
-        result = BROTLI_NEEDS_MORE_INPUT;
+        result = BROTLI_DECODER_NEEDS_MORE_INPUT;
         goto saveStateAndReturn;
       }
-      if (PREDICT_FALSE(s->block_length[0] == 0)) {
+      if (BROTLI_PREDICT_FALSE(s->block_length[0] == 0)) {
         BROTLI_SAFE(DecodeLiteralBlockSwitch(s));
         PreloadSymbol(safe, s->literal_htree, br, &bits, &value);
         if (!s->trivial_literal_context) goto CommandInner;
@@ -1597,7 +1658,7 @@ CommandInner:
       } else {
         uint32_t literal;
         if (!SafeReadSymbol(s->literal_htree, br, &literal)) {
-          result = BROTLI_NEEDS_MORE_INPUT;
+          result = BROTLI_DECODER_NEEDS_MORE_INPUT;
           goto saveStateAndReturn;
         }
         s->ringbuffer[pos] = (uint8_t)literal;
@@ -1605,7 +1666,7 @@ CommandInner:
       --s->block_length[0];
       BROTLI_LOG_ARRAY_INDEX(s->ringbuffer, pos);
       ++pos;
-      if (PREDICT_FALSE(pos == s->ringbuffer_size)) {
+      if (BROTLI_PREDICT_FALSE(pos == s->ringbuffer_size)) {
         s->state = BROTLI_STATE_COMMAND_INNER_WRITE;
         --i;
         goto saveStateAndReturn;
@@ -1619,10 +1680,10 @@ CommandInner:
       uint8_t context;
       if (!CheckInputAmount(safe, br, 28)) { /* 162 bits + 7 bytes */
         s->state = BROTLI_STATE_COMMAND_INNER;
-        result = BROTLI_NEEDS_MORE_INPUT;
+        result = BROTLI_DECODER_NEEDS_MORE_INPUT;
         goto saveStateAndReturn;
       }
-      if (PREDICT_FALSE(s->block_length[0] == 0)) {
+      if (BROTLI_PREDICT_FALSE(s->block_length[0] == 0)) {
         BROTLI_SAFE(DecodeLiteralBlockSwitch(s));
         if (s->trivial_literal_context) goto CommandInner;
       }
@@ -1635,7 +1696,7 @@ CommandInner:
       } else {
         uint32_t literal;
         if (!SafeReadSymbol(hc, br, &literal)) {
-          result = BROTLI_NEEDS_MORE_INPUT;
+          result = BROTLI_DECODER_NEEDS_MORE_INPUT;
           goto saveStateAndReturn;
         }
         p1 = (uint8_t)literal;
@@ -1645,7 +1706,7 @@ CommandInner:
       BROTLI_LOG_UINT(s->context_map_slice[context]);
       BROTLI_LOG_ARRAY_INDEX(s->ringbuffer, pos & s->ringbuffer_mask);
       ++pos;
-      if (PREDICT_FALSE(pos == s->ringbuffer_size)) {
+      if (BROTLI_PREDICT_FALSE(pos == s->ringbuffer_size)) {
         s->state = BROTLI_STATE_COMMAND_INNER_WRITE;
         --i;
         goto saveStateAndReturn;
@@ -1653,7 +1714,7 @@ CommandInner:
     } while (--i != 0);
   }
   BROTLI_LOG_UINT(s->meta_block_remaining_len);
-  if (PREDICT_FALSE(s->meta_block_remaining_len <= 0)) {
+  if (BROTLI_PREDICT_FALSE(s->meta_block_remaining_len <= 0)) {
     s->state = BROTLI_STATE_METABLOCK_DONE;
     goto saveStateAndReturn;
   }
@@ -1663,46 +1724,54 @@ CommandPostDecodeLiterals:
     s->state = BROTLI_STATE_COMMAND_POST_DECODE_LITERALS;
   }
   if (s->distance_code >= 0) {
+    /* Implicit distance case. */
+    s->distance_context = s->distance_code ? 0 : 1;
     --s->dist_rb_idx;
     s->distance_code = s->dist_rb[s->dist_rb_idx & 3];
-    goto postReadDistance;  /* We already have the implicit distance */
-  }
-  /* Read distance code in the command, unless it was implicitly zero. */
-  if (PREDICT_FALSE(s->block_length[2] == 0)) {
-    BROTLI_SAFE(DecodeDistanceBlockSwitch(s));
+  } else {
+    /* Read distance code in the command, unless it was implicitly zero. */
+    if (BROTLI_PREDICT_FALSE(s->block_length[2] == 0)) {
+      BROTLI_SAFE(DecodeDistanceBlockSwitch(s));
+    }
+    BROTLI_SAFE(ReadDistance(s, br));
   }
-  BROTLI_SAFE(ReadDistance(s, br));
-postReadDistance:
   BROTLI_LOG(("[ProcessCommandsInternal] pos = %d distance = %d\n",
               pos, s->distance_code));
   if (s->max_distance != s->max_backward_distance) {
-    if (pos < s->max_backward_distance_minus_custom_dict_size) {
-      s->max_distance = pos + s->custom_dict_size;
-    } else {
-      s->max_distance = s->max_backward_distance;
-    }
+    s->max_distance =
+        (pos < s->max_backward_distance) ? pos : s->max_backward_distance;
   }
   i = s->copy_length;
   /* Apply copy of LZ77 back-reference, or static dictionary reference if
   the distance is larger than the max LZ77 distance */
   if (s->distance_code > s->max_distance) {
-    if (i >= kBrotliMinDictionaryWordLength &&
-        i <= kBrotliMaxDictionaryWordLength) {
-      int offset = (int)kBrotliDictionaryOffsetsByLength[i];
-      int word_id = s->distance_code - s->max_distance - 1;
-      uint32_t shift = kBrotliDictionarySizeBitsByLength[i];
+    int address = s->distance_code - s->max_distance - 1;
+    if (i >= BROTLI_MIN_DICTIONARY_WORD_LENGTH &&
+        i <= BROTLI_MAX_DICTIONARY_WORD_LENGTH) {
+      int offset = (int)s->dictionary->offsets_by_length[i];
+      uint32_t shift = s->dictionary->size_bits_by_length[i];
       int mask = (int)BitMask(shift);
-      int word_idx = word_id & mask;
-      int transform_idx = word_id >> shift;
+      int word_idx = address & mask;
+      int transform_idx = address >> shift;
+      /* Compensate double distance-ring-buffer roll. */
+      s->dist_rb_idx += s->distance_context;
       offset += word_idx * i;
+      if (BROTLI_PREDICT_FALSE(!s->dictionary->data)) {
+        return BROTLI_FAILURE(BROTLI_DECODER_ERROR_DICTIONARY_NOT_SET);
+      }
       if (transform_idx < kNumTransforms) {
-        const uint8_t* word = &kBrotliDictionary[offset];
+        const uint8_t* word = &s->dictionary->data[offset];
         int len = i;
         if (transform_idx == 0) {
           memcpy(&s->ringbuffer[pos], word, (size_t)len);
+          BROTLI_LOG(("[ProcessCommandsInternal] dictionary word: [%.*s]\n",
+                      len, word));
         } else {
           len = TransformDictionaryWord(
               &s->ringbuffer[pos], word, len, transform_idx);
+          BROTLI_LOG(("[ProcessCommandsInternal] dictionary word: [%.*s],"
+                      " transform_idx = %d, transformed: [%.*s]\n",
+                      i, word, transform_idx, len, &s->ringbuffer[pos]));
         }
         pos += len;
         s->meta_block_remaining_len -= len;
@@ -1715,13 +1784,13 @@ postReadDistance:
         BROTLI_LOG(("Invalid backward reference. pos: %d distance: %d "
             "len: %d bytes left: %d\n",
             pos, s->distance_code, i, s->meta_block_remaining_len));
-        return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_TRANSFORM);
+        return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_TRANSFORM);
       }
     } else {
       BROTLI_LOG(("Invalid backward reference. pos: %d distance: %d "
           "len: %d bytes left: %d\n",
           pos, s->distance_code, i, s->meta_block_remaining_len));
-      return BROTLI_FAILURE(BROTLI_ERROR_FORMAT_DICTIONARY);
+      return BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_DICTIONARY);
     }
   } else {
     int src_start = (pos - s->distance_code) & s->ringbuffer_mask;
@@ -1733,9 +1802,9 @@ postReadDistance:
     s->dist_rb[s->dist_rb_idx & 3] = s->distance_code;
     ++s->dist_rb_idx;
     s->meta_block_remaining_len -= i;
-    /* There are 32+ bytes of slack in the ringbuffer allocation.
+    /* There are 32+ bytes of slack in the ring-buffer allocation.
        Also, we have 16 short codes, that make these 16 bytes irrelevant
-       in the ringbuffer. Let's copy over them as a first guess.
+       in the ring-buffer. Let's copy over them as a first guess.
      */
     memmove16(copy_dst, copy_src);
     if (src_end > pos && dst_end > src_start) {
@@ -1772,7 +1841,7 @@ CommandPostWrapCopy:
       s->ringbuffer[pos] =
           s->ringbuffer[(pos - s->distance_code) & s->ringbuffer_mask];
       ++pos;
-      if (PREDICT_FALSE(--wrap_guard == 0)) {
+      if (BROTLI_PREDICT_FALSE(--wrap_guard == 0)) {
         s->state = BROTLI_STATE_COMMAND_POST_WRITE_2;
         goto saveStateAndReturn;
       }
@@ -1794,32 +1863,33 @@ saveStateAndReturn:
 
 #undef BROTLI_SAFE
 
-static BROTLI_NOINLINE BrotliErrorCode ProcessCommands(BrotliState* s) {
+static BROTLI_NOINLINE BrotliDecoderErrorCode ProcessCommands(
+    BrotliDecoderState* s) {
   return ProcessCommandsInternal(0, s);
 }
 
-static BROTLI_NOINLINE BrotliErrorCode SafeProcessCommands(BrotliState* s) {
+static BROTLI_NOINLINE BrotliDecoderErrorCode SafeProcessCommands(
+    BrotliDecoderState* s) {
   return ProcessCommandsInternal(1, s);
 }
 
-BrotliResult BrotliDecompressBuffer(size_t encoded_size,
-                                    const uint8_t* encoded_buffer,
-                                    size_t* decoded_size,
-                                    uint8_t* decoded_buffer) {
-  BrotliState s;
-  BrotliResult result;
+BrotliDecoderResult BrotliDecoderDecompress(
+    size_t encoded_size, const uint8_t* encoded_buffer, size_t* decoded_size,
+    uint8_t* decoded_buffer) {
+  BrotliDecoderState s;
+  BrotliDecoderResult result;
   size_t total_out = 0;
   size_t available_in = encoded_size;
   const uint8_t* next_in = encoded_buffer;
   size_t available_out = *decoded_size;
   uint8_t* next_out = decoded_buffer;
-  BrotliStateInit(&s);
-  result = BrotliDecompressStream(&available_in, &next_in, &available_out,
-      &next_out, &total_out, &s);
+  BrotliDecoderStateInit(&s);
+  result = BrotliDecoderDecompressStream(
+      &s, &available_in, &next_in, &available_out, &next_out, &total_out);
   *decoded_size = total_out;
-  BrotliStateCleanup(&s);
-  if (result != BROTLI_RESULT_SUCCESS) {
-    result = BROTLI_RESULT_ERROR;
+  BrotliDecoderStateCleanup(&s);
+  if (result != BROTLI_DECODER_RESULT_SUCCESS) {
+    result = BROTLI_DECODER_RESULT_ERROR;
   }
   return result;
 }
@@ -1827,7 +1897,7 @@ BrotliResult BrotliDecompressBuffer(size_t encoded_size,
 /* Invariant: input stream is never overconsumed:
     * invalid input implies that the whole stream is invalid -> any amount of
       input could be read and discarded
-    * when result is "needs more input", then at leat one more byte is REQUIRED
+    * when result is "needs more input", then at least one more byte is REQUIRED
       to complete decoding; all input data MUST be consumed by decoder, so
       client could swap the input buffer
     * when result is "needs more output" decoder MUST ensure that it doesn't
@@ -1836,11 +1906,20 @@ BrotliResult BrotliDecompressBuffer(size_t encoded_size,
     * when result is "success" decoder MUST return all unused data back to input
       buffer; this is possible because the invariant is hold on enter
 */
-BrotliResult BrotliDecompressStream(size_t* available_in,
-    const uint8_t** next_in, size_t* available_out, uint8_t** next_out,
-    size_t* total_out, BrotliState* s) {
-  BrotliErrorCode result = BROTLI_SUCCESS;
+BrotliDecoderResult BrotliDecoderDecompressStream(
+    BrotliDecoderState* s, size_t* available_in, const uint8_t** next_in,
+    size_t* available_out, uint8_t** next_out, size_t* total_out) {
+  BrotliDecoderErrorCode result = BROTLI_DECODER_SUCCESS;
   BrotliBitReader* br = &s->br;
+  /* Do not try to process further in a case of unrecoverable error. */
+  if ((int)s->error_code < 0) {
+    return BROTLI_DECODER_RESULT_ERROR;
+  }
+  if (*available_out && (!next_out || !*next_out)) {
+    return SaveErrorCode(
+        s, BROTLI_FAILURE(BROTLI_DECODER_ERROR_INVALID_ARGUMENTS));
+  }
+  if (!*available_out) next_out = 0;
   if (s->buffer_length == 0) { /* Just connect bit reader to input stream. */
     br->avail_in = *available_in;
     br->next_in = *next_in;
@@ -1848,30 +1927,36 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
     /* At least one byte of input is required. More than one byte of input may
        be required to complete the transaction -> reading more data must be
        done in a loop -> do it in a main loop. */
-    result = BROTLI_NEEDS_MORE_INPUT;
+    result = BROTLI_DECODER_NEEDS_MORE_INPUT;
     br->next_in = &s->buffer.u8[0];
   }
   /* State machine */
   for (;;) {
-    if (result != BROTLI_SUCCESS) { /* Error | needs more input/output */
-      if (result == BROTLI_NEEDS_MORE_INPUT) {
-        if (s->ringbuffer != 0) { /* Proactively push output. */
-          WriteRingBuffer(available_out, next_out, total_out, s);
+    if (result != BROTLI_DECODER_SUCCESS) { /* Error, needs more input/output */
+      if (result == BROTLI_DECODER_NEEDS_MORE_INPUT) {
+        if (s->ringbuffer != 0) { /* Pro-actively push output. */
+          BrotliDecoderErrorCode intermediate_result = WriteRingBuffer(s,
+              available_out, next_out, total_out, BROTLI_TRUE);
+          /* WriteRingBuffer checks s->meta_block_remaining_len validity. */
+          if ((int)intermediate_result < 0) {
+            result = intermediate_result;
+            break;
+          }
         }
         if (s->buffer_length != 0) { /* Used with internal buffer. */
           if (br->avail_in == 0) { /* Successfully finished read transaction. */
-            /* Accamulator contains less than 8 bits, because internal buffer
+            /* Accumulator contains less than 8 bits, because internal buffer
                is expanded byte-by-byte until it is enough to complete read. */
             s->buffer_length = 0;
             /* Switch to input stream and restart. */
-            result = BROTLI_SUCCESS;
+            result = BROTLI_DECODER_SUCCESS;
             br->avail_in = *available_in;
             br->next_in = *next_in;
             continue;
           } else if (*available_in != 0) {
             /* Not enough data in buffer, but can take one more byte from
                input stream. */
-            result = BROTLI_SUCCESS;
+            result = BROTLI_DECODER_SUCCESS;
             s->buffer.u8[s->buffer_length] = **next_in;
             s->buffer_length++;
             br->avail_in = s->buffer_length;
@@ -1905,8 +1990,8 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
         s->buffer_length = 0;
       } else {
         /* Using input stream in last iteration. When decoder switches to input
-           stream it has less than 8 bits in accamulator, so it is safe to
-           return unused accamulator bits there. */
+           stream it has less than 8 bits in accumulator, so it is safe to
+           return unused accumulator bits there. */
         BrotliBitReaderUnload(br);
         *available_in = br->avail_in;
         *next_in = br->next_in;
@@ -1917,7 +2002,7 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
       case BROTLI_STATE_UNINITED:
         /* Prepare to the first read. */
         if (!BrotliWarmupBitReader(br)) {
-          result = BROTLI_NEEDS_MORE_INPUT;
+          result = BROTLI_DECODER_NEEDS_MORE_INPUT;
           break;
         }
         /* Decode window size. */
@@ -1925,25 +2010,18 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
         BROTLI_LOG_UINT(s->window_bits);
         if (s->window_bits == 9) {
           /* Value 9 is reserved for future use. */
-          result = BROTLI_FAILURE(BROTLI_ERROR_FORMAT_WINDOW_BITS);
+          result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_WINDOW_BITS);
           break;
         }
         /* Maximum distance, see section 9.1. of the spec. */
-        s->max_backward_distance = (1 << s->window_bits) - 16;
-        /* Limit custom dictionary size. */
-        if (s->custom_dict_size >= s->max_backward_distance) {
-          s->custom_dict += s->custom_dict_size - s->max_backward_distance;
-          s->custom_dict_size = s->max_backward_distance;
-        }
-        s->max_backward_distance_minus_custom_dict_size =
-            s->max_backward_distance - s->custom_dict_size;
+        s->max_backward_distance = (1 << s->window_bits) - BROTLI_WINDOW_GAP;
 
         /* Allocate memory for both block_type_trees and block_len_trees. */
         s->block_type_trees = (HuffmanCode*)BROTLI_ALLOC(s,
             sizeof(HuffmanCode) * 3 *
                 (BROTLI_HUFFMAN_MAX_SIZE_258 + BROTLI_HUFFMAN_MAX_SIZE_26));
         if (s->block_type_trees == 0) {
-          result = BROTLI_FAILURE(BROTLI_ERROR_ALLOC_BLOCK_TYPE_TREES);
+          result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_BLOCK_TYPE_TREES);
           break;
         }
         s->block_len_trees =
@@ -1952,13 +2030,13 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
         s->state = BROTLI_STATE_METABLOCK_BEGIN;
         /* No break, continue to next state */
       case BROTLI_STATE_METABLOCK_BEGIN:
-        BrotliStateMetablockBegin(s);
+        BrotliDecoderStateMetablockBegin(s);
         BROTLI_LOG_UINT(s->pos);
         s->state = BROTLI_STATE_METABLOCK_HEADER;
         /* No break, continue to next state */
       case BROTLI_STATE_METABLOCK_HEADER:
         result = DecodeMetaBlockLength(s, br); /* Reads 2 - 31 bits. */
-        if (result != BROTLI_SUCCESS) {
+        if (result != BROTLI_DECODER_SUCCESS) {
           break;
         }
         BROTLI_LOG_UINT(s->is_last_metablock);
@@ -1967,7 +2045,7 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
         BROTLI_LOG_UINT(s->is_uncompressed);
         if (s->is_metadata || s->is_uncompressed) {
           if (!BrotliJumpToByteBoundary(br)) {
-            result = BROTLI_FAILURE(BROTLI_ERROR_FORMAT_PADDING_1);
+            result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_PADDING_1);
             break;
           }
         }
@@ -1979,9 +2057,7 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
           s->state = BROTLI_STATE_METABLOCK_DONE;
           break;
         }
-        if (!s->ringbuffer) {
-          BrotliCalculateRingBufferSize(s, br);
-        }
+        BrotliCalculateRingBufferSize(s);
         if (s->is_uncompressed) {
           s->state = BROTLI_STATE_UNCOMPRESSED;
           break;
@@ -1990,11 +2066,9 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
         s->state = BROTLI_STATE_HUFFMAN_CODE_0;
         break;
       case BROTLI_STATE_UNCOMPRESSED: {
-        int bytes_copied = s->meta_block_remaining_len;
         result = CopyUncompressedBlockToOutput(
             available_out, next_out, total_out, s);
-        bytes_copied -= s->meta_block_remaining_len;
-        if (result != BROTLI_SUCCESS) {
+        if (result != BROTLI_DECODER_SUCCESS) {
           break;
         }
         s->state = BROTLI_STATE_METABLOCK_DONE;
@@ -2005,11 +2079,11 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
           uint32_t bits;
           /* Read one byte and ignore it. */
           if (!BrotliSafeReadBits(br, 8, &bits)) {
-            result = BROTLI_NEEDS_MORE_INPUT;
+            result = BROTLI_DECODER_NEEDS_MORE_INPUT;
             break;
           }
         }
-        if (result == BROTLI_SUCCESS) {
+        if (result == BROTLI_DECODER_SUCCESS) {
           s->state = BROTLI_STATE_METABLOCK_DONE;
         }
         break;
@@ -2020,7 +2094,7 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
         }
         /* Reads 1..11 bits. */
         result = DecodeVarLenUint8(s, br, &s->num_block_types[s->loop_counter]);
-        if (result != BROTLI_SUCCESS) {
+        if (result != BROTLI_DECODER_SUCCESS) {
           break;
         }
         s->num_block_types[s->loop_counter]++;
@@ -2035,15 +2109,15 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
         int tree_offset = s->loop_counter * BROTLI_HUFFMAN_MAX_SIZE_258;
         result = ReadHuffmanCode(s->num_block_types[s->loop_counter] + 2,
             &s->block_type_trees[tree_offset], NULL, s);
-        if (result != BROTLI_SUCCESS) break;
+        if (result != BROTLI_DECODER_SUCCESS) break;
         s->state = BROTLI_STATE_HUFFMAN_CODE_2;
         /* No break, continue to next state */
       }
       case BROTLI_STATE_HUFFMAN_CODE_2: {
         int tree_offset = s->loop_counter * BROTLI_HUFFMAN_MAX_SIZE_26;
-        result = ReadHuffmanCode(kNumBlockLengthCodes,
+        result = ReadHuffmanCode(BROTLI_NUM_BLOCK_LEN_SYMBOLS,
             &s->block_len_trees[tree_offset], NULL, s);
-        if (result != BROTLI_SUCCESS) break;
+        if (result != BROTLI_DECODER_SUCCESS) break;
         s->state = BROTLI_STATE_HUFFMAN_CODE_3;
         /* No break, continue to next state */
       }
@@ -2051,7 +2125,7 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
         int tree_offset = s->loop_counter * BROTLI_HUFFMAN_MAX_SIZE_26;
         if (!SafeReadBlockLength(s, &s->block_length[s->loop_counter],
             &s->block_len_trees[tree_offset], br)) {
-          result = BROTLI_NEEDS_MORE_INPUT;
+          result = BROTLI_DECODER_NEEDS_MORE_INPUT;
           break;
         }
         BROTLI_LOG_UINT(s->block_length[s->loop_counter]);
@@ -2062,20 +2136,20 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
       case BROTLI_STATE_METABLOCK_HEADER_2: {
         uint32_t bits;
         if (!BrotliSafeReadBits(br, 6, &bits)) {
-          result = BROTLI_NEEDS_MORE_INPUT;
+          result = BROTLI_DECODER_NEEDS_MORE_INPUT;
           break;
         }
         s->distance_postfix_bits = bits & BitMask(2);
         bits >>= 2;
-        s->num_direct_distance_codes =
-            NUM_DISTANCE_SHORT_CODES + (bits << s->distance_postfix_bits);
+        s->num_direct_distance_codes = BROTLI_NUM_DISTANCE_SHORT_CODES +
+            (bits << s->distance_postfix_bits);
         BROTLI_LOG_UINT(s->num_direct_distance_codes);
         BROTLI_LOG_UINT(s->distance_postfix_bits);
         s->distance_postfix_mask = (int)BitMask(s->distance_postfix_bits);
         s->context_modes =
             (uint8_t*)BROTLI_ALLOC(s, (size_t)s->num_block_types[0]);
         if (s->context_modes == 0) {
-          result = BROTLI_FAILURE(BROTLI_ERROR_ALLOC_CONTEXT_MODES);
+          result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_CONTEXT_MODES);
           break;
         }
         s->loop_counter = 0;
@@ -2084,16 +2158,16 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
       }
       case BROTLI_STATE_CONTEXT_MODES:
         result = ReadContextModes(s);
-        if (result != BROTLI_SUCCESS) {
+        if (result != BROTLI_DECODER_SUCCESS) {
           break;
         }
         s->state = BROTLI_STATE_CONTEXT_MAP_1;
         /* No break, continue to next state */
       case BROTLI_STATE_CONTEXT_MAP_1:
         result = DecodeContextMap(
-            s->num_block_types[0] << kLiteralContextBits,
+            s->num_block_types[0] << BROTLI_LITERAL_CONTEXT_BITS,
             &s->num_literal_htrees, &s->context_map, s);
-        if (result != BROTLI_SUCCESS) {
+        if (result != BROTLI_DECODER_SUCCESS) {
           break;
         }
         DetectTrivialLiteralBlockTypes(s);
@@ -2101,26 +2175,27 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
         /* No break, continue to next state */
       case BROTLI_STATE_CONTEXT_MAP_2:
         {
-          uint32_t num_distance_codes =
-              s->num_direct_distance_codes + (48U << s->distance_postfix_bits);
+          uint32_t num_distance_codes = s->num_direct_distance_codes +
+              ((2 * BROTLI_MAX_DISTANCE_BITS) << s->distance_postfix_bits);
+          BROTLI_BOOL allocation_success = BROTLI_TRUE;
           result = DecodeContextMap(
-              s->num_block_types[2] << kDistanceContextBits,
+              s->num_block_types[2] << BROTLI_DISTANCE_CONTEXT_BITS,
               &s->num_dist_htrees, &s->dist_context_map, s);
-          if (result != BROTLI_SUCCESS) {
+          if (result != BROTLI_DECODER_SUCCESS) {
             break;
           }
-          BrotliHuffmanTreeGroupInit(s, &s->literal_hgroup, kNumLiteralCodes,
-                                     s->num_literal_htrees);
-          BrotliHuffmanTreeGroupInit(s, &s->insert_copy_hgroup,
-                                     kNumInsertAndCopyCodes,
-                                     s->num_block_types[1]);
-          BrotliHuffmanTreeGroupInit(s, &s->distance_hgroup, num_distance_codes,
-                                     s->num_dist_htrees);
-          if (s->literal_hgroup.codes == 0 ||
-              s->insert_copy_hgroup.codes == 0 ||
-              s->distance_hgroup.codes == 0) {
+          allocation_success &= BrotliDecoderHuffmanTreeGroupInit(
+              s, &s->literal_hgroup, BROTLI_NUM_LITERAL_SYMBOLS,
+              s->num_literal_htrees);
+          allocation_success &= BrotliDecoderHuffmanTreeGroupInit(
+              s, &s->insert_copy_hgroup, BROTLI_NUM_COMMAND_SYMBOLS,
+              s->num_block_types[1]);
+          allocation_success &= BrotliDecoderHuffmanTreeGroupInit(
+              s, &s->distance_hgroup, num_distance_codes,
+              s->num_dist_htrees);
+          if (!allocation_success) {
             return SaveErrorCode(s,
-                BROTLI_FAILURE(BROTLI_ERROR_ALLOC_TREE_GROUPS));
+                BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_TREE_GROUPS));
           }
         }
         s->loop_counter = 0;
@@ -2140,19 +2215,19 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
               hgroup = &s->distance_hgroup;
               break;
             default:
-              return SaveErrorCode(s,
-                  BROTLI_FAILURE(BROTLI_ERROR_UNREACHABLE));
+              return SaveErrorCode(s, BROTLI_FAILURE(
+                  BROTLI_DECODER_ERROR_UNREACHABLE));
           }
           result = HuffmanTreeGroupDecode(hgroup, s);
         }
-        if (result != BROTLI_SUCCESS) break;
+        if (result != BROTLI_DECODER_SUCCESS) break;
         s->loop_counter++;
         if (s->loop_counter >= 3) {
           PrepareLiteralDecoding(s);
           s->dist_context_map_slice = s->dist_context_map;
           s->htree_command = s->insert_copy_hgroup.htrees[0];
-          if (!s->ringbuffer && !BrotliAllocateRingBuffer(s)) {
-            result = BROTLI_FAILURE(BROTLI_ERROR_ALLOC_RING_BUFFER_2);
+          if (!BrotliEnsureRingBuffer(s)) {
+            result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_ALLOC_RING_BUFFER_2);
             break;
           }
           s->state = BROTLI_STATE_COMMAND_BEGIN;
@@ -2163,20 +2238,23 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
       case BROTLI_STATE_COMMAND_POST_DECODE_LITERALS:
       case BROTLI_STATE_COMMAND_POST_WRAP_COPY:
         result = ProcessCommands(s);
-        if (result == BROTLI_NEEDS_MORE_INPUT) {
+        if (result == BROTLI_DECODER_NEEDS_MORE_INPUT) {
           result = SafeProcessCommands(s);
         }
         break;
       case BROTLI_STATE_COMMAND_INNER_WRITE:
       case BROTLI_STATE_COMMAND_POST_WRITE_1:
       case BROTLI_STATE_COMMAND_POST_WRITE_2:
-        result = WriteRingBuffer(available_out, next_out, total_out, s);
-        if (result != BROTLI_SUCCESS) {
+        result = WriteRingBuffer(
+            s, available_out, next_out, total_out, BROTLI_FALSE);
+        if (result != BROTLI_DECODER_SUCCESS) {
           break;
         }
-        s->max_distance = s->max_backward_distance;
+        WrapRingBuffer(s);
+        if (s->ringbuffer_size == 1 << s->window_bits) {
+          s->max_distance = s->max_backward_distance;
+        }
         if (s->state == BROTLI_STATE_COMMAND_POST_WRITE_1) {
-          memcpy(s->ringbuffer, s->ringbuffer_end, (size_t)s->pos);
           if (s->meta_block_remaining_len == 0) {
             /* Next metablock, if any */
             s->state = BROTLI_STATE_METABLOCK_DONE;
@@ -2200,16 +2278,16 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
         break;
       case BROTLI_STATE_METABLOCK_DONE:
         if (s->meta_block_remaining_len < 0) {
-          result = BROTLI_FAILURE(BROTLI_ERROR_FORMAT_BLOCK_LENGTH_2);
+          result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_BLOCK_LENGTH_2);
           break;
         }
-        BrotliStateCleanupAfterMetablock(s);
+        BrotliDecoderStateCleanupAfterMetablock(s);
         if (!s->is_last_metablock) {
           s->state = BROTLI_STATE_METABLOCK_BEGIN;
           break;
         }
         if (!BrotliJumpToByteBoundary(br)) {
-          result = BROTLI_FAILURE(BROTLI_ERROR_FORMAT_PADDING_2);
+          result = BROTLI_FAILURE(BROTLI_DECODER_ERROR_FORMAT_PADDING_2);
           break;
         }
         if (s->buffer_length == 0) {
@@ -2221,8 +2299,9 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
         /* No break, continue to next state */
       case BROTLI_STATE_DONE:
         if (s->ringbuffer != 0) {
-          result = WriteRingBuffer(available_out, next_out, total_out, s);
-          if (result != BROTLI_SUCCESS) {
+          result = WriteRingBuffer(
+              s, available_out, next_out, total_out, BROTLI_TRUE);
+          if (result != BROTLI_DECODER_SUCCESS) {
             break;
           }
         }
@@ -2232,31 +2311,70 @@ BrotliResult BrotliDecompressStream(size_t* available_in,
   return SaveErrorCode(s, result);
 }
 
-void BrotliSetCustomDictionary(
-    size_t size, const uint8_t* dict, BrotliState* s) {
-  if (size > (1u << 24)) {
-    return;
+BROTLI_BOOL BrotliDecoderHasMoreOutput(const BrotliDecoderState* s) {
+  /* After unrecoverable error remaining output is considered nonsensical. */
+  if ((int)s->error_code < 0) {
+    return BROTLI_FALSE;
   }
-  s->custom_dict = dict;
-  s->custom_dict_size = (int)size;
+  return TO_BROTLI_BOOL(
+      s->ringbuffer != 0 && UnwrittenBytes(s, BROTLI_FALSE) != 0);
 }
 
-BrotliErrorCode BrotliGetErrorCode(const BrotliState* s) {
-  return (BrotliErrorCode)s->error_code;
+const uint8_t* BrotliDecoderTakeOutput(BrotliDecoderState* s, size_t* size) {
+  uint8_t* result = 0;
+  size_t available_out = *size ? *size : 1u << 24;
+  size_t requested_out = available_out;
+  BrotliDecoderErrorCode status;
+  if ((s->ringbuffer == 0) || ((int)s->error_code < 0)) {
+    *size = 0;
+    return 0;
+  }
+  WrapRingBuffer(s);
+  status = WriteRingBuffer(s, &available_out, &result, 0, BROTLI_TRUE);
+  /* Either WriteRingBuffer returns those "success" codes... */
+  if (status == BROTLI_DECODER_SUCCESS ||
+      status == BROTLI_DECODER_NEEDS_MORE_OUTPUT) {
+    *size = requested_out - available_out;
+  } else {
+    /* ... or stream is broken. Normally this should be caught by
+       BrotliDecoderDecompressStream, this is just a safeguard. */
+    if ((int)status < 0) SaveErrorCode(s, status);
+    *size = 0;
+    result = 0;
+  }
+  return result;
+}
+
+BROTLI_BOOL BrotliDecoderIsUsed(const BrotliDecoderState* s) {
+  return TO_BROTLI_BOOL(s->state != BROTLI_STATE_UNINITED ||
+      BrotliGetAvailableBits(&s->br) != 0);
+}
+
+BROTLI_BOOL BrotliDecoderIsFinished(const BrotliDecoderState* s) {
+  return TO_BROTLI_BOOL(s->state == BROTLI_STATE_DONE) &&
+      !BrotliDecoderHasMoreOutput(s);
 }
 
-const char* BrotliErrorString(BrotliErrorCode c) {
+BrotliDecoderErrorCode BrotliDecoderGetErrorCode(const BrotliDecoderState* s) {
+  return (BrotliDecoderErrorCode)s->error_code;
+}
+
+const char* BrotliDecoderErrorString(BrotliDecoderErrorCode c) {
   switch (c) {
-#define _BROTLI_ERROR_CODE_CASE(PREFIX, NAME, CODE) \
-    case BROTLI ## PREFIX ## NAME: return #NAME;
-#define _BROTLI_NOTHING
-    BROTLI_ERROR_CODES_LIST(_BROTLI_ERROR_CODE_CASE, _BROTLI_NOTHING)
-#undef _BROTLI_ERROR_CODE_CASE
-#undef _BROTLI_NOTHING
+#define BROTLI_ERROR_CODE_CASE_(PREFIX, NAME, CODE) \
+    case BROTLI_DECODER ## PREFIX ## NAME: return #NAME;
+#define BROTLI_NOTHING_
+    BROTLI_DECODER_ERROR_CODES_LIST(BROTLI_ERROR_CODE_CASE_, BROTLI_NOTHING_)
+#undef BROTLI_ERROR_CODE_CASE_
+#undef BROTLI_NOTHING_
     default: return "INVALID";
   }
 }
 
+uint32_t BrotliDecoderVersion() {
+  return BROTLI_VERSION;
+}
+
 #if defined(__cplusplus) || defined(c_plusplus)
 }  /* extern "C" */
 #endif
diff --git a/Source/ThirdParty/brotli/dec/decode.h b/Source/ThirdParty/brotli/dec/decode.h
deleted file mode 100644
index 056a8b548..000000000
--- a/Source/ThirdParty/brotli/dec/decode.h
+++ /dev/null
@@ -1,162 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
-   Distributed under MIT license.
-   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-/* API for Brotli decompression */
-
-#ifndef BROTLI_DEC_DECODE_H_
-#define BROTLI_DEC_DECODE_H_
-
-#include "./types.h"
-
-#if defined(__cplusplus) || defined(c_plusplus)
-extern "C" {
-#endif
-
-typedef struct BrotliStateStruct BrotliState;
-
-typedef enum {
-  /* Decoding error, e.g. corrupt input or memory allocation problem */
-  BROTLI_RESULT_ERROR = 0,
-  /* Decoding successfully completed */
-  BROTLI_RESULT_SUCCESS = 1,
-  /* Partially done; should be called again with more input */
-  BROTLI_RESULT_NEEDS_MORE_INPUT = 2,
-  /* Partially done; should be called again with more output */
-  BROTLI_RESULT_NEEDS_MORE_OUTPUT = 3
-} BrotliResult;
-
-#define BROTLI_ERROR_CODES_LIST(BROTLI_ERROR_CODE, SEPARATOR)              \
-  BROTLI_ERROR_CODE(_, NO_ERROR, 0) SEPARATOR                              \
-  /* Same as BrotliResult values */                                        \
-  BROTLI_ERROR_CODE(_, SUCCESS, 1) SEPARATOR                               \
-  BROTLI_ERROR_CODE(_, NEEDS_MORE_INPUT, 2) SEPARATOR                      \
-  BROTLI_ERROR_CODE(_, NEEDS_MORE_OUTPUT, 3) SEPARATOR                     \
-                                                                           \
-  /* Errors caused by invalid input */                                     \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, EXUBERANT_NIBBLE, -1) SEPARATOR        \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, RESERVED, -2) SEPARATOR                \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, EXUBERANT_META_NIBBLE, -3) SEPARATOR   \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, SIMPLE_HUFFMAN_ALPHABET, -4) SEPARATOR \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, SIMPLE_HUFFMAN_SAME, -5) SEPARATOR     \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, CL_SPACE, -6) SEPARATOR                \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, HUFFMAN_SPACE, -7) SEPARATOR           \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, CONTEXT_MAP_REPEAT, -8) SEPARATOR      \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, BLOCK_LENGTH_1, -9) SEPARATOR          \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, BLOCK_LENGTH_2, -10) SEPARATOR         \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, TRANSFORM, -11) SEPARATOR              \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, DICTIONARY, -12) SEPARATOR             \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, WINDOW_BITS, -13) SEPARATOR            \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, PADDING_1, -14) SEPARATOR              \
-  BROTLI_ERROR_CODE(_ERROR_FORMAT_, PADDING_2, -15) SEPARATOR              \
-                                                                           \
-  /* -16..-20 codes are reserved */                                        \
-                                                                           \
-  /* Memory allocation problems */                                         \
-  BROTLI_ERROR_CODE(_ERROR_ALLOC_, CONTEXT_MODES, -21) SEPARATOR           \
-  /* Literal, insert and distance trees together */                        \
-  BROTLI_ERROR_CODE(_ERROR_ALLOC_, TREE_GROUPS, -22) SEPARATOR             \
-  /* -23..-24 codes are reserved for distinct tree groups */               \
-  BROTLI_ERROR_CODE(_ERROR_ALLOC_, CONTEXT_MAP, -25) SEPARATOR             \
-  BROTLI_ERROR_CODE(_ERROR_ALLOC_, RING_BUFFER_1, -26) SEPARATOR           \
-  BROTLI_ERROR_CODE(_ERROR_ALLOC_, RING_BUFFER_2, -27) SEPARATOR           \
-  /* -28..-29 codes are reserved for dynamic ringbuffer allocation */      \
-  BROTLI_ERROR_CODE(_ERROR_ALLOC_, BLOCK_TYPE_TREES, -30) SEPARATOR        \
-                                                                           \
-  /* "Impossible" states */                                                \
-  BROTLI_ERROR_CODE(_ERROR_, UNREACHABLE, -31)
-
-typedef enum {
-#define _BROTLI_COMMA ,
-#define _BROTLI_ERROR_CODE_ENUM_ITEM(PREFIX, NAME, CODE) \
-    BROTLI ## PREFIX ## NAME = CODE
-  BROTLI_ERROR_CODES_LIST(_BROTLI_ERROR_CODE_ENUM_ITEM, _BROTLI_COMMA)
-#undef _BROTLI_ERROR_CODE_ENUM_ITEM
-#undef _BROTLI_COMMA
-} BrotliErrorCode;
-
-#define BROTLI_LAST_ERROR_CODE BROTLI_ERROR_UNREACHABLE
-
-/* Creates the instance of BrotliState and initializes it. |alloc_func| and
-   |free_func| MUST be both zero or both non-zero. In the case they are both
-   zero, default memory allocators are used. |opaque| is passed to |alloc_func|
-   and |free_func| when they are called. */
-BrotliState* BrotliCreateState(
-    brotli_alloc_func alloc_func, brotli_free_func free_func, void* opaque);
-
-/* Deinitializes and frees BrotliState instance. */
-void BrotliDestroyState(BrotliState* state);
-
-/* Sets |*decoded_size| to the decompressed size of the given encoded stream.
-   This function only works if the encoded buffer has a single meta block,
-   or if it has two meta-blocks, where the first is uncompressed and the
-   second is empty.
-   Returns 1 on success, 0 on failure. */
-int BrotliDecompressedSize(size_t encoded_size,
-                           const uint8_t* encoded_buffer,
-                           size_t* decoded_size);
-
-/* Decompresses the data in |encoded_buffer| into |decoded_buffer|, and sets
-   |*decoded_size| to the decompressed length. */
-BrotliResult BrotliDecompressBuffer(size_t encoded_size,
-                                    const uint8_t* encoded_buffer,
-                                    size_t* decoded_size,
-                                    uint8_t* decoded_buffer);
-
-/* Decompresses the data. Supports partial input and output.
-
-   Must be called with an allocated input buffer in |*next_in| and an allocated
-   output buffer in |*next_out|. The values |*available_in| and |*available_out|
-   must specify the allocated size in |*next_in| and |*next_out| respectively.
-
-   After each call, |*available_in| will be decremented by the amount of input
-   bytes consumed, and the |*next_in| pointer will be incremented by that
-   amount. Similarly, |*available_out| will be decremented by the amount of
-   output bytes written, and the |*next_out| pointer will be incremented by that
-   amount. |total_out|, if it is not a null-pointer, will be set to the number
-   of bytes decompressed since the last state initialization.
-
-   Input is never overconsumed, so |next_in| and |available_in| could be passed
-   to the next consumer after decoding is complete. */
-BrotliResult BrotliDecompressStream(size_t* available_in,
-                                    const uint8_t** next_in,
-                                    size_t* available_out,
-                                    uint8_t** next_out,
-                                    size_t* total_out,
-                                    BrotliState* s);
-
-/* Fills the new state with a dictionary for LZ77, warming up the ringbuffer,
-   e.g. for custom static dictionaries for data formats.
-   Not to be confused with the built-in transformable dictionary of Brotli.
-   |size| should be less or equal to 2^24 (16MiB), otherwise the dictionary will
-   be ignored. The dictionary must exist in memory until decoding is done and
-   is owned by the caller. To use:
-    1) Allocate and initialize state with BrotliCreateState
-    2) Use BrotliSetCustomDictionary
-    3) Use BrotliDecompressStream
-    4) Clean up and free state with BrotliDestroyState
-*/
-void BrotliSetCustomDictionary(
-    size_t size, const uint8_t* dict, BrotliState* s);
-
-/* Returns 1, if s is in a state where we have not read any input bytes yet,
-   and 0 otherwise */
-int BrotliStateIsStreamStart(const BrotliState* s);
-
-/* Returns 1, if s is in a state where we reached the end of the input and
-   produced all of the output, and 0 otherwise. */
-int BrotliStateIsStreamEnd(const BrotliState* s);
-
-/* Returns detailed error code after BrotliDecompressStream returns
-   BROTLI_RESULT_ERROR. */
-BrotliErrorCode BrotliGetErrorCode(const BrotliState* s);
-
-const char* BrotliErrorString(BrotliErrorCode c);
-
-#if defined(__cplusplus) || defined(c_plusplus)
-} /* extern "C" */
-#endif
-
-#endif  /* BROTLI_DEC_DECODE_H_ */
diff --git a/Source/ThirdParty/brotli/dec/dictionary.c b/Source/ThirdParty/brotli/dec/dictionary.c
deleted file mode 100644
index f8f58575c..000000000
--- a/Source/ThirdParty/brotli/dec/dictionary.c
+++ /dev/null
@@ -1,9466 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
-   Distributed under MIT license.
-   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-#include "./dictionary.h"
-
-#if defined(__cplusplus) || defined(c_plusplus)
-extern "C" {
-#endif
-
-/* In case of multiple definition linker error with dictionary.cc from the
-  encoder: include only one of enc/dictionary.cc or dec/dictionary.c in a
-  target using both enc and dec. */
-const uint8_t kBrotliDictionary[122784] = {
-  0x74, 0x69, 0x6d, 0x65, 0x64, 0x6f, 0x77, 0x6e, 0x6c, 0x69, 0x66, 0x65, 0x6c,
-  0x65, 0x66, 0x74, 0x62, 0x61, 0x63, 0x6b, 0x63, 0x6f, 0x64, 0x65, 0x64, 0x61,
-  0x74, 0x61, 0x73, 0x68, 0x6f, 0x77, 0x6f, 0x6e, 0x6c, 0x79, 0x73, 0x69, 0x74,
-  0x65, 0x63, 0x69, 0x74, 0x79, 0x6f, 0x70, 0x65, 0x6e, 0x6a, 0x75, 0x73, 0x74,
-  0x6c, 0x69, 0x6b, 0x65, 0x66, 0x72, 0x65, 0x65, 0x77, 0x6f, 0x72, 0x6b, 0x74,
-  0x65, 0x78, 0x74, 0x79, 0x65, 0x61, 0x72, 0x6f, 0x76, 0x65, 0x72, 0x62, 0x6f,
-  0x64, 0x79, 0x6c, 0x6f, 0x76, 0x65, 0x66, 0x6f, 0x72, 0x6d, 0x62, 0x6f, 0x6f,
-  0x6b, 0x70, 0x6c, 0x61, 0x79, 0x6c, 0x69, 0x76, 0x65, 0x6c, 0x69, 0x6e, 0x65,
-  0x68, 0x65, 0x6c, 0x70, 0x68, 0x6f, 0x6d, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6d,
-  0x6f, 0x72, 0x65, 0x77, 0x6f, 0x72, 0x64, 0x6c, 0x6f, 0x6e, 0x67, 0x74, 0x68,
-  0x65, 0x6d, 0x76, 0x69, 0x65, 0x77, 0x66, 0x69, 0x6e, 0x64, 0x70, 0x61, 0x67,
-  0x65, 0x64, 0x61, 0x79, 0x73, 0x66, 0x75, 0x6c, 0x6c, 0x68, 0x65, 0x61, 0x64,
-  0x74, 0x65, 0x72, 0x6d, 0x65, 0x61, 0x63, 0x68, 0x61, 0x72, 0x65, 0x61, 0x66,
-  0x72, 0x6f, 0x6d, 0x74, 0x72, 0x75, 0x65, 0x6d, 0x61, 0x72, 0x6b, 0x61, 0x62,
-  0x6c, 0x65, 0x75, 0x70, 0x6f, 0x6e, 0x68, 0x69, 0x67, 0x68, 0x64, 0x61, 0x74,
-  0x65, 0x6c, 0x61, 0x6e, 0x64, 0x6e, 0x65, 0x77, 0x73, 0x65, 0x76, 0x65, 0x6e,
-  0x6e, 0x65, 0x78, 0x74, 0x63, 0x61, 0x73, 0x65, 0x62, 0x6f, 0x74, 0x68, 0x70,
-  0x6f, 0x73, 0x74, 0x75, 0x73, 0x65, 0x64, 0x6d, 0x61, 0x64, 0x65, 0x68, 0x61,
-  0x6e, 0x64, 0x68, 0x65, 0x72, 0x65, 0x77, 0x68, 0x61, 0x74, 0x6e, 0x61, 0x6d,
-  0x65, 0x4c, 0x69, 0x6e, 0x6b, 0x62, 0x6c, 0x6f, 0x67, 0x73, 0x69, 0x7a, 0x65,
-  0x62, 0x61, 0x73, 0x65, 0x68, 0x65, 0x6c, 0x64, 0x6d, 0x61, 0x6b, 0x65, 0x6d,
-  0x61, 0x69, 0x6e, 0x75, 0x73, 0x65, 0x72, 0x27, 0x29, 0x20, 0x2b, 0x68, 0x6f,
-  0x6c, 0x64, 0x65, 0x6e, 0x64, 0x73, 0x77, 0x69, 0x74, 0x68, 0x4e, 0x65, 0x77,
-  0x73, 0x72, 0x65, 0x61, 0x64, 0x77, 0x65, 0x72, 0x65, 0x73, 0x69, 0x67, 0x6e,
-  0x74, 0x61, 0x6b, 0x65, 0x68, 0x61, 0x76, 0x65, 0x67, 0x61, 0x6d, 0x65, 0x73,
-  0x65, 0x65, 0x6e, 0x63, 0x61, 0x6c, 0x6c, 0x70, 0x61, 0x74, 0x68, 0x77, 0x65,
-  0x6c, 0x6c, 0x70, 0x6c, 0x75, 0x73, 0x6d, 0x65, 0x6e, 0x75, 0x66, 0x69, 0x6c,
-  0x6d, 0x70, 0x61, 0x72, 0x74, 0x6a, 0x6f, 0x69, 0x6e, 0x74, 0x68, 0x69, 0x73,
-  0x6c, 0x69, 0x73, 0x74, 0x67, 0x6f, 0x6f, 0x64, 0x6e, 0x65, 0x65, 0x64, 0x77,
-  0x61, 0x79, 0x73, 0x77, 0x65, 0x73, 0x74, 0x6a, 0x6f, 0x62, 0x73, 0x6d, 0x69,
-  0x6e, 0x64, 0x61, 0x6c, 0x73, 0x6f, 0x6c, 0x6f, 0x67, 0x6f, 0x72, 0x69, 0x63,
-  0x68, 0x75, 0x73, 0x65, 0x73, 0x6c, 0x61, 0x73, 0x74, 0x74, 0x65, 0x61, 0x6d,
-  0x61, 0x72, 0x6d, 0x79, 0x66, 0x6f, 0x6f, 0x64, 0x6b, 0x69, 0x6e, 0x67, 0x77,
-  0x69, 0x6c, 0x6c, 0x65, 0x61, 0x73, 0x74, 0x77, 0x61, 0x72, 0x64, 0x62, 0x65,
-  0x73, 0x74, 0x66, 0x69, 0x72, 0x65, 0x50, 0x61, 0x67, 0x65, 0x6b, 0x6e, 0x6f,
-  0x77, 0x61, 0x77, 0x61, 0x79, 0x2e, 0x70, 0x6e, 0x67, 0x6d, 0x6f, 0x76, 0x65,
-  0x74, 0x68, 0x61, 0x6e, 0x6c, 0x6f, 0x61, 0x64, 0x67, 0x69, 0x76, 0x65, 0x73,
-  0x65, 0x6c, 0x66, 0x6e, 0x6f, 0x74, 0x65, 0x6d, 0x75, 0x63, 0x68, 0x66, 0x65,
-  0x65, 0x64, 0x6d, 0x61, 0x6e, 0x79, 0x72, 0x6f, 0x63, 0x6b, 0x69, 0x63, 0x6f,
-  0x6e, 0x6f, 0x6e, 0x63, 0x65, 0x6c, 0x6f, 0x6f, 0x6b, 0x68, 0x69, 0x64, 0x65,
-  0x64, 0x69, 0x65, 0x64, 0x48, 0x6f, 0x6d, 0x65, 0x72, 0x75, 0x6c, 0x65, 0x68,
-  0x6f, 0x73, 0x74, 0x61, 0x6a, 0x61, 0x78, 0x69, 0x6e, 0x66, 0x6f, 0x63, 0x6c,
-  0x75, 0x62, 0x6c, 0x61, 0x77, 0x73, 0x6c, 0x65, 0x73, 0x73, 0x68, 0x61, 0x6c,
-  0x66, 0x73, 0x6f, 0x6d, 0x65, 0x73, 0x75, 0x63, 0x68, 0x7a, 0x6f, 0x6e, 0x65,
-  0x31, 0x30, 0x30, 0x25, 0x6f, 0x6e, 0x65, 0x73, 0x63, 0x61, 0x72, 0x65, 0x54,
-  0x69, 0x6d, 0x65, 0x72, 0x61, 0x63, 0x65, 0x62, 0x6c, 0x75, 0x65, 0x66, 0x6f,
-  0x75, 0x72, 0x77, 0x65, 0x65, 0x6b, 0x66, 0x61, 0x63, 0x65, 0x68, 0x6f, 0x70,
-  0x65, 0x67, 0x61, 0x76, 0x65, 0x68, 0x61, 0x72, 0x64, 0x6c, 0x6f, 0x73, 0x74,
-  0x77, 0x68, 0x65, 0x6e, 0x70, 0x61, 0x72, 0x6b, 0x6b, 0x65, 0x70, 0x74, 0x70,
-  0x61, 0x73, 0x73, 0x73, 0x68, 0x69, 0x70, 0x72, 0x6f, 0x6f, 0x6d, 0x48, 0x54,
-  0x4d, 0x4c, 0x70, 0x6c, 0x61, 0x6e, 0x54, 0x79, 0x70, 0x65, 0x64, 0x6f, 0x6e,
-  0x65, 0x73, 0x61, 0x76, 0x65, 0x6b, 0x65, 0x65, 0x70, 0x66, 0x6c, 0x61, 0x67,
-  0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x6f, 0x6c, 0x64, 0x66, 0x69, 0x76, 0x65, 0x74,
-  0x6f, 0x6f, 0x6b, 0x72, 0x61, 0x74, 0x65, 0x74, 0x6f, 0x77, 0x6e, 0x6a, 0x75,
-  0x6d, 0x70, 0x74, 0x68, 0x75, 0x73, 0x64, 0x61, 0x72, 0x6b, 0x63, 0x61, 0x72,
-  0x64, 0x66, 0x69, 0x6c, 0x65, 0x66, 0x65, 0x61, 0x72, 0x73, 0x74, 0x61, 0x79,
-  0x6b, 0x69, 0x6c, 0x6c, 0x74, 0x68, 0x61, 0x74, 0x66, 0x61, 0x6c, 0x6c, 0x61,
-  0x75, 0x74, 0x6f, 0x65, 0x76, 0x65, 0x72, 0x2e, 0x63, 0x6f, 0x6d, 0x74, 0x61,
-  0x6c, 0x6b, 0x73, 0x68, 0x6f, 0x70, 0x76, 0x6f, 0x74, 0x65, 0x64, 0x65, 0x65,
-  0x70, 0x6d, 0x6f, 0x64, 0x65, 0x72, 0x65, 0x73, 0x74, 0x74, 0x75, 0x72, 0x6e,
-  0x62, 0x6f, 0x72, 0x6e, 0x62, 0x61, 0x6e, 0x64, 0x66, 0x65, 0x6c, 0x6c, 0x72,
-  0x6f, 0x73, 0x65, 0x75, 0x72, 0x6c, 0x28, 0x73, 0x6b, 0x69, 0x6e, 0x72, 0x6f,
-  0x6c, 0x65, 0x63, 0x6f, 0x6d, 0x65, 0x61, 0x63, 0x74, 0x73, 0x61, 0x67, 0x65,
-  0x73, 0x6d, 0x65, 0x65, 0x74, 0x67, 0x6f, 0x6c, 0x64, 0x2e, 0x6a, 0x70, 0x67,
-  0x69, 0x74, 0x65, 0x6d, 0x76, 0x61, 0x72, 0x79, 0x66, 0x65, 0x6c, 0x74, 0x74,
-  0x68, 0x65, 0x6e, 0x73, 0x65, 0x6e, 0x64, 0x64, 0x72, 0x6f, 0x70, 0x56, 0x69,
-  0x65, 0x77, 0x63, 0x6f, 0x70, 0x79, 0x31, 0x2e, 0x30, 0x22, 0x3c, 0x2f, 0x61,
-  0x3e, 0x73, 0x74, 0x6f, 0x70, 0x65, 0x6c, 0x73, 0x65, 0x6c, 0x69, 0x65, 0x73,
-  0x74, 0x6f, 0x75, 0x72, 0x70, 0x61, 0x63, 0x6b, 0x2e, 0x67, 0x69, 0x66, 0x70,
-  0x61, 0x73, 0x74, 0x63, 0x73, 0x73, 0x3f, 0x67, 0x72, 0x61, 0x79, 0x6d, 0x65,
-  0x61, 0x6e, 0x26, 0x67, 0x74, 0x3b, 0x72, 0x69, 0x64, 0x65, 0x73, 0x68, 0x6f,
-  0x74, 0x6c, 0x61, 0x74, 0x65, 0x73, 0x61, 0x69, 0x64, 0x72, 0x6f, 0x61, 0x64,
-  0x76, 0x61, 0x72, 0x20, 0x66, 0x65, 0x65, 0x6c, 0x6a, 0x6f, 0x68, 0x6e, 0x72,
-  0x69, 0x63, 0x6b, 0x70, 0x6f, 0x72, 0x74, 0x66, 0x61, 0x73, 0x74, 0x27, 0x55,
-  0x41, 0x2d, 0x64, 0x65, 0x61, 0x64, 0x3c, 0x2f, 0x62, 0x3e, 0x70, 0x6f, 0x6f,
-  0x72, 0x62, 0x69, 0x6c, 0x6c, 0x74, 0x79, 0x70, 0x65, 0x55, 0x2e, 0x53, 0x2e,
-  0x77, 0x6f, 0x6f, 0x64, 0x6d, 0x75, 0x73, 0x74, 0x32, 0x70, 0x78, 0x3b, 0x49,
-  0x6e, 0x66, 0x6f, 0x72, 0x61, 0x6e, 0x6b, 0x77, 0x69, 0x64, 0x65, 0x77, 0x61,
-  0x6e, 0x74, 0x77, 0x61, 0x6c, 0x6c, 0x6c, 0x65, 0x61, 0x64, 0x5b, 0x30, 0x5d,
-  0x3b, 0x70, 0x61, 0x75, 0x6c, 0x77, 0x61, 0x76, 0x65, 0x73, 0x75, 0x72, 0x65,
-  0x24, 0x28, 0x27, 0x23, 0x77, 0x61, 0x69, 0x74, 0x6d, 0x61, 0x73, 0x73, 0x61,
-  0x72, 0x6d, 0x73, 0x67, 0x6f, 0x65, 0x73, 0x67, 0x61, 0x69, 0x6e, 0x6c, 0x61,
-  0x6e, 0x67, 0x70, 0x61, 0x69, 0x64, 0x21, 0x2d, 0x2d, 0x20, 0x6c, 0x6f, 0x63,
-  0x6b, 0x75, 0x6e, 0x69, 0x74, 0x72, 0x6f, 0x6f, 0x74, 0x77, 0x61, 0x6c, 0x6b,
-  0x66, 0x69, 0x72, 0x6d, 0x77, 0x69, 0x66, 0x65, 0x78, 0x6d, 0x6c, 0x22, 0x73,
-  0x6f, 0x6e, 0x67, 0x74, 0x65, 0x73, 0x74, 0x32, 0x30, 0x70, 0x78, 0x6b, 0x69,
-  0x6e, 0x64, 0x72, 0x6f, 0x77, 0x73, 0x74, 0x6f, 0x6f, 0x6c, 0x66, 0x6f, 0x6e,
-  0x74, 0x6d, 0x61, 0x69, 0x6c, 0x73, 0x61, 0x66, 0x65, 0x73, 0x74, 0x61, 0x72,
-  0x6d, 0x61, 0x70, 0x73, 0x63, 0x6f, 0x72, 0x65, 0x72, 0x61, 0x69, 0x6e, 0x66,
-  0x6c, 0x6f, 0x77, 0x62, 0x61, 0x62, 0x79, 0x73, 0x70, 0x61, 0x6e, 0x73, 0x61,
-  0x79, 0x73, 0x34, 0x70, 0x78, 0x3b, 0x36, 0x70, 0x78, 0x3b, 0x61, 0x72, 0x74,
-  0x73, 0x66, 0x6f, 0x6f, 0x74, 0x72, 0x65, 0x61, 0x6c, 0x77, 0x69, 0x6b, 0x69,
-  0x68, 0x65, 0x61, 0x74, 0x73, 0x74, 0x65, 0x70, 0x74, 0x72, 0x69, 0x70, 0x6f,
-  0x72, 0x67, 0x2f, 0x6c, 0x61, 0x6b, 0x65, 0x77, 0x65, 0x61, 0x6b, 0x74, 0x6f,
-  0x6c, 0x64, 0x46, 0x6f, 0x72, 0x6d, 0x63, 0x61, 0x73, 0x74, 0x66, 0x61, 0x6e,
-  0x73, 0x62, 0x61, 0x6e, 0x6b, 0x76, 0x65, 0x72, 0x79, 0x72, 0x75, 0x6e, 0x73,
-  0x6a, 0x75, 0x6c, 0x79, 0x74, 0x61, 0x73, 0x6b, 0x31, 0x70, 0x78, 0x3b, 0x67,
-  0x6f, 0x61, 0x6c, 0x67, 0x72, 0x65, 0x77, 0x73, 0x6c, 0x6f, 0x77, 0x65, 0x64,
-  0x67, 0x65, 0x69, 0x64, 0x3d, 0x22, 0x73, 0x65, 0x74, 0x73, 0x35, 0x70, 0x78,
-  0x3b, 0x2e, 0x6a, 0x73, 0x3f, 0x34, 0x30, 0x70, 0x78, 0x69, 0x66, 0x20, 0x28,
-  0x73, 0x6f, 0x6f, 0x6e, 0x73, 0x65, 0x61, 0x74, 0x6e, 0x6f, 0x6e, 0x65, 0x74,
-  0x75, 0x62, 0x65, 0x7a, 0x65, 0x72, 0x6f, 0x73, 0x65, 0x6e, 0x74, 0x72, 0x65,
-  0x65, 0x64, 0x66, 0x61, 0x63, 0x74, 0x69, 0x6e, 0x74, 0x6f, 0x67, 0x69, 0x66,
-  0x74, 0x68, 0x61, 0x72, 0x6d, 0x31, 0x38, 0x70, 0x78, 0x63, 0x61, 0x6d, 0x65,
-  0x68, 0x69, 0x6c, 0x6c, 0x62, 0x6f, 0x6c, 0x64, 0x7a, 0x6f, 0x6f, 0x6d, 0x76,
-  0x6f, 0x69, 0x64, 0x65, 0x61, 0x73, 0x79, 0x72, 0x69, 0x6e, 0x67, 0x66, 0x69,
-  0x6c, 0x6c, 0x70, 0x65, 0x61, 0x6b, 0x69, 0x6e, 0x69, 0x74, 0x63, 0x6f, 0x73,
-  0x74, 0x33, 0x70, 0x78, 0x3b, 0x6a, 0x61, 0x63, 0x6b, 0x74, 0x61, 0x67, 0x73,
-  0x62, 0x69, 0x74, 0x73, 0x72, 0x6f, 0x6c, 0x6c, 0x65, 0x64, 0x69, 0x74, 0x6b,
-  0x6e, 0x65, 0x77, 0x6e, 0x65, 0x61, 0x72, 0x3c, 0x21, 0x2d, 0x2d, 0x67, 0x72,
-  0x6f, 0x77, 0x4a, 0x53, 0x4f, 0x4e, 0x64, 0x75, 0x74, 0x79, 0x4e, 0x61, 0x6d,
-  0x65, 0x73, 0x61, 0x6c, 0x65, 0x79, 0x6f, 0x75, 0x20, 0x6c, 0x6f, 0x74, 0x73,
-  0x70, 0x61, 0x69, 0x6e, 0x6a, 0x61, 0x7a, 0x7a, 0x63, 0x6f, 0x6c, 0x64, 0x65,
-  0x79, 0x65, 0x73, 0x66, 0x69, 0x73, 0x68, 0x77, 0x77, 0x77, 0x2e, 0x72, 0x69,
-  0x73, 0x6b, 0x74, 0x61, 0x62, 0x73, 0x70, 0x72, 0x65, 0x76, 0x31, 0x30, 0x70,
-  0x78, 0x72, 0x69, 0x73, 0x65, 0x32, 0x35, 0x70, 0x78, 0x42, 0x6c, 0x75, 0x65,
-  0x64, 0x69, 0x6e, 0x67, 0x33, 0x30, 0x30, 0x2c, 0x62, 0x61, 0x6c, 0x6c, 0x66,
-  0x6f, 0x72, 0x64, 0x65, 0x61, 0x72, 0x6e, 0x77, 0x69, 0x6c, 0x64, 0x62, 0x6f,
-  0x78, 0x2e, 0x66, 0x61, 0x69, 0x72, 0x6c, 0x61, 0x63, 0x6b, 0x76, 0x65, 0x72,
-  0x73, 0x70, 0x61, 0x69, 0x72, 0x6a, 0x75, 0x6e, 0x65, 0x74, 0x65, 0x63, 0x68,
-  0x69, 0x66, 0x28, 0x21, 0x70, 0x69, 0x63, 0x6b, 0x65, 0x76, 0x69, 0x6c, 0x24,
-  0x28, 0x22, 0x23, 0x77, 0x61, 0x72, 0x6d, 0x6c, 0x6f, 0x72, 0x64, 0x64, 0x6f,
-  0x65, 0x73, 0x70, 0x75, 0x6c, 0x6c, 0x2c, 0x30, 0x30, 0x30, 0x69, 0x64, 0x65,
-  0x61, 0x64, 0x72, 0x61, 0x77, 0x68, 0x75, 0x67, 0x65, 0x73, 0x70, 0x6f, 0x74,
-  0x66, 0x75, 0x6e, 0x64, 0x62, 0x75, 0x72, 0x6e, 0x68, 0x72, 0x65, 0x66, 0x63,
-  0x65, 0x6c, 0x6c, 0x6b, 0x65, 0x79, 0x73, 0x74, 0x69, 0x63, 0x6b, 0x68, 0x6f,
-  0x75, 0x72, 0x6c, 0x6f, 0x73, 0x73, 0x66, 0x75, 0x65, 0x6c, 0x31, 0x32, 0x70,
-  0x78, 0x73, 0x75, 0x69, 0x74, 0x64, 0x65, 0x61, 0x6c, 0x52, 0x53, 0x53, 0x22,
-  0x61, 0x67, 0x65, 0x64, 0x67, 0x72, 0x65, 0x79, 0x47, 0x45, 0x54, 0x22, 0x65,
-  0x61, 0x73, 0x65, 0x61, 0x69, 0x6d, 0x73, 0x67, 0x69, 0x72, 0x6c, 0x61, 0x69,
-  0x64, 0x73, 0x38, 0x70, 0x78, 0x3b, 0x6e, 0x61, 0x76, 0x79, 0x67, 0x72, 0x69,
-  0x64, 0x74, 0x69, 0x70, 0x73, 0x23, 0x39, 0x39, 0x39, 0x77, 0x61, 0x72, 0x73,
-  0x6c, 0x61, 0x64, 0x79, 0x63, 0x61, 0x72, 0x73, 0x29, 0x3b, 0x20, 0x7d, 0x70,
-  0x68, 0x70, 0x3f, 0x68, 0x65, 0x6c, 0x6c, 0x74, 0x61, 0x6c, 0x6c, 0x77, 0x68,
-  0x6f, 0x6d, 0x7a, 0x68, 0x3a, 0xe5, 0x2a, 0x2f, 0x0d, 0x0a, 0x20, 0x31, 0x30,
-  0x30, 0x68, 0x61, 0x6c, 0x6c, 0x2e, 0x0a, 0x0a, 0x41, 0x37, 0x70, 0x78, 0x3b,
-  0x70, 0x75, 0x73, 0x68, 0x63, 0x68, 0x61, 0x74, 0x30, 0x70, 0x78, 0x3b, 0x63,
-  0x72, 0x65, 0x77, 0x2a, 0x2f, 0x3c, 0x2f, 0x68, 0x61, 0x73, 0x68, 0x37, 0x35,
-  0x70, 0x78, 0x66, 0x6c, 0x61, 0x74, 0x72, 0x61, 0x72, 0x65, 0x20, 0x26, 0x26,
-  0x20, 0x74, 0x65, 0x6c, 0x6c, 0x63, 0x61, 0x6d, 0x70, 0x6f, 0x6e, 0x74, 0x6f,
-  0x6c, 0x61, 0x69, 0x64, 0x6d, 0x69, 0x73, 0x73, 0x73, 0x6b, 0x69, 0x70, 0x74,
-  0x65, 0x6e, 0x74, 0x66, 0x69, 0x6e, 0x65, 0x6d, 0x61, 0x6c, 0x65, 0x67, 0x65,
-  0x74, 0x73, 0x70, 0x6c, 0x6f, 0x74, 0x34, 0x30, 0x30, 0x2c, 0x0d, 0x0a, 0x0d,
-  0x0a, 0x63, 0x6f, 0x6f, 0x6c, 0x66, 0x65, 0x65, 0x74, 0x2e, 0x70, 0x68, 0x70,
-  0x3c, 0x62, 0x72, 0x3e, 0x65, 0x72, 0x69, 0x63, 0x6d, 0x6f, 0x73, 0x74, 0x67,
-  0x75, 0x69, 0x64, 0x62, 0x65, 0x6c, 0x6c, 0x64, 0x65, 0x73, 0x63, 0x68, 0x61,
-  0x69, 0x72, 0x6d, 0x61, 0x74, 0x68, 0x61, 0x74, 0x6f, 0x6d, 0x2f, 0x69, 0x6d,
-  0x67, 0x26, 0x23, 0x38, 0x32, 0x6c, 0x75, 0x63, 0x6b, 0x63, 0x65, 0x6e, 0x74,
-  0x30, 0x30, 0x30, 0x3b, 0x74, 0x69, 0x6e, 0x79, 0x67, 0x6f, 0x6e, 0x65, 0x68,
-  0x74, 0x6d, 0x6c, 0x73, 0x65, 0x6c, 0x6c, 0x64, 0x72, 0x75, 0x67, 0x46, 0x52,
-  0x45, 0x45, 0x6e, 0x6f, 0x64, 0x65, 0x6e, 0x69, 0x63, 0x6b, 0x3f, 0x69, 0x64,
-  0x3d, 0x6c, 0x6f, 0x73, 0x65, 0x6e, 0x75, 0x6c, 0x6c, 0x76, 0x61, 0x73, 0x74,
-  0x77, 0x69, 0x6e, 0x64, 0x52, 0x53, 0x53, 0x20, 0x77, 0x65, 0x61, 0x72, 0x72,
-  0x65, 0x6c, 0x79, 0x62, 0x65, 0x65, 0x6e, 0x73, 0x61, 0x6d, 0x65, 0x64, 0x75,
-  0x6b, 0x65, 0x6e, 0x61, 0x73, 0x61, 0x63, 0x61, 0x70, 0x65, 0x77, 0x69, 0x73,
-  0x68, 0x67, 0x75, 0x6c, 0x66, 0x54, 0x32, 0x33, 0x3a, 0x68, 0x69, 0x74, 0x73,
-  0x73, 0x6c, 0x6f, 0x74, 0x67, 0x61, 0x74, 0x65, 0x6b, 0x69, 0x63, 0x6b, 0x62,
-  0x6c, 0x75, 0x72, 0x74, 0x68, 0x65, 0x79, 0x31, 0x35, 0x70, 0x78, 0x27, 0x27,
-  0x29, 0x3b, 0x29, 0x3b, 0x22, 0x3e, 0x6d, 0x73, 0x69, 0x65, 0x77, 0x69, 0x6e,
-  0x73, 0x62, 0x69, 0x72, 0x64, 0x73, 0x6f, 0x72, 0x74, 0x62, 0x65, 0x74, 0x61,
-  0x73, 0x65, 0x65, 0x6b, 0x54, 0x31, 0x38, 0x3a, 0x6f, 0x72, 0x64, 0x73, 0x74,
-  0x72, 0x65, 0x65, 0x6d, 0x61, 0x6c, 0x6c, 0x36, 0x30, 0x70, 0x78, 0x66, 0x61,
-  0x72, 0x6d, 0xe2, 0x80, 0x99, 0x73, 0x62, 0x6f, 0x79, 0x73, 0x5b, 0x30, 0x5d,
-  0x2e, 0x27, 0x29, 0x3b, 0x22, 0x50, 0x4f, 0x53, 0x54, 0x62, 0x65, 0x61, 0x72,
-  0x6b, 0x69, 0x64, 0x73, 0x29, 0x3b, 0x7d, 0x7d, 0x6d, 0x61, 0x72, 0x79, 0x74,
-  0x65, 0x6e, 0x64, 0x28, 0x55, 0x4b, 0x29, 0x71, 0x75, 0x61, 0x64, 0x7a, 0x68,
-  0x3a, 0xe6, 0x2d, 0x73, 0x69, 0x7a, 0x2d, 0x2d, 0x2d, 0x2d, 0x70, 0x72, 0x6f,
-  0x70, 0x27, 0x29, 0x3b, 0x0d, 0x6c, 0x69, 0x66, 0x74, 0x54, 0x31, 0x39, 0x3a,
-  0x76, 0x69, 0x63, 0x65, 0x61, 0x6e, 0x64, 0x79, 0x64, 0x65, 0x62, 0x74, 0x3e,
-  0x52, 0x53, 0x53, 0x70, 0x6f, 0x6f, 0x6c, 0x6e, 0x65, 0x63, 0x6b, 0x62, 0x6c,
-  0x6f, 0x77, 0x54, 0x31, 0x36, 0x3a, 0x64, 0x6f, 0x6f, 0x72, 0x65, 0x76, 0x61,
-  0x6c, 0x54, 0x31, 0x37, 0x3a, 0x6c, 0x65, 0x74, 0x73, 0x66, 0x61, 0x69, 0x6c,
-  0x6f, 0x72, 0x61, 0x6c, 0x70, 0x6f, 0x6c, 0x6c, 0x6e, 0x6f, 0x76, 0x61, 0x63,
-  0x6f, 0x6c, 0x73, 0x67, 0x65, 0x6e, 0x65, 0x20, 0xe2, 0x80, 0x94, 0x73, 0x6f,
-  0x66, 0x74, 0x72, 0x6f, 0x6d, 0x65, 0x74, 0x69, 0x6c, 0x6c, 0x72, 0x6f, 0x73,
-  0x73, 0x3c, 0x68, 0x33, 0x3e, 0x70, 0x6f, 0x75, 0x72, 0x66, 0x61, 0x64, 0x65,
-  0x70, 0x69, 0x6e, 0x6b, 0x3c, 0x74, 0x72, 0x3e, 0x6d, 0x69, 0x6e, 0x69, 0x29,
-  0x7c, 0x21, 0x28, 0x6d, 0x69, 0x6e, 0x65, 0x7a, 0x68, 0x3a, 0xe8, 0x62, 0x61,
-  0x72, 0x73, 0x68, 0x65, 0x61, 0x72, 0x30, 0x30, 0x29, 0x3b, 0x6d, 0x69, 0x6c,
-  0x6b, 0x20, 0x2d, 0x2d, 0x3e, 0x69, 0x72, 0x6f, 0x6e, 0x66, 0x72, 0x65, 0x64,
-  0x64, 0x69, 0x73, 0x6b, 0x77, 0x65, 0x6e, 0x74, 0x73, 0x6f, 0x69, 0x6c, 0x70,
-  0x75, 0x74, 0x73, 0x2f, 0x6a, 0x73, 0x2f, 0x68, 0x6f, 0x6c, 0x79, 0x54, 0x32,
-  0x32, 0x3a, 0x49, 0x53, 0x42, 0x4e, 0x54, 0x32, 0x30, 0x3a, 0x61, 0x64, 0x61,
-  0x6d, 0x73, 0x65, 0x65, 0x73, 0x3c, 0x68, 0x32, 0x3e, 0x6a, 0x73, 0x6f, 0x6e,
-  0x27, 0x2c, 0x20, 0x27, 0x63, 0x6f, 0x6e, 0x74, 0x54, 0x32, 0x31, 0x3a, 0x20,
-  0x52, 0x53, 0x53, 0x6c, 0x6f, 0x6f, 0x70, 0x61, 0x73, 0x69, 0x61, 0x6d, 0x6f,
-  0x6f, 0x6e, 0x3c, 0x2f, 0x70, 0x3e, 0x73, 0x6f, 0x75, 0x6c, 0x4c, 0x49, 0x4e,
-  0x45, 0x66, 0x6f, 0x72, 0x74, 0x63, 0x61, 0x72, 0x74, 0x54, 0x31, 0x34, 0x3a,
-  0x3c, 0x68, 0x31, 0x3e, 0x38, 0x30, 0x70, 0x78, 0x21, 0x2d, 0x2d, 0x3c, 0x39,
-  0x70, 0x78, 0x3b, 0x54, 0x30, 0x34, 0x3a, 0x6d, 0x69, 0x6b, 0x65, 0x3a, 0x34,
-  0x36, 0x5a, 0x6e, 0x69, 0x63, 0x65, 0x69, 0x6e, 0x63, 0x68, 0x59, 0x6f, 0x72,
-  0x6b, 0x72, 0x69, 0x63, 0x65, 0x7a, 0x68, 0x3a, 0xe4, 0x27, 0x29, 0x29, 0x3b,
-  0x70, 0x75, 0x72, 0x65, 0x6d, 0x61, 0x67, 0x65, 0x70, 0x61, 0x72, 0x61, 0x74,
-  0x6f, 0x6e, 0x65, 0x62, 0x6f, 0x6e, 0x64, 0x3a, 0x33, 0x37, 0x5a, 0x5f, 0x6f,
-  0x66, 0x5f, 0x27, 0x5d, 0x29, 0x3b, 0x30, 0x30, 0x30, 0x2c, 0x7a, 0x68, 0x3a,
-  0xe7, 0x74, 0x61, 0x6e, 0x6b, 0x79, 0x61, 0x72, 0x64, 0x62, 0x6f, 0x77, 0x6c,
-  0x62, 0x75, 0x73, 0x68, 0x3a, 0x35, 0x36, 0x5a, 0x4a, 0x61, 0x76, 0x61, 0x33,
-  0x30, 0x70, 0x78, 0x0a, 0x7c, 0x7d, 0x0a, 0x25, 0x43, 0x33, 0x25, 0x3a, 0x33,
-  0x34, 0x5a, 0x6a, 0x65, 0x66, 0x66, 0x45, 0x58, 0x50, 0x49, 0x63, 0x61, 0x73,
-  0x68, 0x76, 0x69, 0x73, 0x61, 0x67, 0x6f, 0x6c, 0x66, 0x73, 0x6e, 0x6f, 0x77,
-  0x7a, 0x68, 0x3a, 0xe9, 0x71, 0x75, 0x65, 0x72, 0x2e, 0x63, 0x73, 0x73, 0x73,
-  0x69, 0x63, 0x6b, 0x6d, 0x65, 0x61, 0x74, 0x6d, 0x69, 0x6e, 0x2e, 0x62, 0x69,
-  0x6e, 0x64, 0x64, 0x65, 0x6c, 0x6c, 0x68, 0x69, 0x72, 0x65, 0x70, 0x69, 0x63,
-  0x73, 0x72, 0x65, 0x6e, 0x74, 0x3a, 0x33, 0x36, 0x5a, 0x48, 0x54, 0x54, 0x50,
-  0x2d, 0x32, 0x30, 0x31, 0x66, 0x6f, 0x74, 0x6f, 0x77, 0x6f, 0x6c, 0x66, 0x45,
-  0x4e, 0x44, 0x20, 0x78, 0x62, 0x6f, 0x78, 0x3a, 0x35, 0x34, 0x5a, 0x42, 0x4f,
-  0x44, 0x59, 0x64, 0x69, 0x63, 0x6b, 0x3b, 0x0a, 0x7d, 0x0a, 0x65, 0x78, 0x69,
-  0x74, 0x3a, 0x33, 0x35, 0x5a, 0x76, 0x61, 0x72, 0x73, 0x62, 0x65, 0x61, 0x74,
-  0x27, 0x7d, 0x29, 0x3b, 0x64, 0x69, 0x65, 0x74, 0x39, 0x39, 0x39, 0x3b, 0x61,
-  0x6e, 0x6e, 0x65, 0x7d, 0x7d, 0x3c, 0x2f, 0x5b, 0x69, 0x5d, 0x2e, 0x4c, 0x61,
-  0x6e, 0x67, 0x6b, 0x6d, 0xc2, 0xb2, 0x77, 0x69, 0x72, 0x65, 0x74, 0x6f, 0x79,
-  0x73, 0x61, 0x64, 0x64, 0x73, 0x73, 0x65, 0x61, 0x6c, 0x61, 0x6c, 0x65, 0x78,
-  0x3b, 0x0a, 0x09, 0x7d, 0x65, 0x63, 0x68, 0x6f, 0x6e, 0x69, 0x6e, 0x65, 0x2e,
-  0x6f, 0x72, 0x67, 0x30, 0x30, 0x35, 0x29, 0x74, 0x6f, 0x6e, 0x79, 0x6a, 0x65,
-  0x77, 0x73, 0x73, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x67, 0x73, 0x72, 0x6f, 0x6f,
-  0x66, 0x30, 0x30, 0x30, 0x29, 0x20, 0x32, 0x30, 0x30, 0x77, 0x69, 0x6e, 0x65,
-  0x67, 0x65, 0x61, 0x72, 0x64, 0x6f, 0x67, 0x73, 0x62, 0x6f, 0x6f, 0x74, 0x67,
-  0x61, 0x72, 0x79, 0x63, 0x75, 0x74, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x74, 0x65,
-  0x6d, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x78, 0x6d, 0x6c, 0x63, 0x6f, 0x63,
-  0x6b, 0x67, 0x61, 0x6e, 0x67, 0x24, 0x28, 0x27, 0x2e, 0x35, 0x30, 0x70, 0x78,
-  0x50, 0x68, 0x2e, 0x44, 0x6d, 0x69, 0x73, 0x63, 0x61, 0x6c, 0x61, 0x6e, 0x6c,
-  0x6f, 0x61, 0x6e, 0x64, 0x65, 0x73, 0x6b, 0x6d, 0x69, 0x6c, 0x65, 0x72, 0x79,
-  0x61, 0x6e, 0x75, 0x6e, 0x69, 0x78, 0x64, 0x69, 0x73, 0x63, 0x29, 0x3b, 0x7d,
-  0x0a, 0x64, 0x75, 0x73, 0x74, 0x63, 0x6c, 0x69, 0x70, 0x29, 0x2e, 0x0a, 0x0a,
-  0x37, 0x30, 0x70, 0x78, 0x2d, 0x32, 0x30, 0x30, 0x44, 0x56, 0x44, 0x73, 0x37,
-  0x5d, 0x3e, 0x3c, 0x74, 0x61, 0x70, 0x65, 0x64, 0x65, 0x6d, 0x6f, 0x69, 0x2b,
-  0x2b, 0x29, 0x77, 0x61, 0x67, 0x65, 0x65, 0x75, 0x72, 0x6f, 0x70, 0x68, 0x69,
-  0x6c, 0x6f, 0x70, 0x74, 0x73, 0x68, 0x6f, 0x6c, 0x65, 0x46, 0x41, 0x51, 0x73,
-  0x61, 0x73, 0x69, 0x6e, 0x2d, 0x32, 0x36, 0x54, 0x6c, 0x61, 0x62, 0x73, 0x70,
-  0x65, 0x74, 0x73, 0x55, 0x52, 0x4c, 0x20, 0x62, 0x75, 0x6c, 0x6b, 0x63, 0x6f,
-  0x6f, 0x6b, 0x3b, 0x7d, 0x0d, 0x0a, 0x48, 0x45, 0x41, 0x44, 0x5b, 0x30, 0x5d,
-  0x29, 0x61, 0x62, 0x62, 0x72, 0x6a, 0x75, 0x61, 0x6e, 0x28, 0x31, 0x39, 0x38,
-  0x6c, 0x65, 0x73, 0x68, 0x74, 0x77, 0x69, 0x6e, 0x3c, 0x2f, 0x69, 0x3e, 0x73,
-  0x6f, 0x6e, 0x79, 0x67, 0x75, 0x79, 0x73, 0x66, 0x75, 0x63, 0x6b, 0x70, 0x69,
-  0x70, 0x65, 0x7c, 0x2d, 0x0a, 0x21, 0x30, 0x30, 0x32, 0x29, 0x6e, 0x64, 0x6f,
-  0x77, 0x5b, 0x31, 0x5d, 0x3b, 0x5b, 0x5d, 0x3b, 0x0a, 0x4c, 0x6f, 0x67, 0x20,
-  0x73, 0x61, 0x6c, 0x74, 0x0d, 0x0a, 0x09, 0x09, 0x62, 0x61, 0x6e, 0x67, 0x74,
-  0x72, 0x69, 0x6d, 0x62, 0x61, 0x74, 0x68, 0x29, 0x7b, 0x0d, 0x0a, 0x30, 0x30,
-  0x70, 0x78, 0x0a, 0x7d, 0x29, 0x3b, 0x6b, 0x6f, 0x3a, 0xec, 0x66, 0x65, 0x65,
-  0x73, 0x61, 0x64, 0x3e, 0x0d, 0x73, 0x3a, 0x2f, 0x2f, 0x20, 0x5b, 0x5d, 0x3b,
-  0x74, 0x6f, 0x6c, 0x6c, 0x70, 0x6c, 0x75, 0x67, 0x28, 0x29, 0x7b, 0x0a, 0x7b,
-  0x0d, 0x0a, 0x20, 0x2e, 0x6a, 0x73, 0x27, 0x32, 0x30, 0x30, 0x70, 0x64, 0x75,
-  0x61, 0x6c, 0x62, 0x6f, 0x61, 0x74, 0x2e, 0x4a, 0x50, 0x47, 0x29, 0x3b, 0x0a,
-  0x7d, 0x71, 0x75, 0x6f, 0x74, 0x29, 0x3b, 0x0a, 0x0a, 0x27, 0x29, 0x3b, 0x0a,
-  0x0d, 0x0a, 0x7d, 0x0d, 0x32, 0x30, 0x31, 0x34, 0x32, 0x30, 0x31, 0x35, 0x32,
-  0x30, 0x31, 0x36, 0x32, 0x30, 0x31, 0x37, 0x32, 0x30, 0x31, 0x38, 0x32, 0x30,
-  0x31, 0x39, 0x32, 0x30, 0x32, 0x30, 0x32, 0x30, 0x32, 0x31, 0x32, 0x30, 0x32,
-  0x32, 0x32, 0x30, 0x32, 0x33, 0x32, 0x30, 0x32, 0x34, 0x32, 0x30, 0x32, 0x35,
-  0x32, 0x30, 0x32, 0x36, 0x32, 0x30, 0x32, 0x37, 0x32, 0x30, 0x32, 0x38, 0x32,
-  0x30, 0x32, 0x39, 0x32, 0x30, 0x33, 0x30, 0x32, 0x30, 0x33, 0x31, 0x32, 0x30,
-  0x33, 0x32, 0x32, 0x30, 0x33, 0x33, 0x32, 0x30, 0x33, 0x34, 0x32, 0x30, 0x33,
-  0x35, 0x32, 0x30, 0x33, 0x36, 0x32, 0x30, 0x33, 0x37, 0x32, 0x30, 0x31, 0x33,
-  0x32, 0x30, 0x31, 0x32, 0x32, 0x30, 0x31, 0x31, 0x32, 0x30, 0x31, 0x30, 0x32,
-  0x30, 0x30, 0x39, 0x32, 0x30, 0x30, 0x38, 0x32, 0x30, 0x30, 0x37, 0x32, 0x30,
-  0x30, 0x36, 0x32, 0x30, 0x30, 0x35, 0x32, 0x30, 0x30, 0x34, 0x32, 0x30, 0x30,
-  0x33, 0x32, 0x30, 0x30, 0x32, 0x32, 0x30, 0x30, 0x31, 0x32, 0x30, 0x30, 0x30,
-  0x31, 0x39, 0x39, 0x39, 0x31, 0x39, 0x39, 0x38, 0x31, 0x39, 0x39, 0x37, 0x31,
-  0x39, 0x39, 0x36, 0x31, 0x39, 0x39, 0x35, 0x31, 0x39, 0x39, 0x34, 0x31, 0x39,
-  0x39, 0x33, 0x31, 0x39, 0x39, 0x32, 0x31, 0x39, 0x39, 0x31, 0x31, 0x39, 0x39,
-  0x30, 0x31, 0x39, 0x38, 0x39, 0x31, 0x39, 0x38, 0x38, 0x31, 0x39, 0x38, 0x37,
-  0x31, 0x39, 0x38, 0x36, 0x31, 0x39, 0x38, 0x35, 0x31, 0x39, 0x38, 0x34, 0x31,
-  0x39, 0x38, 0x33, 0x31, 0x39, 0x38, 0x32, 0x31, 0x39, 0x38, 0x31, 0x31, 0x39,
-  0x38, 0x30, 0x31, 0x39, 0x37, 0x39, 0x31, 0x39, 0x37, 0x38, 0x31, 0x39, 0x37,
-  0x37, 0x31, 0x39, 0x37, 0x36, 0x31, 0x39, 0x37, 0x35, 0x31, 0x39, 0x37, 0x34,
-  0x31, 0x39, 0x37, 0x33, 0x31, 0x39, 0x37, 0x32, 0x31, 0x39, 0x37, 0x31, 0x31,
-  0x39, 0x37, 0x30, 0x31, 0x39, 0x36, 0x39, 0x31, 0x39, 0x36, 0x38, 0x31, 0x39,
-  0x36, 0x37, 0x31, 0x39, 0x36, 0x36, 0x31, 0x39, 0x36, 0x35, 0x31, 0x39, 0x36,
-  0x34, 0x31, 0x39, 0x36, 0x33, 0x31, 0x39, 0x36, 0x32, 0x31, 0x39, 0x36, 0x31,
-  0x31, 0x39, 0x36, 0x30, 0x31, 0x39, 0x35, 0x39, 0x31, 0x39, 0x35, 0x38, 0x31,
-  0x39, 0x35, 0x37, 0x31, 0x39, 0x35, 0x36, 0x31, 0x39, 0x35, 0x35, 0x31, 0x39,
-  0x35, 0x34, 0x31, 0x39, 0x35, 0x33, 0x31, 0x39, 0x35, 0x32, 0x31, 0x39, 0x35,
-  0x31, 0x31, 0x39, 0x35, 0x30, 0x31, 0x30, 0x30, 0x30, 0x31, 0x30, 0x32, 0x34,
-  0x31, 0x33, 0x39, 0x34, 0x30, 0x30, 0x30, 0x30, 0x39, 0x39, 0x39, 0x39, 0x63,
-  0x6f, 0x6d, 0x6f, 0x6d, 0xc3, 0xa1, 0x73, 0x65, 0x73, 0x74, 0x65, 0x65, 0x73,
-  0x74, 0x61, 0x70, 0x65, 0x72, 0x6f, 0x74, 0x6f, 0x64, 0x6f, 0x68, 0x61, 0x63,
-  0x65, 0x63, 0x61, 0x64, 0x61, 0x61, 0xc3, 0xb1, 0x6f, 0x62, 0x69, 0x65, 0x6e,
-  0x64, 0xc3, 0xad, 0x61, 0x61, 0x73, 0xc3, 0xad, 0x76, 0x69, 0x64, 0x61, 0x63,
-  0x61, 0x73, 0x6f, 0x6f, 0x74, 0x72, 0x6f, 0x66, 0x6f, 0x72, 0x6f, 0x73, 0x6f,
-  0x6c, 0x6f, 0x6f, 0x74, 0x72, 0x61, 0x63, 0x75, 0x61, 0x6c, 0x64, 0x69, 0x6a,
-  0x6f, 0x73, 0x69, 0x64, 0x6f, 0x67, 0x72, 0x61, 0x6e, 0x74, 0x69, 0x70, 0x6f,
-  0x74, 0x65, 0x6d, 0x61, 0x64, 0x65, 0x62, 0x65, 0x61, 0x6c, 0x67, 0x6f, 0x71,
-  0x75, 0xc3, 0xa9, 0x65, 0x73, 0x74, 0x6f, 0x6e, 0x61, 0x64, 0x61, 0x74, 0x72,
-  0x65, 0x73, 0x70, 0x6f, 0x63, 0x6f, 0x63, 0x61, 0x73, 0x61, 0x62, 0x61, 0x6a,
-  0x6f, 0x74, 0x6f, 0x64, 0x61, 0x73, 0x69, 0x6e, 0x6f, 0x61, 0x67, 0x75, 0x61,
-  0x70, 0x75, 0x65, 0x73, 0x75, 0x6e, 0x6f, 0x73, 0x61, 0x6e, 0x74, 0x65, 0x64,
-  0x69, 0x63, 0x65, 0x6c, 0x75, 0x69, 0x73, 0x65, 0x6c, 0x6c, 0x61, 0x6d, 0x61,
-  0x79, 0x6f, 0x7a, 0x6f, 0x6e, 0x61, 0x61, 0x6d, 0x6f, 0x72, 0x70, 0x69, 0x73,
-  0x6f, 0x6f, 0x62, 0x72, 0x61, 0x63, 0x6c, 0x69, 0x63, 0x65, 0x6c, 0x6c, 0x6f,
-  0x64, 0x69, 0x6f, 0x73, 0x68, 0x6f, 0x72, 0x61, 0x63, 0x61, 0x73, 0x69, 0xd0,
-  0xb7, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xbe, 0xd0, 0xbc, 0xd1, 0x80,
-  0xd0, 0xb0, 0xd1, 0x80, 0xd1, 0x83, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0,
-  0xb5, 0xd0, 0xbf, 0xd0, 0xbe, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xb7,
-  0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd0,
-  0xb6, 0xd0, 0xb5, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x85, 0xd0, 0x9d,
-  0xd0, 0xb0, 0xd0, 0xb5, 0xd0, 0xb5, 0xd0, 0xb1, 0xd1, 0x8b, 0xd0, 0xbc, 0xd1,
-  0x8b, 0xd0, 0x92, 0xd1, 0x8b, 0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xb2, 0xd1, 0x8b,
-  0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0x9d, 0xd0, 0xbe, 0xd0, 0xbe, 0xd0, 0xb1, 0xd0,
-  0x9f, 0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xb8, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xa0,
-  0xd0, 0xa4, 0xd0, 0x9d, 0xd0, 0xb5, 0xd0, 0x9c, 0xd1, 0x8b, 0xd1, 0x82, 0xd1,
-  0x8b, 0xd0, 0x9e, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0, 0xb4, 0xd0, 0xb0,
-  0xd0, 0x97, 0xd0, 0xb0, 0xd0, 0x94, 0xd0, 0xb0, 0xd0, 0x9d, 0xd1, 0x83, 0xd0,
-  0x9e, 0xd0, 0xb1, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0x98, 0xd0, 0xb7, 0xd0, 0xb5,
-  0xd0, 0xb9, 0xd0, 0xbd, 0xd1, 0x83, 0xd0, 0xbc, 0xd0, 0xbc, 0xd0, 0xa2, 0xd1,
-  0x8b, 0xd1, 0x83, 0xd0, 0xb6, 0xd9, 0x81, 0xd9, 0x8a, 0xd8, 0xa3, 0xd9, 0x86,
-  0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xb9, 0xd9, 0x83, 0xd9, 0x84, 0xd8,
-  0xa3, 0xd9, 0x88, 0xd8, 0xb1, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x81,
-  0xd9, 0x89, 0xd9, 0x87, 0xd9, 0x88, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x84, 0xd9,
-  0x83, 0xd8, 0xa7, 0xd9, 0x88, 0xd9, 0x84, 0xd9, 0x87, 0xd8, 0xa8, 0xd8, 0xb3,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa5, 0xd9, 0x86, 0xd9, 0x87, 0xd9, 0x8a, 0xd8,
-  0xa3, 0xd9, 0x8a, 0xd9, 0x82, 0xd8, 0xaf, 0xd9, 0x87, 0xd9, 0x84, 0xd8, 0xab,
-  0xd9, 0x85, 0xd8, 0xa8, 0xd9, 0x87, 0xd9, 0x84, 0xd9, 0x88, 0xd9, 0x84, 0xd9,
-  0x8a, 0xd8, 0xa8, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x8a, 0xd8, 0xa8, 0xd9, 0x83,
-  0xd8, 0xb4, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xa3, 0xd9, 0x85, 0xd9,
-  0x86, 0xd8, 0xaa, 0xd8, 0xa8, 0xd9, 0x8a, 0xd9, 0x84, 0xd9, 0x86, 0xd8, 0xad,
-  0xd8, 0xa8, 0xd9, 0x87, 0xd9, 0x85, 0xd9, 0x85, 0xd8, 0xb4, 0xd9, 0x88, 0xd8,
-  0xb4, 0x66, 0x69, 0x72, 0x73, 0x74, 0x76, 0x69, 0x64, 0x65, 0x6f, 0x6c, 0x69,
-  0x67, 0x68, 0x74, 0x77, 0x6f, 0x72, 0x6c, 0x64, 0x6d, 0x65, 0x64, 0x69, 0x61,
-  0x77, 0x68, 0x69, 0x74, 0x65, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x62, 0x6c, 0x61,
-  0x63, 0x6b, 0x72, 0x69, 0x67, 0x68, 0x74, 0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x62,
-  0x6f, 0x6f, 0x6b, 0x73, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x6d, 0x75, 0x73, 0x69,
-  0x63, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x70, 0x6f,
-  0x69, 0x6e, 0x74, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x6c, 0x65, 0x76, 0x65, 0x6c,
-  0x74, 0x61, 0x62, 0x6c, 0x65, 0x62, 0x6f, 0x61, 0x72, 0x64, 0x68, 0x6f, 0x75,
-  0x73, 0x65, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x77, 0x6f, 0x72, 0x6b, 0x73, 0x79,
-  0x65, 0x61, 0x72, 0x73, 0x73, 0x74, 0x61, 0x74, 0x65, 0x74, 0x6f, 0x64, 0x61,
-  0x79, 0x77, 0x61, 0x74, 0x65, 0x72, 0x73, 0x74, 0x61, 0x72, 0x74, 0x73, 0x74,
-  0x79, 0x6c, 0x65, 0x64, 0x65, 0x61, 0x74, 0x68, 0x70, 0x6f, 0x77, 0x65, 0x72,
-  0x70, 0x68, 0x6f, 0x6e, 0x65, 0x6e, 0x69, 0x67, 0x68, 0x74, 0x65, 0x72, 0x72,
-  0x6f, 0x72, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x61, 0x62, 0x6f, 0x75, 0x74, 0x74,
-  0x65, 0x72, 0x6d, 0x73, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x74, 0x6f, 0x6f, 0x6c,
-  0x73, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x74, 0x69,
-  0x6d, 0x65, 0x73, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x77, 0x6f, 0x72, 0x64, 0x73,
-  0x67, 0x61, 0x6d, 0x65, 0x73, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x73, 0x70, 0x61,
-  0x63, 0x65, 0x66, 0x6f, 0x63, 0x75, 0x73, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x6d,
-  0x6f, 0x64, 0x65, 0x6c, 0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x67, 0x75, 0x69, 0x64,
-  0x65, 0x72, 0x61, 0x64, 0x69, 0x6f, 0x73, 0x68, 0x61, 0x72, 0x65, 0x77, 0x6f,
-  0x6d, 0x65, 0x6e, 0x61, 0x67, 0x61, 0x69, 0x6e, 0x6d, 0x6f, 0x6e, 0x65, 0x79,
-  0x69, 0x6d, 0x61, 0x67, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x73, 0x79, 0x6f, 0x75,
-  0x6e, 0x67, 0x6c, 0x69, 0x6e, 0x65, 0x73, 0x6c, 0x61, 0x74, 0x65, 0x72, 0x63,
-  0x6f, 0x6c, 0x6f, 0x72, 0x67, 0x72, 0x65, 0x65, 0x6e, 0x66, 0x72, 0x6f, 0x6e,
-  0x74, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x77, 0x61, 0x74, 0x63, 0x68, 0x66, 0x6f,
-  0x72, 0x63, 0x65, 0x70, 0x72, 0x69, 0x63, 0x65, 0x72, 0x75, 0x6c, 0x65, 0x73,
-  0x62, 0x65, 0x67, 0x69, 0x6e, 0x61, 0x66, 0x74, 0x65, 0x72, 0x76, 0x69, 0x73,
-  0x69, 0x74, 0x69, 0x73, 0x73, 0x75, 0x65, 0x61, 0x72, 0x65, 0x61, 0x73, 0x62,
-  0x65, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x74, 0x6f, 0x74, 0x61,
-  0x6c, 0x68, 0x6f, 0x75, 0x72, 0x73, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x70, 0x72,
-  0x69, 0x6e, 0x74, 0x70, 0x72, 0x65, 0x73, 0x73, 0x62, 0x75, 0x69, 0x6c, 0x74,
-  0x6c, 0x69, 0x6e, 0x6b, 0x73, 0x73, 0x70, 0x65, 0x65, 0x64, 0x73, 0x74, 0x75,
-  0x64, 0x79, 0x74, 0x72, 0x61, 0x64, 0x65, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x73,
-  0x65, 0x6e, 0x73, 0x65, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x68, 0x6f, 0x77,
-  0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x73, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x61, 0x64,
-  0x64, 0x65, 0x64, 0x73, 0x74, 0x69, 0x6c, 0x6c, 0x6d, 0x6f, 0x76, 0x65, 0x64,
-  0x74, 0x61, 0x6b, 0x65, 0x6e, 0x61, 0x62, 0x6f, 0x76, 0x65, 0x66, 0x6c, 0x61,
-  0x73, 0x68, 0x66, 0x69, 0x78, 0x65, 0x64, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x6f,
-  0x74, 0x68, 0x65, 0x72, 0x76, 0x69, 0x65, 0x77, 0x73, 0x63, 0x68, 0x65, 0x63,
-  0x6b, 0x6c, 0x65, 0x67, 0x61, 0x6c, 0x72, 0x69, 0x76, 0x65, 0x72, 0x69, 0x74,
-  0x65, 0x6d, 0x73, 0x71, 0x75, 0x69, 0x63, 0x6b, 0x73, 0x68, 0x61, 0x70, 0x65,
-  0x68, 0x75, 0x6d, 0x61, 0x6e, 0x65, 0x78, 0x69, 0x73, 0x74, 0x67, 0x6f, 0x69,
-  0x6e, 0x67, 0x6d, 0x6f, 0x76, 0x69, 0x65, 0x74, 0x68, 0x69, 0x72, 0x64, 0x62,
-  0x61, 0x73, 0x69, 0x63, 0x70, 0x65, 0x61, 0x63, 0x65, 0x73, 0x74, 0x61, 0x67,
-  0x65, 0x77, 0x69, 0x64, 0x74, 0x68, 0x6c, 0x6f, 0x67, 0x69, 0x6e, 0x69, 0x64,
-  0x65, 0x61, 0x73, 0x77, 0x72, 0x6f, 0x74, 0x65, 0x70, 0x61, 0x67, 0x65, 0x73,
-  0x75, 0x73, 0x65, 0x72, 0x73, 0x64, 0x72, 0x69, 0x76, 0x65, 0x73, 0x74, 0x6f,
-  0x72, 0x65, 0x62, 0x72, 0x65, 0x61, 0x6b, 0x73, 0x6f, 0x75, 0x74, 0x68, 0x76,
-  0x6f, 0x69, 0x63, 0x65, 0x73, 0x69, 0x74, 0x65, 0x73, 0x6d, 0x6f, 0x6e, 0x74,
-  0x68, 0x77, 0x68, 0x65, 0x72, 0x65, 0x62, 0x75, 0x69, 0x6c, 0x64, 0x77, 0x68,
-  0x69, 0x63, 0x68, 0x65, 0x61, 0x72, 0x74, 0x68, 0x66, 0x6f, 0x72, 0x75, 0x6d,
-  0x74, 0x68, 0x72, 0x65, 0x65, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x70, 0x61, 0x72,
-  0x74, 0x79, 0x43, 0x6c, 0x69, 0x63, 0x6b, 0x6c, 0x6f, 0x77, 0x65, 0x72, 0x6c,
-  0x69, 0x76, 0x65, 0x73, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x6c, 0x61, 0x79, 0x65,
-  0x72, 0x65, 0x6e, 0x74, 0x72, 0x79, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x75, 0x73,
-  0x61, 0x67, 0x65, 0x73, 0x6f, 0x75, 0x6e, 0x64, 0x63, 0x6f, 0x75, 0x72, 0x74,
-  0x79, 0x6f, 0x75, 0x72, 0x20, 0x62, 0x69, 0x72, 0x74, 0x68, 0x70, 0x6f, 0x70,
-  0x75, 0x70, 0x74, 0x79, 0x70, 0x65, 0x73, 0x61, 0x70, 0x70, 0x6c, 0x79, 0x49,
-  0x6d, 0x61, 0x67, 0x65, 0x62, 0x65, 0x69, 0x6e, 0x67, 0x75, 0x70, 0x70, 0x65,
-  0x72, 0x6e, 0x6f, 0x74, 0x65, 0x73, 0x65, 0x76, 0x65, 0x72, 0x79, 0x73, 0x68,
-  0x6f, 0x77, 0x73, 0x6d, 0x65, 0x61, 0x6e, 0x73, 0x65, 0x78, 0x74, 0x72, 0x61,
-  0x6d, 0x61, 0x74, 0x63, 0x68, 0x74, 0x72, 0x61, 0x63, 0x6b, 0x6b, 0x6e, 0x6f,
-  0x77, 0x6e, 0x65, 0x61, 0x72, 0x6c, 0x79, 0x62, 0x65, 0x67, 0x61, 0x6e, 0x73,
-  0x75, 0x70, 0x65, 0x72, 0x70, 0x61, 0x70, 0x65, 0x72, 0x6e, 0x6f, 0x72, 0x74,
-  0x68, 0x6c, 0x65, 0x61, 0x72, 0x6e, 0x67, 0x69, 0x76, 0x65, 0x6e, 0x6e, 0x61,
-  0x6d, 0x65, 0x64, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x54, 0x65, 0x72, 0x6d, 0x73,
-  0x70, 0x61, 0x72, 0x74, 0x73, 0x47, 0x72, 0x6f, 0x75, 0x70, 0x62, 0x72, 0x61,
-  0x6e, 0x64, 0x75, 0x73, 0x69, 0x6e, 0x67, 0x77, 0x6f, 0x6d, 0x61, 0x6e, 0x66,
-  0x61, 0x6c, 0x73, 0x65, 0x72, 0x65, 0x61, 0x64, 0x79, 0x61, 0x75, 0x64, 0x69,
-  0x6f, 0x74, 0x61, 0x6b, 0x65, 0x73, 0x77, 0x68, 0x69, 0x6c, 0x65, 0x2e, 0x63,
-  0x6f, 0x6d, 0x2f, 0x6c, 0x69, 0x76, 0x65, 0x64, 0x63, 0x61, 0x73, 0x65, 0x73,
-  0x64, 0x61, 0x69, 0x6c, 0x79, 0x63, 0x68, 0x69, 0x6c, 0x64, 0x67, 0x72, 0x65,
-  0x61, 0x74, 0x6a, 0x75, 0x64, 0x67, 0x65, 0x74, 0x68, 0x6f, 0x73, 0x65, 0x75,
-  0x6e, 0x69, 0x74, 0x73, 0x6e, 0x65, 0x76, 0x65, 0x72, 0x62, 0x72, 0x6f, 0x61,
-  0x64, 0x63, 0x6f, 0x61, 0x73, 0x74, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x61, 0x70,
-  0x70, 0x6c, 0x65, 0x66, 0x69, 0x6c, 0x65, 0x73, 0x63, 0x79, 0x63, 0x6c, 0x65,
-  0x73, 0x63, 0x65, 0x6e, 0x65, 0x70, 0x6c, 0x61, 0x6e, 0x73, 0x63, 0x6c, 0x69,
-  0x63, 0x6b, 0x77, 0x72, 0x69, 0x74, 0x65, 0x71, 0x75, 0x65, 0x65, 0x6e, 0x70,
-  0x69, 0x65, 0x63, 0x65, 0x65, 0x6d, 0x61, 0x69, 0x6c, 0x66, 0x72, 0x61, 0x6d,
-  0x65, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x70, 0x68, 0x6f, 0x74, 0x6f, 0x6c, 0x69,
-  0x6d, 0x69, 0x74, 0x63, 0x61, 0x63, 0x68, 0x65, 0x63, 0x69, 0x76, 0x69, 0x6c,
-  0x73, 0x63, 0x61, 0x6c, 0x65, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x74, 0x68, 0x65,
-  0x6d, 0x65, 0x74, 0x68, 0x65, 0x72, 0x65, 0x74, 0x6f, 0x75, 0x63, 0x68, 0x62,
-  0x6f, 0x75, 0x6e, 0x64, 0x72, 0x6f, 0x79, 0x61, 0x6c, 0x61, 0x73, 0x6b, 0x65,
-  0x64, 0x77, 0x68, 0x6f, 0x6c, 0x65, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x73, 0x74,
-  0x6f, 0x63, 0x6b, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x66, 0x61, 0x69, 0x74, 0x68,
-  0x68, 0x65, 0x61, 0x72, 0x74, 0x65, 0x6d, 0x70, 0x74, 0x79, 0x6f, 0x66, 0x66,
-  0x65, 0x72, 0x73, 0x63, 0x6f, 0x70, 0x65, 0x6f, 0x77, 0x6e, 0x65, 0x64, 0x6d,
-  0x69, 0x67, 0x68, 0x74, 0x61, 0x6c, 0x62, 0x75, 0x6d, 0x74, 0x68, 0x69, 0x6e,
-  0x6b, 0x62, 0x6c, 0x6f, 0x6f, 0x64, 0x61, 0x72, 0x72, 0x61, 0x79, 0x6d, 0x61,
-  0x6a, 0x6f, 0x72, 0x74, 0x72, 0x75, 0x73, 0x74, 0x63, 0x61, 0x6e, 0x6f, 0x6e,
-  0x75, 0x6e, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x76, 0x61, 0x6c,
-  0x69, 0x64, 0x73, 0x74, 0x6f, 0x6e, 0x65, 0x53, 0x74, 0x79, 0x6c, 0x65, 0x4c,
-  0x6f, 0x67, 0x69, 0x6e, 0x68, 0x61, 0x70, 0x70, 0x79, 0x6f, 0x63, 0x63, 0x75,
-  0x72, 0x6c, 0x65, 0x66, 0x74, 0x3a, 0x66, 0x72, 0x65, 0x73, 0x68, 0x71, 0x75,
-  0x69, 0x74, 0x65, 0x66, 0x69, 0x6c, 0x6d, 0x73, 0x67, 0x72, 0x61, 0x64, 0x65,
-  0x6e, 0x65, 0x65, 0x64, 0x73, 0x75, 0x72, 0x62, 0x61, 0x6e, 0x66, 0x69, 0x67,
-  0x68, 0x74, 0x62, 0x61, 0x73, 0x69, 0x73, 0x68, 0x6f, 0x76, 0x65, 0x72, 0x61,
-  0x75, 0x74, 0x6f, 0x3b, 0x72, 0x6f, 0x75, 0x74, 0x65, 0x2e, 0x68, 0x74, 0x6d,
-  0x6c, 0x6d, 0x69, 0x78, 0x65, 0x64, 0x66, 0x69, 0x6e, 0x61, 0x6c, 0x59, 0x6f,
-  0x75, 0x72, 0x20, 0x73, 0x6c, 0x69, 0x64, 0x65, 0x74, 0x6f, 0x70, 0x69, 0x63,
-  0x62, 0x72, 0x6f, 0x77, 0x6e, 0x61, 0x6c, 0x6f, 0x6e, 0x65, 0x64, 0x72, 0x61,
-  0x77, 0x6e, 0x73, 0x70, 0x6c, 0x69, 0x74, 0x72, 0x65, 0x61, 0x63, 0x68, 0x52,
-  0x69, 0x67, 0x68, 0x74, 0x64, 0x61, 0x74, 0x65, 0x73, 0x6d, 0x61, 0x72, 0x63,
-  0x68, 0x71, 0x75, 0x6f, 0x74, 0x65, 0x67, 0x6f, 0x6f, 0x64, 0x73, 0x4c, 0x69,
-  0x6e, 0x6b, 0x73, 0x64, 0x6f, 0x75, 0x62, 0x74, 0x61, 0x73, 0x79, 0x6e, 0x63,
-  0x74, 0x68, 0x75, 0x6d, 0x62, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x63, 0x68, 0x69,
-  0x65, 0x66, 0x79, 0x6f, 0x75, 0x74, 0x68, 0x6e, 0x6f, 0x76, 0x65, 0x6c, 0x31,
-  0x30, 0x70, 0x78, 0x3b, 0x73, 0x65, 0x72, 0x76, 0x65, 0x75, 0x6e, 0x74, 0x69,
-  0x6c, 0x68, 0x61, 0x6e, 0x64, 0x73, 0x43, 0x68, 0x65, 0x63, 0x6b, 0x53, 0x70,
-  0x61, 0x63, 0x65, 0x71, 0x75, 0x65, 0x72, 0x79, 0x6a, 0x61, 0x6d, 0x65, 0x73,
-  0x65, 0x71, 0x75, 0x61, 0x6c, 0x74, 0x77, 0x69, 0x63, 0x65, 0x30, 0x2c, 0x30,
-  0x30, 0x30, 0x53, 0x74, 0x61, 0x72, 0x74, 0x70, 0x61, 0x6e, 0x65, 0x6c, 0x73,
-  0x6f, 0x6e, 0x67, 0x73, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x69, 0x67, 0x68,
-  0x74, 0x73, 0x68, 0x69, 0x66, 0x74, 0x77, 0x6f, 0x72, 0x74, 0x68, 0x70, 0x6f,
-  0x73, 0x74, 0x73, 0x6c, 0x65, 0x61, 0x64, 0x73, 0x77, 0x65, 0x65, 0x6b, 0x73,
-  0x61, 0x76, 0x6f, 0x69, 0x64, 0x74, 0x68, 0x65, 0x73, 0x65, 0x6d, 0x69, 0x6c,
-  0x65, 0x73, 0x70, 0x6c, 0x61, 0x6e, 0x65, 0x73, 0x6d, 0x61, 0x72, 0x74, 0x61,
-  0x6c, 0x70, 0x68, 0x61, 0x70, 0x6c, 0x61, 0x6e, 0x74, 0x6d, 0x61, 0x72, 0x6b,
-  0x73, 0x72, 0x61, 0x74, 0x65, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x73, 0x63, 0x6c,
-  0x61, 0x69, 0x6d, 0x73, 0x61, 0x6c, 0x65, 0x73, 0x74, 0x65, 0x78, 0x74, 0x73,
-  0x73, 0x74, 0x61, 0x72, 0x73, 0x77, 0x72, 0x6f, 0x6e, 0x67, 0x3c, 0x2f, 0x68,
-  0x33, 0x3e, 0x74, 0x68, 0x69, 0x6e, 0x67, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x6d,
-  0x75, 0x6c, 0x74, 0x69, 0x68, 0x65, 0x61, 0x72, 0x64, 0x50, 0x6f, 0x77, 0x65,
-  0x72, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x74, 0x6f, 0x6b, 0x65, 0x6e, 0x73, 0x6f,
-  0x6c, 0x69, 0x64, 0x28, 0x74, 0x68, 0x69, 0x73, 0x62, 0x72, 0x69, 0x6e, 0x67,
-  0x73, 0x68, 0x69, 0x70, 0x73, 0x73, 0x74, 0x61, 0x66, 0x66, 0x74, 0x72, 0x69,
-  0x65, 0x64, 0x63, 0x61, 0x6c, 0x6c, 0x73, 0x66, 0x75, 0x6c, 0x6c, 0x79, 0x66,
-  0x61, 0x63, 0x74, 0x73, 0x61, 0x67, 0x65, 0x6e, 0x74, 0x54, 0x68, 0x69, 0x73,
-  0x20, 0x2f, 0x2f, 0x2d, 0x2d, 0x3e, 0x61, 0x64, 0x6d, 0x69, 0x6e, 0x65, 0x67,
-  0x79, 0x70, 0x74, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x31, 0x35, 0x70, 0x78, 0x3b,
-  0x45, 0x6d, 0x61, 0x69, 0x6c, 0x74, 0x72, 0x75, 0x65, 0x22, 0x63, 0x72, 0x6f,
-  0x73, 0x73, 0x73, 0x70, 0x65, 0x6e, 0x74, 0x62, 0x6c, 0x6f, 0x67, 0x73, 0x62,
-  0x6f, 0x78, 0x22, 0x3e, 0x6e, 0x6f, 0x74, 0x65, 0x64, 0x6c, 0x65, 0x61, 0x76,
-  0x65, 0x63, 0x68, 0x69, 0x6e, 0x61, 0x73, 0x69, 0x7a, 0x65, 0x73, 0x67, 0x75,
-  0x65, 0x73, 0x74, 0x3c, 0x2f, 0x68, 0x34, 0x3e, 0x72, 0x6f, 0x62, 0x6f, 0x74,
-  0x68, 0x65, 0x61, 0x76, 0x79, 0x74, 0x72, 0x75, 0x65, 0x2c, 0x73, 0x65, 0x76,
-  0x65, 0x6e, 0x67, 0x72, 0x61, 0x6e, 0x64, 0x63, 0x72, 0x69, 0x6d, 0x65, 0x73,
-  0x69, 0x67, 0x6e, 0x73, 0x61, 0x77, 0x61, 0x72, 0x65, 0x64, 0x61, 0x6e, 0x63,
-  0x65, 0x70, 0x68, 0x61, 0x73, 0x65, 0x3e, 0x3c, 0x21, 0x2d, 0x2d, 0x65, 0x6e,
-  0x5f, 0x55, 0x53, 0x26, 0x23, 0x33, 0x39, 0x3b, 0x32, 0x30, 0x30, 0x70, 0x78,
-  0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6e, 0x65, 0x6e, 0x6a,
-  0x6f, 0x79, 0x61, 0x6a, 0x61, 0x78, 0x2e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73,
-  0x6d, 0x69, 0x74, 0x68, 0x55, 0x2e, 0x53, 0x2e, 0x20, 0x68, 0x6f, 0x6c, 0x64,
-  0x73, 0x70, 0x65, 0x74, 0x65, 0x72, 0x69, 0x6e, 0x64, 0x69, 0x61, 0x6e, 0x61,
-  0x76, 0x22, 0x3e, 0x63, 0x68, 0x61, 0x69, 0x6e, 0x73, 0x63, 0x6f, 0x72, 0x65,
-  0x63, 0x6f, 0x6d, 0x65, 0x73, 0x64, 0x6f, 0x69, 0x6e, 0x67, 0x70, 0x72, 0x69,
-  0x6f, 0x72, 0x53, 0x68, 0x61, 0x72, 0x65, 0x31, 0x39, 0x39, 0x30, 0x73, 0x72,
-  0x6f, 0x6d, 0x61, 0x6e, 0x6c, 0x69, 0x73, 0x74, 0x73, 0x6a, 0x61, 0x70, 0x61,
-  0x6e, 0x66, 0x61, 0x6c, 0x6c, 0x73, 0x74, 0x72, 0x69, 0x61, 0x6c, 0x6f, 0x77,
-  0x6e, 0x65, 0x72, 0x61, 0x67, 0x72, 0x65, 0x65, 0x3c, 0x2f, 0x68, 0x32, 0x3e,
-  0x61, 0x62, 0x75, 0x73, 0x65, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x6f, 0x70, 0x65,
-  0x72, 0x61, 0x22, 0x2d, 0x2f, 0x2f, 0x57, 0x63, 0x61, 0x72, 0x64, 0x73, 0x68,
-  0x69, 0x6c, 0x6c, 0x73, 0x74, 0x65, 0x61, 0x6d, 0x73, 0x50, 0x68, 0x6f, 0x74,
-  0x6f, 0x74, 0x72, 0x75, 0x74, 0x68, 0x63, 0x6c, 0x65, 0x61, 0x6e, 0x2e, 0x70,
-  0x68, 0x70, 0x3f, 0x73, 0x61, 0x69, 0x6e, 0x74, 0x6d, 0x65, 0x74, 0x61, 0x6c,
-  0x6c, 0x6f, 0x75, 0x69, 0x73, 0x6d, 0x65, 0x61, 0x6e, 0x74, 0x70, 0x72, 0x6f,
-  0x6f, 0x66, 0x62, 0x72, 0x69, 0x65, 0x66, 0x72, 0x6f, 0x77, 0x22, 0x3e, 0x67,
-  0x65, 0x6e, 0x72, 0x65, 0x74, 0x72, 0x75, 0x63, 0x6b, 0x6c, 0x6f, 0x6f, 0x6b,
-  0x73, 0x56, 0x61, 0x6c, 0x75, 0x65, 0x46, 0x72, 0x61, 0x6d, 0x65, 0x2e, 0x6e,
-  0x65, 0x74, 0x2f, 0x2d, 0x2d, 0x3e, 0x0a, 0x3c, 0x74, 0x72, 0x79, 0x20, 0x7b,
-  0x0a, 0x76, 0x61, 0x72, 0x20, 0x6d, 0x61, 0x6b, 0x65, 0x73, 0x63, 0x6f, 0x73,
-  0x74, 0x73, 0x70, 0x6c, 0x61, 0x69, 0x6e, 0x61, 0x64, 0x75, 0x6c, 0x74, 0x71,
-  0x75, 0x65, 0x73, 0x74, 0x74, 0x72, 0x61, 0x69, 0x6e, 0x6c, 0x61, 0x62, 0x6f,
-  0x72, 0x68, 0x65, 0x6c, 0x70, 0x73, 0x63, 0x61, 0x75, 0x73, 0x65, 0x6d, 0x61,
-  0x67, 0x69, 0x63, 0x6d, 0x6f, 0x74, 0x6f, 0x72, 0x74, 0x68, 0x65, 0x69, 0x72,
-  0x32, 0x35, 0x30, 0x70, 0x78, 0x6c, 0x65, 0x61, 0x73, 0x74, 0x73, 0x74, 0x65,
-  0x70, 0x73, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x63, 0x6f, 0x75, 0x6c, 0x64, 0x67,
-  0x6c, 0x61, 0x73, 0x73, 0x73, 0x69, 0x64, 0x65, 0x73, 0x66, 0x75, 0x6e, 0x64,
-  0x73, 0x68, 0x6f, 0x74, 0x65, 0x6c, 0x61, 0x77, 0x61, 0x72, 0x64, 0x6d, 0x6f,
-  0x75, 0x74, 0x68, 0x6d, 0x6f, 0x76, 0x65, 0x73, 0x70, 0x61, 0x72, 0x69, 0x73,
-  0x67, 0x69, 0x76, 0x65, 0x73, 0x64, 0x75, 0x74, 0x63, 0x68, 0x74, 0x65, 0x78,
-  0x61, 0x73, 0x66, 0x72, 0x75, 0x69, 0x74, 0x6e, 0x75, 0x6c, 0x6c, 0x2c, 0x7c,
-  0x7c, 0x5b, 0x5d, 0x3b, 0x74, 0x6f, 0x70, 0x22, 0x3e, 0x0a, 0x3c, 0x21, 0x2d,
-  0x2d, 0x50, 0x4f, 0x53, 0x54, 0x22, 0x6f, 0x63, 0x65, 0x61, 0x6e, 0x3c, 0x62,
-  0x72, 0x2f, 0x3e, 0x66, 0x6c, 0x6f, 0x6f, 0x72, 0x73, 0x70, 0x65, 0x61, 0x6b,
-  0x64, 0x65, 0x70, 0x74, 0x68, 0x20, 0x73, 0x69, 0x7a, 0x65, 0x62, 0x61, 0x6e,
-  0x6b, 0x73, 0x63, 0x61, 0x74, 0x63, 0x68, 0x63, 0x68, 0x61, 0x72, 0x74, 0x32,
-  0x30, 0x70, 0x78, 0x3b, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x64, 0x65, 0x61, 0x6c,
-  0x73, 0x77, 0x6f, 0x75, 0x6c, 0x64, 0x35, 0x30, 0x70, 0x78, 0x3b, 0x75, 0x72,
-  0x6c, 0x3d, 0x22, 0x70, 0x61, 0x72, 0x6b, 0x73, 0x6d, 0x6f, 0x75, 0x73, 0x65,
-  0x4d, 0x6f, 0x73, 0x74, 0x20, 0x2e, 0x2e, 0x2e, 0x3c, 0x2f, 0x61, 0x6d, 0x6f,
-  0x6e, 0x67, 0x62, 0x72, 0x61, 0x69, 0x6e, 0x62, 0x6f, 0x64, 0x79, 0x20, 0x6e,
-  0x6f, 0x6e, 0x65, 0x3b, 0x62, 0x61, 0x73, 0x65, 0x64, 0x63, 0x61, 0x72, 0x72,
-  0x79, 0x64, 0x72, 0x61, 0x66, 0x74, 0x72, 0x65, 0x66, 0x65, 0x72, 0x70, 0x61,
-  0x67, 0x65, 0x5f, 0x68, 0x6f, 0x6d, 0x65, 0x2e, 0x6d, 0x65, 0x74, 0x65, 0x72,
-  0x64, 0x65, 0x6c, 0x61, 0x79, 0x64, 0x72, 0x65, 0x61, 0x6d, 0x70, 0x72, 0x6f,
-  0x76, 0x65, 0x6a, 0x6f, 0x69, 0x6e, 0x74, 0x3c, 0x2f, 0x74, 0x72, 0x3e, 0x64,
-  0x72, 0x75, 0x67, 0x73, 0x3c, 0x21, 0x2d, 0x2d, 0x20, 0x61, 0x70, 0x72, 0x69,
-  0x6c, 0x69, 0x64, 0x65, 0x61, 0x6c, 0x61, 0x6c, 0x6c, 0x65, 0x6e, 0x65, 0x78,
-  0x61, 0x63, 0x74, 0x66, 0x6f, 0x72, 0x74, 0x68, 0x63, 0x6f, 0x64, 0x65, 0x73,
-  0x6c, 0x6f, 0x67, 0x69, 0x63, 0x56, 0x69, 0x65, 0x77, 0x20, 0x73, 0x65, 0x65,
-  0x6d, 0x73, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x70, 0x6f, 0x72, 0x74, 0x73, 0x20,
-  0x28, 0x32, 0x30, 0x30, 0x73, 0x61, 0x76, 0x65, 0x64, 0x5f, 0x6c, 0x69, 0x6e,
-  0x6b, 0x67, 0x6f, 0x61, 0x6c, 0x73, 0x67, 0x72, 0x61, 0x6e, 0x74, 0x67, 0x72,
-  0x65, 0x65, 0x6b, 0x68, 0x6f, 0x6d, 0x65, 0x73, 0x72, 0x69, 0x6e, 0x67, 0x73,
-  0x72, 0x61, 0x74, 0x65, 0x64, 0x33, 0x30, 0x70, 0x78, 0x3b, 0x77, 0x68, 0x6f,
-  0x73, 0x65, 0x70, 0x61, 0x72, 0x73, 0x65, 0x28, 0x29, 0x3b, 0x22, 0x20, 0x42,
-  0x6c, 0x6f, 0x63, 0x6b, 0x6c, 0x69, 0x6e, 0x75, 0x78, 0x6a, 0x6f, 0x6e, 0x65,
-  0x73, 0x70, 0x69, 0x78, 0x65, 0x6c, 0x27, 0x29, 0x3b, 0x22, 0x3e, 0x29, 0x3b,
-  0x69, 0x66, 0x28, 0x2d, 0x6c, 0x65, 0x66, 0x74, 0x64, 0x61, 0x76, 0x69, 0x64,
-  0x68, 0x6f, 0x72, 0x73, 0x65, 0x46, 0x6f, 0x63, 0x75, 0x73, 0x72, 0x61, 0x69,
-  0x73, 0x65, 0x62, 0x6f, 0x78, 0x65, 0x73, 0x54, 0x72, 0x61, 0x63, 0x6b, 0x65,
-  0x6d, 0x65, 0x6e, 0x74, 0x3c, 0x2f, 0x65, 0x6d, 0x3e, 0x62, 0x61, 0x72, 0x22,
-  0x3e, 0x2e, 0x73, 0x72, 0x63, 0x3d, 0x74, 0x6f, 0x77, 0x65, 0x72, 0x61, 0x6c,
-  0x74, 0x3d, 0x22, 0x63, 0x61, 0x62, 0x6c, 0x65, 0x68, 0x65, 0x6e, 0x72, 0x79,
-  0x32, 0x34, 0x70, 0x78, 0x3b, 0x73, 0x65, 0x74, 0x75, 0x70, 0x69, 0x74, 0x61,
-  0x6c, 0x79, 0x73, 0x68, 0x61, 0x72, 0x70, 0x6d, 0x69, 0x6e, 0x6f, 0x72, 0x74,
-  0x61, 0x73, 0x74, 0x65, 0x77, 0x61, 0x6e, 0x74, 0x73, 0x74, 0x68, 0x69, 0x73,
-  0x2e, 0x72, 0x65, 0x73, 0x65, 0x74, 0x77, 0x68, 0x65, 0x65, 0x6c, 0x67, 0x69,
-  0x72, 0x6c, 0x73, 0x2f, 0x63, 0x73, 0x73, 0x2f, 0x31, 0x30, 0x30, 0x25, 0x3b,
-  0x63, 0x6c, 0x75, 0x62, 0x73, 0x73, 0x74, 0x75, 0x66, 0x66, 0x62, 0x69, 0x62,
-  0x6c, 0x65, 0x76, 0x6f, 0x74, 0x65, 0x73, 0x20, 0x31, 0x30, 0x30, 0x30, 0x6b,
-  0x6f, 0x72, 0x65, 0x61, 0x7d, 0x29, 0x3b, 0x0d, 0x0a, 0x62, 0x61, 0x6e, 0x64,
-  0x73, 0x71, 0x75, 0x65, 0x75, 0x65, 0x3d, 0x20, 0x7b, 0x7d, 0x3b, 0x38, 0x30,
-  0x70, 0x78, 0x3b, 0x63, 0x6b, 0x69, 0x6e, 0x67, 0x7b, 0x0d, 0x0a, 0x09, 0x09,
-  0x61, 0x68, 0x65, 0x61, 0x64, 0x63, 0x6c, 0x6f, 0x63, 0x6b, 0x69, 0x72, 0x69,
-  0x73, 0x68, 0x6c, 0x69, 0x6b, 0x65, 0x20, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x73,
-  0x74, 0x61, 0x74, 0x73, 0x46, 0x6f, 0x72, 0x6d, 0x22, 0x79, 0x61, 0x68, 0x6f,
-  0x6f, 0x29, 0x5b, 0x30, 0x5d, 0x3b, 0x41, 0x62, 0x6f, 0x75, 0x74, 0x66, 0x69,
-  0x6e, 0x64, 0x73, 0x3c, 0x2f, 0x68, 0x31, 0x3e, 0x64, 0x65, 0x62, 0x75, 0x67,
-  0x74, 0x61, 0x73, 0x6b, 0x73, 0x55, 0x52, 0x4c, 0x20, 0x3d, 0x63, 0x65, 0x6c,
-  0x6c, 0x73, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x31, 0x32, 0x70, 0x78, 0x3b, 0x70,
-  0x72, 0x69, 0x6d, 0x65, 0x74, 0x65, 0x6c, 0x6c, 0x73, 0x74, 0x75, 0x72, 0x6e,
-  0x73, 0x30, 0x78, 0x36, 0x30, 0x30, 0x2e, 0x6a, 0x70, 0x67, 0x22, 0x73, 0x70,
-  0x61, 0x69, 0x6e, 0x62, 0x65, 0x61, 0x63, 0x68, 0x74, 0x61, 0x78, 0x65, 0x73,
-  0x6d, 0x69, 0x63, 0x72, 0x6f, 0x61, 0x6e, 0x67, 0x65, 0x6c, 0x2d, 0x2d, 0x3e,
-  0x3c, 0x2f, 0x67, 0x69, 0x66, 0x74, 0x73, 0x73, 0x74, 0x65, 0x76, 0x65, 0x2d,
-  0x6c, 0x69, 0x6e, 0x6b, 0x62, 0x6f, 0x64, 0x79, 0x2e, 0x7d, 0x29, 0x3b, 0x0a,
-  0x09, 0x6d, 0x6f, 0x75, 0x6e, 0x74, 0x20, 0x28, 0x31, 0x39, 0x39, 0x46, 0x41,
-  0x51, 0x3c, 0x2f, 0x72, 0x6f, 0x67, 0x65, 0x72, 0x66, 0x72, 0x61, 0x6e, 0x6b,
-  0x43, 0x6c, 0x61, 0x73, 0x73, 0x32, 0x38, 0x70, 0x78, 0x3b, 0x66, 0x65, 0x65,
-  0x64, 0x73, 0x3c, 0x68, 0x31, 0x3e, 0x3c, 0x73, 0x63, 0x6f, 0x74, 0x74, 0x74,
-  0x65, 0x73, 0x74, 0x73, 0x32, 0x32, 0x70, 0x78, 0x3b, 0x64, 0x72, 0x69, 0x6e,
-  0x6b, 0x29, 0x20, 0x7c, 0x7c, 0x20, 0x6c, 0x65, 0x77, 0x69, 0x73, 0x73, 0x68,
-  0x61, 0x6c, 0x6c, 0x23, 0x30, 0x33, 0x39, 0x3b, 0x20, 0x66, 0x6f, 0x72, 0x20,
-  0x6c, 0x6f, 0x76, 0x65, 0x64, 0x77, 0x61, 0x73, 0x74, 0x65, 0x30, 0x30, 0x70,
-  0x78, 0x3b, 0x6a, 0x61, 0x3a, 0xe3, 0x82, 0x73, 0x69, 0x6d, 0x6f, 0x6e, 0x3c,
-  0x66, 0x6f, 0x6e, 0x74, 0x72, 0x65, 0x70, 0x6c, 0x79, 0x6d, 0x65, 0x65, 0x74,
-  0x73, 0x75, 0x6e, 0x74, 0x65, 0x72, 0x63, 0x68, 0x65, 0x61, 0x70, 0x74, 0x69,
-  0x67, 0x68, 0x74, 0x42, 0x72, 0x61, 0x6e, 0x64, 0x29, 0x20, 0x21, 0x3d, 0x20,
-  0x64, 0x72, 0x65, 0x73, 0x73, 0x63, 0x6c, 0x69, 0x70, 0x73, 0x72, 0x6f, 0x6f,
-  0x6d, 0x73, 0x6f, 0x6e, 0x6b, 0x65, 0x79, 0x6d, 0x6f, 0x62, 0x69, 0x6c, 0x6d,
-  0x61, 0x69, 0x6e, 0x2e, 0x4e, 0x61, 0x6d, 0x65, 0x20, 0x70, 0x6c, 0x61, 0x74,
-  0x65, 0x66, 0x75, 0x6e, 0x6e, 0x79, 0x74, 0x72, 0x65, 0x65, 0x73, 0x63, 0x6f,
-  0x6d, 0x2f, 0x22, 0x31, 0x2e, 0x6a, 0x70, 0x67, 0x77, 0x6d, 0x6f, 0x64, 0x65,
-  0x70, 0x61, 0x72, 0x61, 0x6d, 0x53, 0x54, 0x41, 0x52, 0x54, 0x6c, 0x65, 0x66,
-  0x74, 0x20, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x2c, 0x20, 0x32, 0x30, 0x31, 0x29,
-  0x3b, 0x0a, 0x7d, 0x0a, 0x66, 0x6f, 0x72, 0x6d, 0x2e, 0x76, 0x69, 0x72, 0x75,
-  0x73, 0x63, 0x68, 0x61, 0x69, 0x72, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x77, 0x6f,
-  0x72, 0x73, 0x74, 0x50, 0x61, 0x67, 0x65, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e,
-  0x70, 0x61, 0x74, 0x63, 0x68, 0x3c, 0x21, 0x2d, 0x2d, 0x0a, 0x6f, 0x2d, 0x63,
-  0x61, 0x63, 0x66, 0x69, 0x72, 0x6d, 0x73, 0x74, 0x6f, 0x75, 0x72, 0x73, 0x2c,
-  0x30, 0x30, 0x30, 0x20, 0x61, 0x73, 0x69, 0x61, 0x6e, 0x69, 0x2b, 0x2b, 0x29,
-  0x7b, 0x61, 0x64, 0x6f, 0x62, 0x65, 0x27, 0x29, 0x5b, 0x30, 0x5d, 0x69, 0x64,
-  0x3d, 0x31, 0x30, 0x62, 0x6f, 0x74, 0x68, 0x3b, 0x6d, 0x65, 0x6e, 0x75, 0x20,
-  0x2e, 0x32, 0x2e, 0x6d, 0x69, 0x2e, 0x70, 0x6e, 0x67, 0x22, 0x6b, 0x65, 0x76,
-  0x69, 0x6e, 0x63, 0x6f, 0x61, 0x63, 0x68, 0x43, 0x68, 0x69, 0x6c, 0x64, 0x62,
-  0x72, 0x75, 0x63, 0x65, 0x32, 0x2e, 0x6a, 0x70, 0x67, 0x55, 0x52, 0x4c, 0x29,
-  0x2b, 0x2e, 0x6a, 0x70, 0x67, 0x7c, 0x73, 0x75, 0x69, 0x74, 0x65, 0x73, 0x6c,
-  0x69, 0x63, 0x65, 0x68, 0x61, 0x72, 0x72, 0x79, 0x31, 0x32, 0x30, 0x22, 0x20,
-  0x73, 0x77, 0x65, 0x65, 0x74, 0x74, 0x72, 0x3e, 0x0d, 0x0a, 0x6e, 0x61, 0x6d,
-  0x65, 0x3d, 0x64, 0x69, 0x65, 0x67, 0x6f, 0x70, 0x61, 0x67, 0x65, 0x20, 0x73,
-  0x77, 0x69, 0x73, 0x73, 0x2d, 0x2d, 0x3e, 0x0a, 0x0a, 0x23, 0x66, 0x66, 0x66,
-  0x3b, 0x22, 0x3e, 0x4c, 0x6f, 0x67, 0x2e, 0x63, 0x6f, 0x6d, 0x22, 0x74, 0x72,
-  0x65, 0x61, 0x74, 0x73, 0x68, 0x65, 0x65, 0x74, 0x29, 0x20, 0x26, 0x26, 0x20,
-  0x31, 0x34, 0x70, 0x78, 0x3b, 0x73, 0x6c, 0x65, 0x65, 0x70, 0x6e, 0x74, 0x65,
-  0x6e, 0x74, 0x66, 0x69, 0x6c, 0x65, 0x64, 0x6a, 0x61, 0x3a, 0xe3, 0x83, 0x69,
-  0x64, 0x3d, 0x22, 0x63, 0x4e, 0x61, 0x6d, 0x65, 0x22, 0x77, 0x6f, 0x72, 0x73,
-  0x65, 0x73, 0x68, 0x6f, 0x74, 0x73, 0x2d, 0x62, 0x6f, 0x78, 0x2d, 0x64, 0x65,
-  0x6c, 0x74, 0x61, 0x0a, 0x26, 0x6c, 0x74, 0x3b, 0x62, 0x65, 0x61, 0x72, 0x73,
-  0x3a, 0x34, 0x38, 0x5a, 0x3c, 0x64, 0x61, 0x74, 0x61, 0x2d, 0x72, 0x75, 0x72,
-  0x61, 0x6c, 0x3c, 0x2f, 0x61, 0x3e, 0x20, 0x73, 0x70, 0x65, 0x6e, 0x64, 0x62,
-  0x61, 0x6b, 0x65, 0x72, 0x73, 0x68, 0x6f, 0x70, 0x73, 0x3d, 0x20, 0x22, 0x22,
-  0x3b, 0x70, 0x68, 0x70, 0x22, 0x3e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x31, 0x33,
-  0x70, 0x78, 0x3b, 0x62, 0x72, 0x69, 0x61, 0x6e, 0x68, 0x65, 0x6c, 0x6c, 0x6f,
-  0x73, 0x69, 0x7a, 0x65, 0x3d, 0x6f, 0x3d, 0x25, 0x32, 0x46, 0x20, 0x6a, 0x6f,
-  0x69, 0x6e, 0x6d, 0x61, 0x79, 0x62, 0x65, 0x3c, 0x69, 0x6d, 0x67, 0x20, 0x69,
-  0x6d, 0x67, 0x22, 0x3e, 0x2c, 0x20, 0x66, 0x6a, 0x73, 0x69, 0x6d, 0x67, 0x22,
-  0x20, 0x22, 0x29, 0x5b, 0x30, 0x5d, 0x4d, 0x54, 0x6f, 0x70, 0x42, 0x54, 0x79,
-  0x70, 0x65, 0x22, 0x6e, 0x65, 0x77, 0x6c, 0x79, 0x44, 0x61, 0x6e, 0x73, 0x6b,
-  0x63, 0x7a, 0x65, 0x63, 0x68, 0x74, 0x72, 0x61, 0x69, 0x6c, 0x6b, 0x6e, 0x6f,
-  0x77, 0x73, 0x3c, 0x2f, 0x68, 0x35, 0x3e, 0x66, 0x61, 0x71, 0x22, 0x3e, 0x7a,
-  0x68, 0x2d, 0x63, 0x6e, 0x31, 0x30, 0x29, 0x3b, 0x0a, 0x2d, 0x31, 0x22, 0x29,
-  0x3b, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x62, 0x6c, 0x75, 0x65, 0x73, 0x74, 0x72,
-  0x75, 0x6c, 0x79, 0x64, 0x61, 0x76, 0x69, 0x73, 0x2e, 0x6a, 0x73, 0x27, 0x3b,
-  0x3e, 0x0d, 0x0a, 0x3c, 0x21, 0x73, 0x74, 0x65, 0x65, 0x6c, 0x20, 0x79, 0x6f,
-  0x75, 0x20, 0x68, 0x32, 0x3e, 0x0d, 0x0a, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x6a,
-  0x65, 0x73, 0x75, 0x73, 0x31, 0x30, 0x30, 0x25, 0x20, 0x6d, 0x65, 0x6e, 0x75,
-  0x2e, 0x0d, 0x0a, 0x09, 0x0d, 0x0a, 0x77, 0x61, 0x6c, 0x65, 0x73, 0x72, 0x69,
-  0x73, 0x6b, 0x73, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x64, 0x64, 0x69, 0x6e, 0x67,
-  0x62, 0x2d, 0x6c, 0x69, 0x6b, 0x74, 0x65, 0x61, 0x63, 0x68, 0x67, 0x69, 0x66,
-  0x22, 0x20, 0x76, 0x65, 0x67, 0x61, 0x73, 0x64, 0x61, 0x6e, 0x73, 0x6b, 0x65,
-  0x65, 0x73, 0x74, 0x69, 0x73, 0x68, 0x71, 0x69, 0x70, 0x73, 0x75, 0x6f, 0x6d,
-  0x69, 0x73, 0x6f, 0x62, 0x72, 0x65, 0x64, 0x65, 0x73, 0x64, 0x65, 0x65, 0x6e,
-  0x74, 0x72, 0x65, 0x74, 0x6f, 0x64, 0x6f, 0x73, 0x70, 0x75, 0x65, 0x64, 0x65,
-  0x61, 0xc3, 0xb1, 0x6f, 0x73, 0x65, 0x73, 0x74, 0xc3, 0xa1, 0x74, 0x69, 0x65,
-  0x6e, 0x65, 0x68, 0x61, 0x73, 0x74, 0x61, 0x6f, 0x74, 0x72, 0x6f, 0x73, 0x70,
-  0x61, 0x72, 0x74, 0x65, 0x64, 0x6f, 0x6e, 0x64, 0x65, 0x6e, 0x75, 0x65, 0x76,
-  0x6f, 0x68, 0x61, 0x63, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x6d, 0x69,
-  0x73, 0x6d, 0x6f, 0x6d, 0x65, 0x6a, 0x6f, 0x72, 0x6d, 0x75, 0x6e, 0x64, 0x6f,
-  0x61, 0x71, 0x75, 0xc3, 0xad, 0x64, 0xc3, 0xad, 0x61, 0x73, 0x73, 0xc3, 0xb3,
-  0x6c, 0x6f, 0x61, 0x79, 0x75, 0x64, 0x61, 0x66, 0x65, 0x63, 0x68, 0x61, 0x74,
-  0x6f, 0x64, 0x61, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x6f, 0x6d, 0x65, 0x6e, 0x6f,
-  0x73, 0x64, 0x61, 0x74, 0x6f, 0x73, 0x6f, 0x74, 0x72, 0x61, 0x73, 0x73, 0x69,
-  0x74, 0x69, 0x6f, 0x6d, 0x75, 0x63, 0x68, 0x6f, 0x61, 0x68, 0x6f, 0x72, 0x61,
-  0x6c, 0x75, 0x67, 0x61, 0x72, 0x6d, 0x61, 0x79, 0x6f, 0x72, 0x65, 0x73, 0x74,
-  0x6f, 0x73, 0x68, 0x6f, 0x72, 0x61, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x61,
-  0x6e, 0x74, 0x65, 0x73, 0x66, 0x6f, 0x74, 0x6f, 0x73, 0x65, 0x73, 0x74, 0x61,
-  0x73, 0x70, 0x61, 0xc3, 0xad, 0x73, 0x6e, 0x75, 0x65, 0x76, 0x61, 0x73, 0x61,
-  0x6c, 0x75, 0x64, 0x66, 0x6f, 0x72, 0x6f, 0x73, 0x6d, 0x65, 0x64, 0x69, 0x6f,
-  0x71, 0x75, 0x69, 0x65, 0x6e, 0x6d, 0x65, 0x73, 0x65, 0x73, 0x70, 0x6f, 0x64,
-  0x65, 0x72, 0x63, 0x68, 0x69, 0x6c, 0x65, 0x73, 0x65, 0x72, 0xc3, 0xa1, 0x76,
-  0x65, 0x63, 0x65, 0x73, 0x64, 0x65, 0x63, 0x69, 0x72, 0x6a, 0x6f, 0x73, 0xc3,
-  0xa9, 0x65, 0x73, 0x74, 0x61, 0x72, 0x76, 0x65, 0x6e, 0x74, 0x61, 0x67, 0x72,
-  0x75, 0x70, 0x6f, 0x68, 0x65, 0x63, 0x68, 0x6f, 0x65, 0x6c, 0x6c, 0x6f, 0x73,
-  0x74, 0x65, 0x6e, 0x67, 0x6f, 0x61, 0x6d, 0x69, 0x67, 0x6f, 0x63, 0x6f, 0x73,
-  0x61, 0x73, 0x6e, 0x69, 0x76, 0x65, 0x6c, 0x67, 0x65, 0x6e, 0x74, 0x65, 0x6d,
-  0x69, 0x73, 0x6d, 0x61, 0x61, 0x69, 0x72, 0x65, 0x73, 0x6a, 0x75, 0x6c, 0x69,
-  0x6f, 0x74, 0x65, 0x6d, 0x61, 0x73, 0x68, 0x61, 0x63, 0x69, 0x61, 0x66, 0x61,
-  0x76, 0x6f, 0x72, 0x6a, 0x75, 0x6e, 0x69, 0x6f, 0x6c, 0x69, 0x62, 0x72, 0x65,
-  0x70, 0x75, 0x6e, 0x74, 0x6f, 0x62, 0x75, 0x65, 0x6e, 0x6f, 0x61, 0x75, 0x74,
-  0x6f, 0x72, 0x61, 0x62, 0x72, 0x69, 0x6c, 0x62, 0x75, 0x65, 0x6e, 0x61, 0x74,
-  0x65, 0x78, 0x74, 0x6f, 0x6d, 0x61, 0x72, 0x7a, 0x6f, 0x73, 0x61, 0x62, 0x65,
-  0x72, 0x6c, 0x69, 0x73, 0x74, 0x61, 0x6c, 0x75, 0x65, 0x67, 0x6f, 0x63, 0xc3,
-  0xb3, 0x6d, 0x6f, 0x65, 0x6e, 0x65, 0x72, 0x6f, 0x6a, 0x75, 0x65, 0x67, 0x6f,
-  0x70, 0x65, 0x72, 0xc3, 0xba, 0x68, 0x61, 0x62, 0x65, 0x72, 0x65, 0x73, 0x74,
-  0x6f, 0x79, 0x6e, 0x75, 0x6e, 0x63, 0x61, 0x6d, 0x75, 0x6a, 0x65, 0x72, 0x76,
-  0x61, 0x6c, 0x6f, 0x72, 0x66, 0x75, 0x65, 0x72, 0x61, 0x6c, 0x69, 0x62, 0x72,
-  0x6f, 0x67, 0x75, 0x73, 0x74, 0x61, 0x69, 0x67, 0x75, 0x61, 0x6c, 0x76, 0x6f,
-  0x74, 0x6f, 0x73, 0x63, 0x61, 0x73, 0x6f, 0x73, 0x67, 0x75, 0xc3, 0xad, 0x61,
-  0x70, 0x75, 0x65, 0x64, 0x6f, 0x73, 0x6f, 0x6d, 0x6f, 0x73, 0x61, 0x76, 0x69,
-  0x73, 0x6f, 0x75, 0x73, 0x74, 0x65, 0x64, 0x64, 0x65, 0x62, 0x65, 0x6e, 0x6e,
-  0x6f, 0x63, 0x68, 0x65, 0x62, 0x75, 0x73, 0x63, 0x61, 0x66, 0x61, 0x6c, 0x74,
-  0x61, 0x65, 0x75, 0x72, 0x6f, 0x73, 0x73, 0x65, 0x72, 0x69, 0x65, 0x64, 0x69,
-  0x63, 0x68, 0x6f, 0x63, 0x75, 0x72, 0x73, 0x6f, 0x63, 0x6c, 0x61, 0x76, 0x65,
-  0x63, 0x61, 0x73, 0x61, 0x73, 0x6c, 0x65, 0xc3, 0xb3, 0x6e, 0x70, 0x6c, 0x61,
-  0x7a, 0x6f, 0x6c, 0x61, 0x72, 0x67, 0x6f, 0x6f, 0x62, 0x72, 0x61, 0x73, 0x76,
-  0x69, 0x73, 0x74, 0x61, 0x61, 0x70, 0x6f, 0x79, 0x6f, 0x6a, 0x75, 0x6e, 0x74,
-  0x6f, 0x74, 0x72, 0x61, 0x74, 0x61, 0x76, 0x69, 0x73, 0x74, 0x6f, 0x63, 0x72,
-  0x65, 0x61, 0x72, 0x63, 0x61, 0x6d, 0x70, 0x6f, 0x68, 0x65, 0x6d, 0x6f, 0x73,
-  0x63, 0x69, 0x6e, 0x63, 0x6f, 0x63, 0x61, 0x72, 0x67, 0x6f, 0x70, 0x69, 0x73,
-  0x6f, 0x73, 0x6f, 0x72, 0x64, 0x65, 0x6e, 0x68, 0x61, 0x63, 0x65, 0x6e, 0xc3,
-  0xa1, 0x72, 0x65, 0x61, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x70, 0x65, 0x64, 0x72,
-  0x6f, 0x63, 0x65, 0x72, 0x63, 0x61, 0x70, 0x75, 0x65, 0x64, 0x61, 0x70, 0x61,
-  0x70, 0x65, 0x6c, 0x6d, 0x65, 0x6e, 0x6f, 0x72, 0xc3, 0xba, 0x74, 0x69, 0x6c,
-  0x63, 0x6c, 0x61, 0x72, 0x6f, 0x6a, 0x6f, 0x72, 0x67, 0x65, 0x63, 0x61, 0x6c,
-  0x6c, 0x65, 0x70, 0x6f, 0x6e, 0x65, 0x72, 0x74, 0x61, 0x72, 0x64, 0x65, 0x6e,
-  0x61, 0x64, 0x69, 0x65, 0x6d, 0x61, 0x72, 0x63, 0x61, 0x73, 0x69, 0x67, 0x75,
-  0x65, 0x65, 0x6c, 0x6c, 0x61, 0x73, 0x73, 0x69, 0x67, 0x6c, 0x6f, 0x63, 0x6f,
-  0x63, 0x68, 0x65, 0x6d, 0x6f, 0x74, 0x6f, 0x73, 0x6d, 0x61, 0x64, 0x72, 0x65,
-  0x63, 0x6c, 0x61, 0x73, 0x65, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x6e, 0x69, 0xc3,
-  0xb1, 0x6f, 0x71, 0x75, 0x65, 0x64, 0x61, 0x70, 0x61, 0x73, 0x61, 0x72, 0x62,
-  0x61, 0x6e, 0x63, 0x6f, 0x68, 0x69, 0x6a, 0x6f, 0x73, 0x76, 0x69, 0x61, 0x6a,
-  0x65, 0x70, 0x61, 0x62, 0x6c, 0x6f, 0xc3, 0xa9, 0x73, 0x74, 0x65, 0x76, 0x69,
-  0x65, 0x6e, 0x65, 0x72, 0x65, 0x69, 0x6e, 0x6f, 0x64, 0x65, 0x6a, 0x61, 0x72,
-  0x66, 0x6f, 0x6e, 0x64, 0x6f, 0x63, 0x61, 0x6e, 0x61, 0x6c, 0x6e, 0x6f, 0x72,
-  0x74, 0x65, 0x6c, 0x65, 0x74, 0x72, 0x61, 0x63, 0x61, 0x75, 0x73, 0x61, 0x74,
-  0x6f, 0x6d, 0x61, 0x72, 0x6d, 0x61, 0x6e, 0x6f, 0x73, 0x6c, 0x75, 0x6e, 0x65,
-  0x73, 0x61, 0x75, 0x74, 0x6f, 0x73, 0x76, 0x69, 0x6c, 0x6c, 0x61, 0x76, 0x65,
-  0x6e, 0x64, 0x6f, 0x70, 0x65, 0x73, 0x61, 0x72, 0x74, 0x69, 0x70, 0x6f, 0x73,
-  0x74, 0x65, 0x6e, 0x67, 0x61, 0x6d, 0x61, 0x72, 0x63, 0x6f, 0x6c, 0x6c, 0x65,
-  0x76, 0x61, 0x70, 0x61, 0x64, 0x72, 0x65, 0x75, 0x6e, 0x69, 0x64, 0x6f, 0x76,
-  0x61, 0x6d, 0x6f, 0x73, 0x7a, 0x6f, 0x6e, 0x61, 0x73, 0x61, 0x6d, 0x62, 0x6f,
-  0x73, 0x62, 0x61, 0x6e, 0x64, 0x61, 0x6d, 0x61, 0x72, 0x69, 0x61, 0x61, 0x62,
-  0x75, 0x73, 0x6f, 0x6d, 0x75, 0x63, 0x68, 0x61, 0x73, 0x75, 0x62, 0x69, 0x72,
-  0x72, 0x69, 0x6f, 0x6a, 0x61, 0x76, 0x69, 0x76, 0x69, 0x72, 0x67, 0x72, 0x61,
-  0x64, 0x6f, 0x63, 0x68, 0x69, 0x63, 0x61, 0x61, 0x6c, 0x6c, 0xc3, 0xad, 0x6a,
-  0x6f, 0x76, 0x65, 0x6e, 0x64, 0x69, 0x63, 0x68, 0x61, 0x65, 0x73, 0x74, 0x61,
-  0x6e, 0x74, 0x61, 0x6c, 0x65, 0x73, 0x73, 0x61, 0x6c, 0x69, 0x72, 0x73, 0x75,
-  0x65, 0x6c, 0x6f, 0x70, 0x65, 0x73, 0x6f, 0x73, 0x66, 0x69, 0x6e, 0x65, 0x73,
-  0x6c, 0x6c, 0x61, 0x6d, 0x61, 0x62, 0x75, 0x73, 0x63, 0x6f, 0xc3, 0xa9, 0x73,
-  0x74, 0x61, 0x6c, 0x6c, 0x65, 0x67, 0x61, 0x6e, 0x65, 0x67, 0x72, 0x6f, 0x70,
-  0x6c, 0x61, 0x7a, 0x61, 0x68, 0x75, 0x6d, 0x6f, 0x72, 0x70, 0x61, 0x67, 0x61,
-  0x72, 0x6a, 0x75, 0x6e, 0x74, 0x61, 0x64, 0x6f, 0x62, 0x6c, 0x65, 0x69, 0x73,
-  0x6c, 0x61, 0x73, 0x62, 0x6f, 0x6c, 0x73, 0x61, 0x62, 0x61, 0xc3, 0xb1, 0x6f,
-  0x68, 0x61, 0x62, 0x6c, 0x61, 0x6c, 0x75, 0x63, 0x68, 0x61, 0xc3, 0x81, 0x72,
-  0x65, 0x61, 0x64, 0x69, 0x63, 0x65, 0x6e, 0x6a, 0x75, 0x67, 0x61, 0x72, 0x6e,
-  0x6f, 0x74, 0x61, 0x73, 0x76, 0x61, 0x6c, 0x6c, 0x65, 0x61, 0x6c, 0x6c, 0xc3,
-  0xa1, 0x63, 0x61, 0x72, 0x67, 0x61, 0x64, 0x6f, 0x6c, 0x6f, 0x72, 0x61, 0x62,
-  0x61, 0x6a, 0x6f, 0x65, 0x73, 0x74, 0xc3, 0xa9, 0x67, 0x75, 0x73, 0x74, 0x6f,
-  0x6d, 0x65, 0x6e, 0x74, 0x65, 0x6d, 0x61, 0x72, 0x69, 0x6f, 0x66, 0x69, 0x72,
-  0x6d, 0x61, 0x63, 0x6f, 0x73, 0x74, 0x6f, 0x66, 0x69, 0x63, 0x68, 0x61, 0x70,
-  0x6c, 0x61, 0x74, 0x61, 0x68, 0x6f, 0x67, 0x61, 0x72, 0x61, 0x72, 0x74, 0x65,
-  0x73, 0x6c, 0x65, 0x79, 0x65, 0x73, 0x61, 0x71, 0x75, 0x65, 0x6c, 0x6d, 0x75,
-  0x73, 0x65, 0x6f, 0x62, 0x61, 0x73, 0x65, 0x73, 0x70, 0x6f, 0x63, 0x6f, 0x73,
-  0x6d, 0x69, 0x74, 0x61, 0x64, 0x63, 0x69, 0x65, 0x6c, 0x6f, 0x63, 0x68, 0x69,
-  0x63, 0x6f, 0x6d, 0x69, 0x65, 0x64, 0x6f, 0x67, 0x61, 0x6e, 0x61, 0x72, 0x73,
-  0x61, 0x6e, 0x74, 0x6f, 0x65, 0x74, 0x61, 0x70, 0x61, 0x64, 0x65, 0x62, 0x65,
-  0x73, 0x70, 0x6c, 0x61, 0x79, 0x61, 0x72, 0x65, 0x64, 0x65, 0x73, 0x73, 0x69,
-  0x65, 0x74, 0x65, 0x63, 0x6f, 0x72, 0x74, 0x65, 0x63, 0x6f, 0x72, 0x65, 0x61,
-  0x64, 0x75, 0x64, 0x61, 0x73, 0x64, 0x65, 0x73, 0x65, 0x6f, 0x76, 0x69, 0x65,
-  0x6a, 0x6f, 0x64, 0x65, 0x73, 0x65, 0x61, 0x61, 0x67, 0x75, 0x61, 0x73, 0x26,
-  0x71, 0x75, 0x6f, 0x74, 0x3b, 0x64, 0x6f, 0x6d, 0x61, 0x69, 0x6e, 0x63, 0x6f,
-  0x6d, 0x6d, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x65, 0x76, 0x65,
-  0x6e, 0x74, 0x73, 0x6d, 0x61, 0x73, 0x74, 0x65, 0x72, 0x73, 0x79, 0x73, 0x74,
-  0x65, 0x6d, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x61, 0x6e, 0x6e, 0x65,
-  0x72, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x65, 0x73, 0x63, 0x72, 0x6f, 0x6c, 0x6c,
-  0x75, 0x70, 0x64, 0x61, 0x74, 0x65, 0x67, 0x6c, 0x6f, 0x62, 0x61, 0x6c, 0x6d,
-  0x65, 0x64, 0x69, 0x75, 0x6d, 0x66, 0x69, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x75,
-  0x6d, 0x62, 0x65, 0x72, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x72, 0x65, 0x73,
-  0x75, 0x6c, 0x74, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x73, 0x63, 0x72, 0x65,
-  0x65, 0x6e, 0x63, 0x68, 0x6f, 0x6f, 0x73, 0x65, 0x6e, 0x6f, 0x72, 0x6d, 0x61,
-  0x6c, 0x74, 0x72, 0x61, 0x76, 0x65, 0x6c, 0x69, 0x73, 0x73, 0x75, 0x65, 0x73,
-  0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x73,
-  0x70, 0x72, 0x69, 0x6e, 0x67, 0x6d, 0x6f, 0x64, 0x75, 0x6c, 0x65, 0x6d, 0x6f,
-  0x62, 0x69, 0x6c, 0x65, 0x73, 0x77, 0x69, 0x74, 0x63, 0x68, 0x70, 0x68, 0x6f,
-  0x74, 0x6f, 0x73, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x72, 0x65, 0x67, 0x69,
-  0x6f, 0x6e, 0x69, 0x74, 0x73, 0x65, 0x6c, 0x66, 0x73, 0x6f, 0x63, 0x69, 0x61,
-  0x6c, 0x61, 0x63, 0x74, 0x69, 0x76, 0x65, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e,
-  0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x74,
-  0x69, 0x74, 0x6c, 0x65, 0x3e, 0x65, 0x69, 0x74, 0x68, 0x65, 0x72, 0x6c, 0x65,
-  0x6e, 0x67, 0x74, 0x68, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x66, 0x72, 0x69,
-  0x65, 0x6e, 0x64, 0x6c, 0x61, 0x79, 0x6f, 0x75, 0x74, 0x61, 0x75, 0x74, 0x68,
-  0x6f, 0x72, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x72, 0x65, 0x76, 0x69, 0x65,
-  0x77, 0x73, 0x75, 0x6d, 0x6d, 0x65, 0x72, 0x73, 0x65, 0x72, 0x76, 0x65, 0x72,
-  0x70, 0x6c, 0x61, 0x79, 0x65, 0x64, 0x70, 0x6c, 0x61, 0x79, 0x65, 0x72, 0x65,
-  0x78, 0x70, 0x61, 0x6e, 0x64, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x66, 0x6f,
-  0x72, 0x6d, 0x61, 0x74, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x70, 0x6f, 0x69,
-  0x6e, 0x74, 0x73, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x70, 0x65, 0x72, 0x73,
-  0x6f, 0x6e, 0x6c, 0x69, 0x76, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x73, 0x69, 0x67,
-  0x6e, 0x6d, 0x6f, 0x6e, 0x74, 0x68, 0x73, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x73,
-  0x75, 0x6e, 0x69, 0x71, 0x75, 0x65, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x70,
-  0x65, 0x6f, 0x70, 0x6c, 0x65, 0x65, 0x6e, 0x65, 0x72, 0x67, 0x79, 0x6e, 0x61,
-  0x74, 0x75, 0x72, 0x65, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x66, 0x69, 0x67,
-  0x75, 0x72, 0x65, 0x68, 0x61, 0x76, 0x69, 0x6e, 0x67, 0x63, 0x75, 0x73, 0x74,
-  0x6f, 0x6d, 0x6f, 0x66, 0x66, 0x73, 0x65, 0x74, 0x6c, 0x65, 0x74, 0x74, 0x65,
-  0x72, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74,
-  0x72, 0x65, 0x6e, 0x64, 0x65, 0x72, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x73, 0x75,
-  0x70, 0x6c, 0x6f, 0x61, 0x64, 0x68, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x6d, 0x65,
-  0x74, 0x68, 0x6f, 0x64, 0x76, 0x69, 0x64, 0x65, 0x6f, 0x73, 0x73, 0x63, 0x68,
-  0x6f, 0x6f, 0x6c, 0x66, 0x75, 0x74, 0x75, 0x72, 0x65, 0x73, 0x68, 0x61, 0x64,
-  0x6f, 0x77, 0x64, 0x65, 0x62, 0x61, 0x74, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x65,
-  0x73, 0x4f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x73,
-  0x72, 0x69, 0x67, 0x68, 0x74, 0x73, 0x6c, 0x65, 0x61, 0x67, 0x75, 0x65, 0x63,
-  0x68, 0x72, 0x6f, 0x6d, 0x65, 0x73, 0x69, 0x6d, 0x70, 0x6c, 0x65, 0x6e, 0x6f,
-  0x74, 0x69, 0x63, 0x65, 0x73, 0x68, 0x61, 0x72, 0x65, 0x64, 0x65, 0x6e, 0x64,
-  0x69, 0x6e, 0x67, 0x73, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x72, 0x65, 0x70, 0x6f,
-  0x72, 0x74, 0x6f, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x73, 0x71, 0x75, 0x61, 0x72,
-  0x65, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x73,
-  0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x6d, 0x6f, 0x76, 0x69, 0x6e, 0x67, 0x6c,
-  0x61, 0x74, 0x65, 0x73, 0x74, 0x77, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x46, 0x72,
-  0x61, 0x6e, 0x63, 0x65, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x73, 0x74, 0x72,
-  0x6f, 0x6e, 0x67, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x4c, 0x6f, 0x6e, 0x64,
-  0x6f, 0x6e, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x66, 0x6f, 0x72, 0x6d, 0x65,
-  0x64, 0x64, 0x65, 0x6d, 0x61, 0x6e, 0x64, 0x73, 0x65, 0x63, 0x75, 0x72, 0x65,
-  0x70, 0x61, 0x73, 0x73, 0x65, 0x64, 0x74, 0x6f, 0x67, 0x67, 0x6c, 0x65, 0x70,
-  0x6c, 0x61, 0x63, 0x65, 0x73, 0x64, 0x65, 0x76, 0x69, 0x63, 0x65, 0x73, 0x74,
-  0x61, 0x74, 0x69, 0x63, 0x63, 0x69, 0x74, 0x69, 0x65, 0x73, 0x73, 0x74, 0x72,
-  0x65, 0x61, 0x6d, 0x79, 0x65, 0x6c, 0x6c, 0x6f, 0x77, 0x61, 0x74, 0x74, 0x61,
-  0x63, 0x6b, 0x73, 0x74, 0x72, 0x65, 0x65, 0x74, 0x66, 0x6c, 0x69, 0x67, 0x68,
-  0x74, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x69, 0x6e, 0x66, 0x6f, 0x22, 0x3e,
-  0x6f, 0x70, 0x65, 0x6e, 0x65, 0x64, 0x75, 0x73, 0x65, 0x66, 0x75, 0x6c, 0x76,
-  0x61, 0x6c, 0x6c, 0x65, 0x79, 0x63, 0x61, 0x75, 0x73, 0x65, 0x73, 0x6c, 0x65,
-  0x61, 0x64, 0x65, 0x72, 0x73, 0x65, 0x63, 0x72, 0x65, 0x74, 0x73, 0x65, 0x63,
-  0x6f, 0x6e, 0x64, 0x64, 0x61, 0x6d, 0x61, 0x67, 0x65, 0x73, 0x70, 0x6f, 0x72,
-  0x74, 0x73, 0x65, 0x78, 0x63, 0x65, 0x70, 0x74, 0x72, 0x61, 0x74, 0x69, 0x6e,
-  0x67, 0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x74, 0x68, 0x69, 0x6e, 0x67, 0x73,
-  0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x66, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x73,
-  0x74, 0x61, 0x74, 0x65, 0x73, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x65, 0x76, 0x69,
-  0x73, 0x75, 0x61, 0x6c, 0x65, 0x64, 0x69, 0x74, 0x6f, 0x72, 0x76, 0x6f, 0x6c,
-  0x75, 0x6d, 0x65, 0x52, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x6d, 0x75, 0x73, 0x65,
-  0x75, 0x6d, 0x6d, 0x6f, 0x76, 0x69, 0x65, 0x73, 0x70, 0x61, 0x72, 0x65, 0x6e,
-  0x74, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x6d, 0x6f, 0x73, 0x74, 0x6c, 0x79,
-  0x6d, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x22, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x6d,
-  0x61, 0x72, 0x6b, 0x65, 0x74, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x63, 0x68,
-  0x61, 0x6e, 0x63, 0x65, 0x73, 0x75, 0x72, 0x76, 0x65, 0x79, 0x62, 0x65, 0x66,
-  0x6f, 0x72, 0x65, 0x73, 0x79, 0x6d, 0x62, 0x6f, 0x6c, 0x6d, 0x6f, 0x6d, 0x65,
-  0x6e, 0x74, 0x73, 0x70, 0x65, 0x65, 0x63, 0x68, 0x6d, 0x6f, 0x74, 0x69, 0x6f,
-  0x6e, 0x69, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x6d, 0x61, 0x74, 0x74, 0x65, 0x72,
-  0x43, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x65,
-  0x78, 0x69, 0x73, 0x74, 0x73, 0x6d, 0x69, 0x64, 0x64, 0x6c, 0x65, 0x45, 0x75,
-  0x72, 0x6f, 0x70, 0x65, 0x67, 0x72, 0x6f, 0x77, 0x74, 0x68, 0x6c, 0x65, 0x67,
-  0x61, 0x63, 0x79, 0x6d, 0x61, 0x6e, 0x6e, 0x65, 0x72, 0x65, 0x6e, 0x6f, 0x75,
-  0x67, 0x68, 0x63, 0x61, 0x72, 0x65, 0x65, 0x72, 0x61, 0x6e, 0x73, 0x77, 0x65,
-  0x72, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6c,
-  0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72,
-  0x61, 0x6e, 0x64, 0x6f, 0x6d, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x64, 0x74, 0x6f,
-  0x70, 0x69, 0x63, 0x73, 0x63, 0x6f, 0x6d, 0x69, 0x6e, 0x67, 0x66, 0x61, 0x74,
-  0x68, 0x65, 0x72, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x69, 0x6d, 0x70,
-  0x6c, 0x79, 0x72, 0x61, 0x69, 0x73, 0x65, 0x64, 0x65, 0x73, 0x63, 0x61, 0x70,
-  0x65, 0x63, 0x68, 0x6f, 0x73, 0x65, 0x6e, 0x63, 0x68, 0x75, 0x72, 0x63, 0x68,
-  0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x63,
-  0x6f, 0x72, 0x6e, 0x65, 0x72, 0x6f, 0x75, 0x74, 0x70, 0x75, 0x74, 0x6d, 0x65,
-  0x6d, 0x6f, 0x72, 0x79, 0x69, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x70, 0x6f, 0x6c,
-  0x69, 0x63, 0x65, 0x6d, 0x6f, 0x64, 0x65, 0x6c, 0x73, 0x4e, 0x75, 0x6d, 0x62,
-  0x65, 0x72, 0x64, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x6f, 0x66, 0x66, 0x65, 0x72,
-  0x73, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x6b, 0x69, 0x6c, 0x6c, 0x65, 0x64,
-  0x6c, 0x69, 0x73, 0x74, 0x65, 0x64, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x73,
-  0x69, 0x6c, 0x76, 0x65, 0x72, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x64, 0x65,
-  0x6c, 0x65, 0x74, 0x65, 0x62, 0x65, 0x74, 0x74, 0x65, 0x72, 0x62, 0x72, 0x6f,
-  0x77, 0x73, 0x65, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x73, 0x47, 0x6c, 0x6f, 0x62,
-  0x61, 0x6c, 0x73, 0x69, 0x6e, 0x67, 0x6c, 0x65, 0x77, 0x69, 0x64, 0x67, 0x65,
-  0x74, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x62, 0x75, 0x64, 0x67, 0x65, 0x74,
-  0x6e, 0x6f, 0x77, 0x72, 0x61, 0x70, 0x63, 0x72, 0x65, 0x64, 0x69, 0x74, 0x63,
-  0x6c, 0x61, 0x69, 0x6d, 0x73, 0x65, 0x6e, 0x67, 0x69, 0x6e, 0x65, 0x73, 0x61,
-  0x66, 0x65, 0x74, 0x79, 0x63, 0x68, 0x6f, 0x69, 0x63, 0x65, 0x73, 0x70, 0x69,
-  0x72, 0x69, 0x74, 0x2d, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x70, 0x72, 0x65,
-  0x61, 0x64, 0x6d, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x6e, 0x65, 0x65, 0x64, 0x65,
-  0x64, 0x72, 0x75, 0x73, 0x73, 0x69, 0x61, 0x70, 0x6c, 0x65, 0x61, 0x73, 0x65,
-  0x65, 0x78, 0x74, 0x65, 0x6e, 0x74, 0x53, 0x63, 0x72, 0x69, 0x70, 0x74, 0x62,
-  0x72, 0x6f, 0x6b, 0x65, 0x6e, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x73, 0x63, 0x68,
-  0x61, 0x72, 0x67, 0x65, 0x64, 0x69, 0x76, 0x69, 0x64, 0x65, 0x66, 0x61, 0x63,
-  0x74, 0x6f, 0x72, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x2d, 0x62, 0x61, 0x73,
-  0x65, 0x64, 0x74, 0x68, 0x65, 0x6f, 0x72, 0x79, 0x63, 0x6f, 0x6e, 0x66, 0x69,
-  0x67, 0x61, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x77, 0x6f, 0x72, 0x6b, 0x65, 0x64,
-  0x68, 0x65, 0x6c, 0x70, 0x65, 0x64, 0x43, 0x68, 0x75, 0x72, 0x63, 0x68, 0x69,
-  0x6d, 0x70, 0x61, 0x63, 0x74, 0x73, 0x68, 0x6f, 0x75, 0x6c, 0x64, 0x61, 0x6c,
-  0x77, 0x61, 0x79, 0x73, 0x6c, 0x6f, 0x67, 0x6f, 0x22, 0x20, 0x62, 0x6f, 0x74,
-  0x74, 0x6f, 0x6d, 0x6c, 0x69, 0x73, 0x74, 0x22, 0x3e, 0x29, 0x7b, 0x76, 0x61,
-  0x72, 0x20, 0x70, 0x72, 0x65, 0x66, 0x69, 0x78, 0x6f, 0x72, 0x61, 0x6e, 0x67,
-  0x65, 0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x2e, 0x70, 0x75, 0x73, 0x68, 0x28,
-  0x63, 0x6f, 0x75, 0x70, 0x6c, 0x65, 0x67, 0x61, 0x72, 0x64, 0x65, 0x6e, 0x62,
-  0x72, 0x69, 0x64, 0x67, 0x65, 0x6c, 0x61, 0x75, 0x6e, 0x63, 0x68, 0x52, 0x65,
-  0x76, 0x69, 0x65, 0x77, 0x74, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x76, 0x69, 0x73,
-  0x69, 0x6f, 0x6e, 0x6c, 0x69, 0x74, 0x74, 0x6c, 0x65, 0x64, 0x61, 0x74, 0x69,
-  0x6e, 0x67, 0x42, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x62, 0x65, 0x61, 0x75, 0x74,
-  0x79, 0x74, 0x68, 0x65, 0x6d, 0x65, 0x73, 0x66, 0x6f, 0x72, 0x67, 0x6f, 0x74,
-  0x53, 0x65, 0x61, 0x72, 0x63, 0x68, 0x61, 0x6e, 0x63, 0x68, 0x6f, 0x72, 0x61,
-  0x6c, 0x6d, 0x6f, 0x73, 0x74, 0x6c, 0x6f, 0x61, 0x64, 0x65, 0x64, 0x43, 0x68,
-  0x61, 0x6e, 0x67, 0x65, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x73, 0x74, 0x72,
-  0x69, 0x6e, 0x67, 0x72, 0x65, 0x6c, 0x6f, 0x61, 0x64, 0x4d, 0x6f, 0x62, 0x69,
-  0x6c, 0x65, 0x69, 0x6e, 0x63, 0x6f, 0x6d, 0x65, 0x73, 0x75, 0x70, 0x70, 0x6c,
-  0x79, 0x53, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x73,
-  0x76, 0x69, 0x65, 0x77, 0x65, 0x64, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x63,
-  0x6f, 0x75, 0x72, 0x73, 0x65, 0x41, 0x62, 0x6f, 0x75, 0x74, 0x20, 0x69, 0x73,
-  0x6c, 0x61, 0x6e, 0x64, 0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x20, 0x63, 0x6f, 0x6f,
-  0x6b, 0x69, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x61, 0x6d, 0x61, 0x7a,
-  0x6f, 0x6e, 0x6d, 0x6f, 0x64, 0x65, 0x72, 0x6e, 0x61, 0x64, 0x76, 0x69, 0x63,
-  0x65, 0x69, 0x6e, 0x3c, 0x2f, 0x61, 0x3e, 0x3a, 0x20, 0x54, 0x68, 0x65, 0x20,
-  0x64, 0x69, 0x61, 0x6c, 0x6f, 0x67, 0x68, 0x6f, 0x75, 0x73, 0x65, 0x73, 0x42,
-  0x45, 0x47, 0x49, 0x4e, 0x20, 0x4d, 0x65, 0x78, 0x69, 0x63, 0x6f, 0x73, 0x74,
-  0x61, 0x72, 0x74, 0x73, 0x63, 0x65, 0x6e, 0x74, 0x72, 0x65, 0x68, 0x65, 0x69,
-  0x67, 0x68, 0x74, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x49, 0x73, 0x6c, 0x61,
-  0x6e, 0x64, 0x61, 0x73, 0x73, 0x65, 0x74, 0x73, 0x45, 0x6d, 0x70, 0x69, 0x72,
-  0x65, 0x53, 0x63, 0x68, 0x6f, 0x6f, 0x6c, 0x65, 0x66, 0x66, 0x6f, 0x72, 0x74,
-  0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6e, 0x65, 0x61, 0x72, 0x6c, 0x79, 0x6d,
-  0x61, 0x6e, 0x75, 0x61, 0x6c, 0x53, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x2e, 0x0a,
-  0x0a, 0x4f, 0x6e, 0x65, 0x6a, 0x6f, 0x69, 0x6e, 0x65, 0x64, 0x6d, 0x65, 0x6e,
-  0x75, 0x22, 0x3e, 0x50, 0x68, 0x69, 0x6c, 0x69, 0x70, 0x61, 0x77, 0x61, 0x72,
-  0x64, 0x73, 0x68, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x69, 0x6d, 0x70, 0x6f, 0x72,
-  0x74, 0x4f, 0x66, 0x66, 0x69, 0x63, 0x65, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64,
-  0x73, 0x6b, 0x69, 0x6c, 0x6c, 0x73, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x53,
-  0x70, 0x6f, 0x72, 0x74, 0x73, 0x64, 0x65, 0x67, 0x72, 0x65, 0x65, 0x77, 0x65,
-  0x65, 0x6b, 0x6c, 0x79, 0x20, 0x28, 0x65, 0x2e, 0x67, 0x2e, 0x62, 0x65, 0x68,
-  0x69, 0x6e, 0x64, 0x64, 0x6f, 0x63, 0x74, 0x6f, 0x72, 0x6c, 0x6f, 0x67, 0x67,
-  0x65, 0x64, 0x75, 0x6e, 0x69, 0x74, 0x65, 0x64, 0x3c, 0x2f, 0x62, 0x3e, 0x3c,
-  0x2f, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x73, 0x70, 0x6c, 0x61, 0x6e, 0x74, 0x73,
-  0x61, 0x73, 0x73, 0x69, 0x73, 0x74, 0x61, 0x72, 0x74, 0x69, 0x73, 0x74, 0x69,
-  0x73, 0x73, 0x75, 0x65, 0x64, 0x33, 0x30, 0x30, 0x70, 0x78, 0x7c, 0x63, 0x61,
-  0x6e, 0x61, 0x64, 0x61, 0x61, 0x67, 0x65, 0x6e, 0x63, 0x79, 0x73, 0x63, 0x68,
-  0x65, 0x6d, 0x65, 0x72, 0x65, 0x6d, 0x61, 0x69, 0x6e, 0x42, 0x72, 0x61, 0x7a,
-  0x69, 0x6c, 0x73, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x6c, 0x6f, 0x67, 0x6f, 0x22,
-  0x3e, 0x62, 0x65, 0x79, 0x6f, 0x6e, 0x64, 0x2d, 0x73, 0x63, 0x61, 0x6c, 0x65,
-  0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x6d,
-  0x61, 0x72, 0x69, 0x6e, 0x65, 0x46, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x63, 0x61,
-  0x6d, 0x65, 0x72, 0x61, 0x3c, 0x2f, 0x68, 0x31, 0x3e, 0x0a, 0x5f, 0x66, 0x6f,
-  0x72, 0x6d, 0x22, 0x6c, 0x65, 0x61, 0x76, 0x65, 0x73, 0x73, 0x74, 0x72, 0x65,
-  0x73, 0x73, 0x22, 0x20, 0x2f, 0x3e, 0x0d, 0x0a, 0x2e, 0x67, 0x69, 0x66, 0x22,
-  0x20, 0x6f, 0x6e, 0x6c, 0x6f, 0x61, 0x64, 0x6c, 0x6f, 0x61, 0x64, 0x65, 0x72,
-  0x4f, 0x78, 0x66, 0x6f, 0x72, 0x64, 0x73, 0x69, 0x73, 0x74, 0x65, 0x72, 0x73,
-  0x75, 0x72, 0x76, 0x69, 0x76, 0x6c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x66, 0x65,
-  0x6d, 0x61, 0x6c, 0x65, 0x44, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x73, 0x69, 0x7a,
-  0x65, 0x3d, 0x22, 0x61, 0x70, 0x70, 0x65, 0x61, 0x6c, 0x74, 0x65, 0x78, 0x74,
-  0x22, 0x3e, 0x6c, 0x65, 0x76, 0x65, 0x6c, 0x73, 0x74, 0x68, 0x61, 0x6e, 0x6b,
-  0x73, 0x68, 0x69, 0x67, 0x68, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64,
-  0x61, 0x6e, 0x69, 0x6d, 0x61, 0x6c, 0x61, 0x6e, 0x79, 0x6f, 0x6e, 0x65, 0x41,
-  0x66, 0x72, 0x69, 0x63, 0x61, 0x61, 0x67, 0x72, 0x65, 0x65, 0x64, 0x72, 0x65,
-  0x63, 0x65, 0x6e, 0x74, 0x50, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x3c, 0x62, 0x72,
-  0x20, 0x2f, 0x3e, 0x77, 0x6f, 0x6e, 0x64, 0x65, 0x72, 0x70, 0x72, 0x69, 0x63,
-  0x65, 0x73, 0x74, 0x75, 0x72, 0x6e, 0x65, 0x64, 0x7c, 0x7c, 0x20, 0x7b, 0x7d,
-  0x3b, 0x6d, 0x61, 0x69, 0x6e, 0x22, 0x3e, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65,
-  0x73, 0x75, 0x6e, 0x64, 0x61, 0x79, 0x77, 0x72, 0x61, 0x70, 0x22, 0x3e, 0x66,
-  0x61, 0x69, 0x6c, 0x65, 0x64, 0x63, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x6d, 0x69,
-  0x6e, 0x75, 0x74, 0x65, 0x62, 0x65, 0x61, 0x63, 0x6f, 0x6e, 0x71, 0x75, 0x6f,
-  0x74, 0x65, 0x73, 0x31, 0x35, 0x30, 0x70, 0x78, 0x7c, 0x65, 0x73, 0x74, 0x61,
-  0x74, 0x65, 0x72, 0x65, 0x6d, 0x6f, 0x74, 0x65, 0x65, 0x6d, 0x61, 0x69, 0x6c,
-  0x22, 0x6c, 0x69, 0x6e, 0x6b, 0x65, 0x64, 0x72, 0x69, 0x67, 0x68, 0x74, 0x3b,
-  0x73, 0x69, 0x67, 0x6e, 0x61, 0x6c, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x6c, 0x31,
-  0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x73, 0x69, 0x67, 0x6e, 0x75, 0x70, 0x70, 0x72,
-  0x69, 0x6e, 0x63, 0x65, 0x66, 0x6c, 0x6f, 0x61, 0x74, 0x3a, 0x2e, 0x70, 0x6e,
-  0x67, 0x22, 0x20, 0x66, 0x6f, 0x72, 0x75, 0x6d, 0x2e, 0x41, 0x63, 0x63, 0x65,
-  0x73, 0x73, 0x70, 0x61, 0x70, 0x65, 0x72, 0x73, 0x73, 0x6f, 0x75, 0x6e, 0x64,
-  0x73, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x48, 0x65, 0x69, 0x67, 0x68, 0x74,
-  0x73, 0x6c, 0x69, 0x64, 0x65, 0x72, 0x55, 0x54, 0x46, 0x2d, 0x38, 0x22, 0x26,
-  0x61, 0x6d, 0x70, 0x3b, 0x20, 0x42, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x2e, 0x20,
-  0x57, 0x69, 0x74, 0x68, 0x73, 0x74, 0x75, 0x64, 0x69, 0x6f, 0x6f, 0x77, 0x6e,
-  0x65, 0x72, 0x73, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x70, 0x72, 0x6f, 0x66,
-  0x69, 0x74, 0x6a, 0x51, 0x75, 0x65, 0x72, 0x79, 0x61, 0x6e, 0x6e, 0x75, 0x61,
-  0x6c, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x73, 0x62, 0x6f, 0x75, 0x67, 0x68, 0x74,
-  0x66, 0x61, 0x6d, 0x6f, 0x75, 0x73, 0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x6c,
-  0x6f, 0x6e, 0x67, 0x65, 0x72, 0x69, 0x2b, 0x2b, 0x29, 0x20, 0x7b, 0x69, 0x73,
-  0x72, 0x61, 0x65, 0x6c, 0x73, 0x61, 0x79, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x63,
-  0x69, 0x64, 0x65, 0x68, 0x6f, 0x6d, 0x65, 0x22, 0x3e, 0x68, 0x65, 0x61, 0x64,
-  0x65, 0x72, 0x65, 0x6e, 0x73, 0x75, 0x72, 0x65, 0x62, 0x72, 0x61, 0x6e, 0x63,
-  0x68, 0x70, 0x69, 0x65, 0x63, 0x65, 0x73, 0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x3b,
-  0x73, 0x74, 0x61, 0x74, 0x65, 0x64, 0x74, 0x6f, 0x70, 0x22, 0x3e, 0x3c, 0x72,
-  0x61, 0x63, 0x69, 0x6e, 0x67, 0x72, 0x65, 0x73, 0x69, 0x7a, 0x65, 0x2d, 0x2d,
-  0x26, 0x67, 0x74, 0x3b, 0x70, 0x61, 0x63, 0x69, 0x74, 0x79, 0x73, 0x65, 0x78,
-  0x75, 0x61, 0x6c, 0x62, 0x75, 0x72, 0x65, 0x61, 0x75, 0x2e, 0x6a, 0x70, 0x67,
-  0x22, 0x20, 0x31, 0x30, 0x2c, 0x30, 0x30, 0x30, 0x6f, 0x62, 0x74, 0x61, 0x69,
-  0x6e, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x73, 0x61, 0x6d, 0x6f, 0x75, 0x6e, 0x74,
-  0x2c, 0x20, 0x49, 0x6e, 0x63, 0x2e, 0x63, 0x6f, 0x6d, 0x65, 0x64, 0x79, 0x6d,
-  0x65, 0x6e, 0x75, 0x22, 0x20, 0x6c, 0x79, 0x72, 0x69, 0x63, 0x73, 0x74, 0x6f,
-  0x64, 0x61, 0x79, 0x2e, 0x69, 0x6e, 0x64, 0x65, 0x65, 0x64, 0x63, 0x6f, 0x75,
-  0x6e, 0x74, 0x79, 0x5f, 0x6c, 0x6f, 0x67, 0x6f, 0x2e, 0x46, 0x61, 0x6d, 0x69,
-  0x6c, 0x79, 0x6c, 0x6f, 0x6f, 0x6b, 0x65, 0x64, 0x4d, 0x61, 0x72, 0x6b, 0x65,
-  0x74, 0x6c, 0x73, 0x65, 0x20, 0x69, 0x66, 0x50, 0x6c, 0x61, 0x79, 0x65, 0x72,
-  0x74, 0x75, 0x72, 0x6b, 0x65, 0x79, 0x29, 0x3b, 0x76, 0x61, 0x72, 0x20, 0x66,
-  0x6f, 0x72, 0x65, 0x73, 0x74, 0x67, 0x69, 0x76, 0x69, 0x6e, 0x67, 0x65, 0x72,
-  0x72, 0x6f, 0x72, 0x73, 0x44, 0x6f, 0x6d, 0x61, 0x69, 0x6e, 0x7d, 0x65, 0x6c,
-  0x73, 0x65, 0x7b, 0x69, 0x6e, 0x73, 0x65, 0x72, 0x74, 0x42, 0x6c, 0x6f, 0x67,
-  0x3c, 0x2f, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x6c, 0x6f, 0x67, 0x69, 0x6e,
-  0x2e, 0x66, 0x61, 0x73, 0x74, 0x65, 0x72, 0x61, 0x67, 0x65, 0x6e, 0x74, 0x73,
-  0x3c, 0x62, 0x6f, 0x64, 0x79, 0x20, 0x31, 0x30, 0x70, 0x78, 0x20, 0x30, 0x70,
-  0x72, 0x61, 0x67, 0x6d, 0x61, 0x66, 0x72, 0x69, 0x64, 0x61, 0x79, 0x6a, 0x75,
-  0x6e, 0x69, 0x6f, 0x72, 0x64, 0x6f, 0x6c, 0x6c, 0x61, 0x72, 0x70, 0x6c, 0x61,
-  0x63, 0x65, 0x64, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x73, 0x70, 0x6c, 0x75, 0x67,
-  0x69, 0x6e, 0x35, 0x2c, 0x30, 0x30, 0x30, 0x20, 0x70, 0x61, 0x67, 0x65, 0x22,
-  0x3e, 0x62, 0x6f, 0x73, 0x74, 0x6f, 0x6e, 0x2e, 0x74, 0x65, 0x73, 0x74, 0x28,
-  0x61, 0x76, 0x61, 0x74, 0x61, 0x72, 0x74, 0x65, 0x73, 0x74, 0x65, 0x64, 0x5f,
-  0x63, 0x6f, 0x75, 0x6e, 0x74, 0x66, 0x6f, 0x72, 0x75, 0x6d, 0x73, 0x73, 0x63,
-  0x68, 0x65, 0x6d, 0x61, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x2c, 0x66, 0x69, 0x6c,
-  0x6c, 0x65, 0x64, 0x73, 0x68, 0x61, 0x72, 0x65, 0x73, 0x72, 0x65, 0x61, 0x64,
-  0x65, 0x72, 0x61, 0x6c, 0x65, 0x72, 0x74, 0x28, 0x61, 0x70, 0x70, 0x65, 0x61,
-  0x72, 0x53, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x6c, 0x69, 0x6e, 0x65, 0x22, 0x3e,
-  0x62, 0x6f, 0x64, 0x79, 0x22, 0x3e, 0x0a, 0x2a, 0x20, 0x54, 0x68, 0x65, 0x54,
-  0x68, 0x6f, 0x75, 0x67, 0x68, 0x73, 0x65, 0x65, 0x69, 0x6e, 0x67, 0x6a, 0x65,
-  0x72, 0x73, 0x65, 0x79, 0x4e, 0x65, 0x77, 0x73, 0x3c, 0x2f, 0x76, 0x65, 0x72,
-  0x69, 0x66, 0x79, 0x65, 0x78, 0x70, 0x65, 0x72, 0x74, 0x69, 0x6e, 0x6a, 0x75,
-  0x72, 0x79, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x43, 0x6f, 0x6f, 0x6b, 0x69,
-  0x65, 0x53, 0x54, 0x41, 0x52, 0x54, 0x20, 0x61, 0x63, 0x72, 0x6f, 0x73, 0x73,
-  0x5f, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x74, 0x68, 0x72, 0x65, 0x61, 0x64, 0x6e,
-  0x61, 0x74, 0x69, 0x76, 0x65, 0x70, 0x6f, 0x63, 0x6b, 0x65, 0x74, 0x62, 0x6f,
-  0x78, 0x22, 0x3e, 0x0a, 0x53, 0x79, 0x73, 0x74, 0x65, 0x6d, 0x20, 0x44, 0x61,
-  0x76, 0x69, 0x64, 0x63, 0x61, 0x6e, 0x63, 0x65, 0x72, 0x74, 0x61, 0x62, 0x6c,
-  0x65, 0x73, 0x70, 0x72, 0x6f, 0x76, 0x65, 0x64, 0x41, 0x70, 0x72, 0x69, 0x6c,
-  0x20, 0x72, 0x65, 0x61, 0x6c, 0x6c, 0x79, 0x64, 0x72, 0x69, 0x76, 0x65, 0x72,
-  0x69, 0x74, 0x65, 0x6d, 0x22, 0x3e, 0x6d, 0x6f, 0x72, 0x65, 0x22, 0x3e, 0x62,
-  0x6f, 0x61, 0x72, 0x64, 0x73, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x73, 0x63, 0x61,
-  0x6d, 0x70, 0x75, 0x73, 0x66, 0x69, 0x72, 0x73, 0x74, 0x20, 0x7c, 0x7c, 0x20,
-  0x5b, 0x5d, 0x3b, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x2e, 0x67, 0x75, 0x69, 0x74,
-  0x61, 0x72, 0x66, 0x69, 0x6e, 0x69, 0x73, 0x68, 0x77, 0x69, 0x64, 0x74, 0x68,
-  0x3a, 0x73, 0x68, 0x6f, 0x77, 0x65, 0x64, 0x4f, 0x74, 0x68, 0x65, 0x72, 0x20,
-  0x2e, 0x70, 0x68, 0x70, 0x22, 0x20, 0x61, 0x73, 0x73, 0x75, 0x6d, 0x65, 0x6c,
-  0x61, 0x79, 0x65, 0x72, 0x73, 0x77, 0x69, 0x6c, 0x73, 0x6f, 0x6e, 0x73, 0x74,
-  0x6f, 0x72, 0x65, 0x73, 0x72, 0x65, 0x6c, 0x69, 0x65, 0x66, 0x73, 0x77, 0x65,
-  0x64, 0x65, 0x6e, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x65, 0x61, 0x73, 0x69,
-  0x6c, 0x79, 0x20, 0x79, 0x6f, 0x75, 0x72, 0x20, 0x53, 0x74, 0x72, 0x69, 0x6e,
-  0x67, 0x0a, 0x0a, 0x57, 0x68, 0x69, 0x6c, 0x74, 0x61, 0x79, 0x6c, 0x6f, 0x72,
-  0x63, 0x6c, 0x65, 0x61, 0x72, 0x3a, 0x72, 0x65, 0x73, 0x6f, 0x72, 0x74, 0x66,
-  0x72, 0x65, 0x6e, 0x63, 0x68, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x22, 0x29,
-  0x20, 0x2b, 0x20, 0x22, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x62, 0x75, 0x79,
-  0x69, 0x6e, 0x67, 0x62, 0x72, 0x61, 0x6e, 0x64, 0x73, 0x4d, 0x65, 0x6d, 0x62,
-  0x65, 0x72, 0x6e, 0x61, 0x6d, 0x65, 0x22, 0x3e, 0x6f, 0x70, 0x70, 0x69, 0x6e,
-  0x67, 0x73, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x35, 0x70, 0x78, 0x3b, 0x22, 0x3e,
-  0x76, 0x73, 0x70, 0x61, 0x63, 0x65, 0x70, 0x6f, 0x73, 0x74, 0x65, 0x72, 0x6d,
-  0x61, 0x6a, 0x6f, 0x72, 0x20, 0x63, 0x6f, 0x66, 0x66, 0x65, 0x65, 0x6d, 0x61,
-  0x72, 0x74, 0x69, 0x6e, 0x6d, 0x61, 0x74, 0x75, 0x72, 0x65, 0x68, 0x61, 0x70,
-  0x70, 0x65, 0x6e, 0x3c, 0x2f, 0x6e, 0x61, 0x76, 0x3e, 0x6b, 0x61, 0x6e, 0x73,
-  0x61, 0x73, 0x6c, 0x69, 0x6e, 0x6b, 0x22, 0x3e, 0x49, 0x6d, 0x61, 0x67, 0x65,
-  0x73, 0x3d, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x77, 0x68, 0x69, 0x6c, 0x65, 0x20,
-  0x68, 0x73, 0x70, 0x61, 0x63, 0x65, 0x30, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x20,
-  0x0a, 0x0a, 0x49, 0x6e, 0x20, 0x20, 0x70, 0x6f, 0x77, 0x65, 0x72, 0x50, 0x6f,
-  0x6c, 0x73, 0x6b, 0x69, 0x2d, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x6a, 0x6f, 0x72,
-  0x64, 0x61, 0x6e, 0x42, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x53, 0x74, 0x61, 0x72,
-  0x74, 0x20, 0x2d, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x32, 0x2e, 0x68, 0x74, 0x6d,
-  0x6c, 0x6e, 0x65, 0x77, 0x73, 0x22, 0x3e, 0x30, 0x31, 0x2e, 0x6a, 0x70, 0x67,
-  0x4f, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x2d, 0x72, 0x69, 0x67, 0x68, 0x74, 0x6d,
-  0x69, 0x6c, 0x6c, 0x65, 0x72, 0x73, 0x65, 0x6e, 0x69, 0x6f, 0x72, 0x49, 0x53,
-  0x42, 0x4e, 0x20, 0x30, 0x30, 0x2c, 0x30, 0x30, 0x30, 0x20, 0x67, 0x75, 0x69,
-  0x64, 0x65, 0x73, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x29, 0x65, 0x63, 0x74, 0x69,
-  0x6f, 0x6e, 0x72, 0x65, 0x70, 0x61, 0x69, 0x72, 0x2e, 0x78, 0x6d, 0x6c, 0x22,
-  0x20, 0x20, 0x72, 0x69, 0x67, 0x68, 0x74, 0x73, 0x2e, 0x68, 0x74, 0x6d, 0x6c,
-  0x2d, 0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x72, 0x65, 0x67, 0x45, 0x78, 0x70, 0x3a,
-  0x68, 0x6f, 0x76, 0x65, 0x72, 0x77, 0x69, 0x74, 0x68, 0x69, 0x6e, 0x76, 0x69,
-  0x72, 0x67, 0x69, 0x6e, 0x70, 0x68, 0x6f, 0x6e, 0x65, 0x73, 0x3c, 0x2f, 0x74,
-  0x72, 0x3e, 0x0d, 0x75, 0x73, 0x69, 0x6e, 0x67, 0x20, 0x0a, 0x09, 0x76, 0x61,
-  0x72, 0x20, 0x3e, 0x27, 0x29, 0x3b, 0x0a, 0x09, 0x3c, 0x2f, 0x74, 0x64, 0x3e,
-  0x0a, 0x3c, 0x2f, 0x74, 0x72, 0x3e, 0x0a, 0x62, 0x61, 0x68, 0x61, 0x73, 0x61,
-  0x62, 0x72, 0x61, 0x73, 0x69, 0x6c, 0x67, 0x61, 0x6c, 0x65, 0x67, 0x6f, 0x6d,
-  0x61, 0x67, 0x79, 0x61, 0x72, 0x70, 0x6f, 0x6c, 0x73, 0x6b, 0x69, 0x73, 0x72,
-  0x70, 0x73, 0x6b, 0x69, 0xd8, 0xb1, 0xd8, 0xaf, 0xd9, 0x88, 0xe4, 0xb8, 0xad,
-  0xe6, 0x96, 0x87, 0xe7, 0xae, 0x80, 0xe4, 0xbd, 0x93, 0xe7, 0xb9, 0x81, 0xe9,
-  0xab, 0x94, 0xe4, 0xbf, 0xa1, 0xe6, 0x81, 0xaf, 0xe4, 0xb8, 0xad, 0xe5, 0x9b,
-  0xbd, 0xe6, 0x88, 0x91, 0xe4, 0xbb, 0xac, 0xe4, 0xb8, 0x80, 0xe4, 0xb8, 0xaa,
-  0xe5, 0x85, 0xac, 0xe5, 0x8f, 0xb8, 0xe7, 0xae, 0xa1, 0xe7, 0x90, 0x86, 0xe8,
-  0xae, 0xba, 0xe5, 0x9d, 0x9b, 0xe5, 0x8f, 0xaf, 0xe4, 0xbb, 0xa5, 0xe6, 0x9c,
-  0x8d, 0xe5, 0x8a, 0xa1, 0xe6, 0x97, 0xb6, 0xe9, 0x97, 0xb4, 0xe4, 0xb8, 0xaa,
-  0xe4, 0xba, 0xba, 0xe4, 0xba, 0xa7, 0xe5, 0x93, 0x81, 0xe8, 0x87, 0xaa, 0xe5,
-  0xb7, 0xb1, 0xe4, 0xbc, 0x81, 0xe4, 0xb8, 0x9a, 0xe6, 0x9f, 0xa5, 0xe7, 0x9c,
-  0x8b, 0xe5, 0xb7, 0xa5, 0xe4, 0xbd, 0x9c, 0xe8, 0x81, 0x94, 0xe7, 0xb3, 0xbb,
-  0xe6, 0xb2, 0xa1, 0xe6, 0x9c, 0x89, 0xe7, 0xbd, 0x91, 0xe7, 0xab, 0x99, 0xe6,
-  0x89, 0x80, 0xe6, 0x9c, 0x89, 0xe8, 0xaf, 0x84, 0xe8, 0xae, 0xba, 0xe4, 0xb8,
-  0xad, 0xe5, 0xbf, 0x83, 0xe6, 0x96, 0x87, 0xe7, 0xab, 0xa0, 0xe7, 0x94, 0xa8,
-  0xe6, 0x88, 0xb7, 0xe9, 0xa6, 0x96, 0xe9, 0xa1, 0xb5, 0xe4, 0xbd, 0x9c, 0xe8,
-  0x80, 0x85, 0xe6, 0x8a, 0x80, 0xe6, 0x9c, 0xaf, 0xe9, 0x97, 0xae, 0xe9, 0xa2,
-  0x98, 0xe7, 0x9b, 0xb8, 0xe5, 0x85, 0xb3, 0xe4, 0xb8, 0x8b, 0xe8, 0xbd, 0xbd,
-  0xe6, 0x90, 0x9c, 0xe7, 0xb4, 0xa2, 0xe4, 0xbd, 0xbf, 0xe7, 0x94, 0xa8, 0xe8,
-  0xbd, 0xaf, 0xe4, 0xbb, 0xb6, 0xe5, 0x9c, 0xa8, 0xe7, 0xba, 0xbf, 0xe4, 0xb8,
-  0xbb, 0xe9, 0xa2, 0x98, 0xe8, 0xb5, 0x84, 0xe6, 0x96, 0x99, 0xe8, 0xa7, 0x86,
-  0xe9, 0xa2, 0x91, 0xe5, 0x9b, 0x9e, 0xe5, 0xa4, 0x8d, 0xe6, 0xb3, 0xa8, 0xe5,
-  0x86, 0x8c, 0xe7, 0xbd, 0x91, 0xe7, 0xbb, 0x9c, 0xe6, 0x94, 0xb6, 0xe8, 0x97,
-  0x8f, 0xe5, 0x86, 0x85, 0xe5, 0xae, 0xb9, 0xe6, 0x8e, 0xa8, 0xe8, 0x8d, 0x90,
-  0xe5, 0xb8, 0x82, 0xe5, 0x9c, 0xba, 0xe6, 0xb6, 0x88, 0xe6, 0x81, 0xaf, 0xe7,
-  0xa9, 0xba, 0xe9, 0x97, 0xb4, 0xe5, 0x8f, 0x91, 0xe5, 0xb8, 0x83, 0xe4, 0xbb,
-  0x80, 0xe4, 0xb9, 0x88, 0xe5, 0xa5, 0xbd, 0xe5, 0x8f, 0x8b, 0xe7, 0x94, 0x9f,
-  0xe6, 0xb4, 0xbb, 0xe5, 0x9b, 0xbe, 0xe7, 0x89, 0x87, 0xe5, 0x8f, 0x91, 0xe5,
-  0xb1, 0x95, 0xe5, 0xa6, 0x82, 0xe6, 0x9e, 0x9c, 0xe6, 0x89, 0x8b, 0xe6, 0x9c,
-  0xba, 0xe6, 0x96, 0xb0, 0xe9, 0x97, 0xbb, 0xe6, 0x9c, 0x80, 0xe6, 0x96, 0xb0,
-  0xe6, 0x96, 0xb9, 0xe5, 0xbc, 0x8f, 0xe5, 0x8c, 0x97, 0xe4, 0xba, 0xac, 0xe6,
-  0x8f, 0x90, 0xe4, 0xbe, 0x9b, 0xe5, 0x85, 0xb3, 0xe4, 0xba, 0x8e, 0xe6, 0x9b,
-  0xb4, 0xe5, 0xa4, 0x9a, 0xe8, 0xbf, 0x99, 0xe4, 0xb8, 0xaa, 0xe7, 0xb3, 0xbb,
-  0xe7, 0xbb, 0x9f, 0xe7, 0x9f, 0xa5, 0xe9, 0x81, 0x93, 0xe6, 0xb8, 0xb8, 0xe6,
-  0x88, 0x8f, 0xe5, 0xb9, 0xbf, 0xe5, 0x91, 0x8a, 0xe5, 0x85, 0xb6, 0xe4, 0xbb,
-  0x96, 0xe5, 0x8f, 0x91, 0xe8, 0xa1, 0xa8, 0xe5, 0xae, 0x89, 0xe5, 0x85, 0xa8,
-  0xe7, 0xac, 0xac, 0xe4, 0xb8, 0x80, 0xe4, 0xbc, 0x9a, 0xe5, 0x91, 0x98, 0xe8,
-  0xbf, 0x9b, 0xe8, 0xa1, 0x8c, 0xe7, 0x82, 0xb9, 0xe5, 0x87, 0xbb, 0xe7, 0x89,
-  0x88, 0xe6, 0x9d, 0x83, 0xe7, 0x94, 0xb5, 0xe5, 0xad, 0x90, 0xe4, 0xb8, 0x96,
-  0xe7, 0x95, 0x8c, 0xe8, 0xae, 0xbe, 0xe8, 0xae, 0xa1, 0xe5, 0x85, 0x8d, 0xe8,
-  0xb4, 0xb9, 0xe6, 0x95, 0x99, 0xe8, 0x82, 0xb2, 0xe5, 0x8a, 0xa0, 0xe5, 0x85,
-  0xa5, 0xe6, 0xb4, 0xbb, 0xe5, 0x8a, 0xa8, 0xe4, 0xbb, 0x96, 0xe4, 0xbb, 0xac,
-  0xe5, 0x95, 0x86, 0xe5, 0x93, 0x81, 0xe5, 0x8d, 0x9a, 0xe5, 0xae, 0xa2, 0xe7,
-  0x8e, 0xb0, 0xe5, 0x9c, 0xa8, 0xe4, 0xb8, 0x8a, 0xe6, 0xb5, 0xb7, 0xe5, 0xa6,
-  0x82, 0xe4, 0xbd, 0x95, 0xe5, 0xb7, 0xb2, 0xe7, 0xbb, 0x8f, 0xe7, 0x95, 0x99,
-  0xe8, 0xa8, 0x80, 0xe8, 0xaf, 0xa6, 0xe7, 0xbb, 0x86, 0xe7, 0xa4, 0xbe, 0xe5,
-  0x8c, 0xba, 0xe7, 0x99, 0xbb, 0xe5, 0xbd, 0x95, 0xe6, 0x9c, 0xac, 0xe7, 0xab,
-  0x99, 0xe9, 0x9c, 0x80, 0xe8, 0xa6, 0x81, 0xe4, 0xbb, 0xb7, 0xe6, 0xa0, 0xbc,
-  0xe6, 0x94, 0xaf, 0xe6, 0x8c, 0x81, 0xe5, 0x9b, 0xbd, 0xe9, 0x99, 0x85, 0xe9,
-  0x93, 0xbe, 0xe6, 0x8e, 0xa5, 0xe5, 0x9b, 0xbd, 0xe5, 0xae, 0xb6, 0xe5, 0xbb,
-  0xba, 0xe8, 0xae, 0xbe, 0xe6, 0x9c, 0x8b, 0xe5, 0x8f, 0x8b, 0xe9, 0x98, 0x85,
-  0xe8, 0xaf, 0xbb, 0xe6, 0xb3, 0x95, 0xe5, 0xbe, 0x8b, 0xe4, 0xbd, 0x8d, 0xe7,
-  0xbd, 0xae, 0xe7, 0xbb, 0x8f, 0xe6, 0xb5, 0x8e, 0xe9, 0x80, 0x89, 0xe6, 0x8b,
-  0xa9, 0xe8, 0xbf, 0x99, 0xe6, 0xa0, 0xb7, 0xe5, 0xbd, 0x93, 0xe5, 0x89, 0x8d,
-  0xe5, 0x88, 0x86, 0xe7, 0xb1, 0xbb, 0xe6, 0x8e, 0x92, 0xe8, 0xa1, 0x8c, 0xe5,
-  0x9b, 0xa0, 0xe4, 0xb8, 0xba, 0xe4, 0xba, 0xa4, 0xe6, 0x98, 0x93, 0xe6, 0x9c,
-  0x80, 0xe5, 0x90, 0x8e, 0xe9, 0x9f, 0xb3, 0xe4, 0xb9, 0x90, 0xe4, 0xb8, 0x8d,
-  0xe8, 0x83, 0xbd, 0xe9, 0x80, 0x9a, 0xe8, 0xbf, 0x87, 0xe8, 0xa1, 0x8c, 0xe4,
-  0xb8, 0x9a, 0xe7, 0xa7, 0x91, 0xe6, 0x8a, 0x80, 0xe5, 0x8f, 0xaf, 0xe8, 0x83,
-  0xbd, 0xe8, 0xae, 0xbe, 0xe5, 0xa4, 0x87, 0xe5, 0x90, 0x88, 0xe4, 0xbd, 0x9c,
-  0xe5, 0xa4, 0xa7, 0xe5, 0xae, 0xb6, 0xe7, 0xa4, 0xbe, 0xe4, 0xbc, 0x9a, 0xe7,
-  0xa0, 0x94, 0xe7, 0xa9, 0xb6, 0xe4, 0xb8, 0x93, 0xe4, 0xb8, 0x9a, 0xe5, 0x85,
-  0xa8, 0xe9, 0x83, 0xa8, 0xe9, 0xa1, 0xb9, 0xe7, 0x9b, 0xae, 0xe8, 0xbf, 0x99,
-  0xe9, 0x87, 0x8c, 0xe8, 0xbf, 0x98, 0xe6, 0x98, 0xaf, 0xe5, 0xbc, 0x80, 0xe5,
-  0xa7, 0x8b, 0xe6, 0x83, 0x85, 0xe5, 0x86, 0xb5, 0xe7, 0x94, 0xb5, 0xe8, 0x84,
-  0x91, 0xe6, 0x96, 0x87, 0xe4, 0xbb, 0xb6, 0xe5, 0x93, 0x81, 0xe7, 0x89, 0x8c,
-  0xe5, 0xb8, 0xae, 0xe5, 0x8a, 0xa9, 0xe6, 0x96, 0x87, 0xe5, 0x8c, 0x96, 0xe8,
-  0xb5, 0x84, 0xe6, 0xba, 0x90, 0xe5, 0xa4, 0xa7, 0xe5, 0xad, 0xa6, 0xe5, 0xad,
-  0xa6, 0xe4, 0xb9, 0xa0, 0xe5, 0x9c, 0xb0, 0xe5, 0x9d, 0x80, 0xe6, 0xb5, 0x8f,
-  0xe8, 0xa7, 0x88, 0xe6, 0x8a, 0x95, 0xe8, 0xb5, 0x84, 0xe5, 0xb7, 0xa5, 0xe7,
-  0xa8, 0x8b, 0xe8, 0xa6, 0x81, 0xe6, 0xb1, 0x82, 0xe6, 0x80, 0x8e, 0xe4, 0xb9,
-  0x88, 0xe6, 0x97, 0xb6, 0xe5, 0x80, 0x99, 0xe5, 0x8a, 0x9f, 0xe8, 0x83, 0xbd,
-  0xe4, 0xb8, 0xbb, 0xe8, 0xa6, 0x81, 0xe7, 0x9b, 0xae, 0xe5, 0x89, 0x8d, 0xe8,
-  0xb5, 0x84, 0xe8, 0xae, 0xaf, 0xe5, 0x9f, 0x8e, 0xe5, 0xb8, 0x82, 0xe6, 0x96,
-  0xb9, 0xe6, 0xb3, 0x95, 0xe7, 0x94, 0xb5, 0xe5, 0xbd, 0xb1, 0xe6, 0x8b, 0x9b,
-  0xe8, 0x81, 0x98, 0xe5, 0xa3, 0xb0, 0xe6, 0x98, 0x8e, 0xe4, 0xbb, 0xbb, 0xe4,
-  0xbd, 0x95, 0xe5, 0x81, 0xa5, 0xe5, 0xba, 0xb7, 0xe6, 0x95, 0xb0, 0xe6, 0x8d,
-  0xae, 0xe7, 0xbe, 0x8e, 0xe5, 0x9b, 0xbd, 0xe6, 0xb1, 0xbd, 0xe8, 0xbd, 0xa6,
-  0xe4, 0xbb, 0x8b, 0xe7, 0xbb, 0x8d, 0xe4, 0xbd, 0x86, 0xe6, 0x98, 0xaf, 0xe4,
-  0xba, 0xa4, 0xe6, 0xb5, 0x81, 0xe7, 0x94, 0x9f, 0xe4, 0xba, 0xa7, 0xe6, 0x89,
-  0x80, 0xe4, 0xbb, 0xa5, 0xe7, 0x94, 0xb5, 0xe8, 0xaf, 0x9d, 0xe6, 0x98, 0xbe,
-  0xe7, 0xa4, 0xba, 0xe4, 0xb8, 0x80, 0xe4, 0xba, 0x9b, 0xe5, 0x8d, 0x95, 0xe4,
-  0xbd, 0x8d, 0xe4, 0xba, 0xba, 0xe5, 0x91, 0x98, 0xe5, 0x88, 0x86, 0xe6, 0x9e,
-  0x90, 0xe5, 0x9c, 0xb0, 0xe5, 0x9b, 0xbe, 0xe6, 0x97, 0x85, 0xe6, 0xb8, 0xb8,
-  0xe5, 0xb7, 0xa5, 0xe5, 0x85, 0xb7, 0xe5, 0xad, 0xa6, 0xe7, 0x94, 0x9f, 0xe7,
-  0xb3, 0xbb, 0xe5, 0x88, 0x97, 0xe7, 0xbd, 0x91, 0xe5, 0x8f, 0x8b, 0xe5, 0xb8,
-  0x96, 0xe5, 0xad, 0x90, 0xe5, 0xaf, 0x86, 0xe7, 0xa0, 0x81, 0xe9, 0xa2, 0x91,
-  0xe9, 0x81, 0x93, 0xe6, 0x8e, 0xa7, 0xe5, 0x88, 0xb6, 0xe5, 0x9c, 0xb0, 0xe5,
-  0x8c, 0xba, 0xe5, 0x9f, 0xba, 0xe6, 0x9c, 0xac, 0xe5, 0x85, 0xa8, 0xe5, 0x9b,
-  0xbd, 0xe7, 0xbd, 0x91, 0xe4, 0xb8, 0x8a, 0xe9, 0x87, 0x8d, 0xe8, 0xa6, 0x81,
-  0xe7, 0xac, 0xac, 0xe4, 0xba, 0x8c, 0xe5, 0x96, 0x9c, 0xe6, 0xac, 0xa2, 0xe8,
-  0xbf, 0x9b, 0xe5, 0x85, 0xa5, 0xe5, 0x8f, 0x8b, 0xe6, 0x83, 0x85, 0xe8, 0xbf,
-  0x99, 0xe4, 0xba, 0x9b, 0xe8, 0x80, 0x83, 0xe8, 0xaf, 0x95, 0xe5, 0x8f, 0x91,
-  0xe7, 0x8e, 0xb0, 0xe5, 0x9f, 0xb9, 0xe8, 0xae, 0xad, 0xe4, 0xbb, 0xa5, 0xe4,
-  0xb8, 0x8a, 0xe6, 0x94, 0xbf, 0xe5, 0xba, 0x9c, 0xe6, 0x88, 0x90, 0xe4, 0xb8,
-  0xba, 0xe7, 0x8e, 0xaf, 0xe5, 0xa2, 0x83, 0xe9, 0xa6, 0x99, 0xe6, 0xb8, 0xaf,
-  0xe5, 0x90, 0x8c, 0xe6, 0x97, 0xb6, 0xe5, 0xa8, 0xb1, 0xe4, 0xb9, 0x90, 0xe5,
-  0x8f, 0x91, 0xe9, 0x80, 0x81, 0xe4, 0xb8, 0x80, 0xe5, 0xae, 0x9a, 0xe5, 0xbc,
-  0x80, 0xe5, 0x8f, 0x91, 0xe4, 0xbd, 0x9c, 0xe5, 0x93, 0x81, 0xe6, 0xa0, 0x87,
-  0xe5, 0x87, 0x86, 0xe6, 0xac, 0xa2, 0xe8, 0xbf, 0x8e, 0xe8, 0xa7, 0xa3, 0xe5,
-  0x86, 0xb3, 0xe5, 0x9c, 0xb0, 0xe6, 0x96, 0xb9, 0xe4, 0xb8, 0x80, 0xe4, 0xb8,
-  0x8b, 0xe4, 0xbb, 0xa5, 0xe5, 0x8f, 0x8a, 0xe8, 0xb4, 0xa3, 0xe4, 0xbb, 0xbb,
-  0xe6, 0x88, 0x96, 0xe8, 0x80, 0x85, 0xe5, 0xae, 0xa2, 0xe6, 0x88, 0xb7, 0xe4,
-  0xbb, 0xa3, 0xe8, 0xa1, 0xa8, 0xe7, 0xa7, 0xaf, 0xe5, 0x88, 0x86, 0xe5, 0xa5,
-  0xb3, 0xe4, 0xba, 0xba, 0xe6, 0x95, 0xb0, 0xe7, 0xa0, 0x81, 0xe9, 0x94, 0x80,
-  0xe5, 0x94, 0xae, 0xe5, 0x87, 0xba, 0xe7, 0x8e, 0xb0, 0xe7, 0xa6, 0xbb, 0xe7,
-  0xba, 0xbf, 0xe5, 0xba, 0x94, 0xe7, 0x94, 0xa8, 0xe5, 0x88, 0x97, 0xe8, 0xa1,
-  0xa8, 0xe4, 0xb8, 0x8d, 0xe5, 0x90, 0x8c, 0xe7, 0xbc, 0x96, 0xe8, 0xbe, 0x91,
-  0xe7, 0xbb, 0x9f, 0xe8, 0xae, 0xa1, 0xe6, 0x9f, 0xa5, 0xe8, 0xaf, 0xa2, 0xe4,
-  0xb8, 0x8d, 0xe8, 0xa6, 0x81, 0xe6, 0x9c, 0x89, 0xe5, 0x85, 0xb3, 0xe6, 0x9c,
-  0xba, 0xe6, 0x9e, 0x84, 0xe5, 0xbe, 0x88, 0xe5, 0xa4, 0x9a, 0xe6, 0x92, 0xad,
-  0xe6, 0x94, 0xbe, 0xe7, 0xbb, 0x84, 0xe7, 0xbb, 0x87, 0xe6, 0x94, 0xbf, 0xe7,
-  0xad, 0x96, 0xe7, 0x9b, 0xb4, 0xe6, 0x8e, 0xa5, 0xe8, 0x83, 0xbd, 0xe5, 0x8a,
-  0x9b, 0xe6, 0x9d, 0xa5, 0xe6, 0xba, 0x90, 0xe6, 0x99, 0x82, 0xe9, 0x96, 0x93,
-  0xe7, 0x9c, 0x8b, 0xe5, 0x88, 0xb0, 0xe7, 0x83, 0xad, 0xe9, 0x97, 0xa8, 0xe5,
-  0x85, 0xb3, 0xe9, 0x94, 0xae, 0xe4, 0xb8, 0x93, 0xe5, 0x8c, 0xba, 0xe9, 0x9d,
-  0x9e, 0xe5, 0xb8, 0xb8, 0xe8, 0x8b, 0xb1, 0xe8, 0xaf, 0xad, 0xe7, 0x99, 0xbe,
-  0xe5, 0xba, 0xa6, 0xe5, 0xb8, 0x8c, 0xe6, 0x9c, 0x9b, 0xe7, 0xbe, 0x8e, 0xe5,
-  0xa5, 0xb3, 0xe6, 0xaf, 0x94, 0xe8, 0xbe, 0x83, 0xe7, 0x9f, 0xa5, 0xe8, 0xaf,
-  0x86, 0xe8, 0xa7, 0x84, 0xe5, 0xae, 0x9a, 0xe5, 0xbb, 0xba, 0xe8, 0xae, 0xae,
-  0xe9, 0x83, 0xa8, 0xe9, 0x97, 0xa8, 0xe6, 0x84, 0x8f, 0xe8, 0xa7, 0x81, 0xe7,
-  0xb2, 0xbe, 0xe5, 0xbd, 0xa9, 0xe6, 0x97, 0xa5, 0xe6, 0x9c, 0xac, 0xe6, 0x8f,
-  0x90, 0xe9, 0xab, 0x98, 0xe5, 0x8f, 0x91, 0xe8, 0xa8, 0x80, 0xe6, 0x96, 0xb9,
-  0xe9, 0x9d, 0xa2, 0xe5, 0x9f, 0xba, 0xe9, 0x87, 0x91, 0xe5, 0xa4, 0x84, 0xe7,
-  0x90, 0x86, 0xe6, 0x9d, 0x83, 0xe9, 0x99, 0x90, 0xe5, 0xbd, 0xb1, 0xe7, 0x89,
-  0x87, 0xe9, 0x93, 0xb6, 0xe8, 0xa1, 0x8c, 0xe8, 0xbf, 0x98, 0xe6, 0x9c, 0x89,
-  0xe5, 0x88, 0x86, 0xe4, 0xba, 0xab, 0xe7, 0x89, 0xa9, 0xe5, 0x93, 0x81, 0xe7,
-  0xbb, 0x8f, 0xe8, 0x90, 0xa5, 0xe6, 0xb7, 0xbb, 0xe5, 0x8a, 0xa0, 0xe4, 0xb8,
-  0x93, 0xe5, 0xae, 0xb6, 0xe8, 0xbf, 0x99, 0xe7, 0xa7, 0x8d, 0xe8, 0xaf, 0x9d,
-  0xe9, 0xa2, 0x98, 0xe8, 0xb5, 0xb7, 0xe6, 0x9d, 0xa5, 0xe4, 0xb8, 0x9a, 0xe5,
-  0x8a, 0xa1, 0xe5, 0x85, 0xac, 0xe5, 0x91, 0x8a, 0xe8, 0xae, 0xb0, 0xe5, 0xbd,
-  0x95, 0xe7, 0xae, 0x80, 0xe4, 0xbb, 0x8b, 0xe8, 0xb4, 0xa8, 0xe9, 0x87, 0x8f,
-  0xe7, 0x94, 0xb7, 0xe4, 0xba, 0xba, 0xe5, 0xbd, 0xb1, 0xe5, 0x93, 0x8d, 0xe5,
-  0xbc, 0x95, 0xe7, 0x94, 0xa8, 0xe6, 0x8a, 0xa5, 0xe5, 0x91, 0x8a, 0xe9, 0x83,
-  0xa8, 0xe5, 0x88, 0x86, 0xe5, 0xbf, 0xab, 0xe9, 0x80, 0x9f, 0xe5, 0x92, 0xa8,
-  0xe8, 0xaf, 0xa2, 0xe6, 0x97, 0xb6, 0xe5, 0xb0, 0x9a, 0xe6, 0xb3, 0xa8, 0xe6,
-  0x84, 0x8f, 0xe7, 0x94, 0xb3, 0xe8, 0xaf, 0xb7, 0xe5, 0xad, 0xa6, 0xe6, 0xa0,
-  0xa1, 0xe5, 0xba, 0x94, 0xe8, 0xaf, 0xa5, 0xe5, 0x8e, 0x86, 0xe5, 0x8f, 0xb2,
-  0xe5, 0x8f, 0xaa, 0xe6, 0x98, 0xaf, 0xe8, 0xbf, 0x94, 0xe5, 0x9b, 0x9e, 0xe8,
-  0xb4, 0xad, 0xe4, 0xb9, 0xb0, 0xe5, 0x90, 0x8d, 0xe7, 0xa7, 0xb0, 0xe4, 0xb8,
-  0xba, 0xe4, 0xba, 0x86, 0xe6, 0x88, 0x90, 0xe5, 0x8a, 0x9f, 0xe8, 0xaf, 0xb4,
-  0xe6, 0x98, 0x8e, 0xe4, 0xbe, 0x9b, 0xe5, 0xba, 0x94, 0xe5, 0xad, 0xa9, 0xe5,
-  0xad, 0x90, 0xe4, 0xb8, 0x93, 0xe9, 0xa2, 0x98, 0xe7, 0xa8, 0x8b, 0xe5, 0xba,
-  0x8f, 0xe4, 0xb8, 0x80, 0xe8, 0x88, 0xac, 0xe6, 0x9c, 0x83, 0xe5, 0x93, 0xa1,
-  0xe5, 0x8f, 0xaa, 0xe6, 0x9c, 0x89, 0xe5, 0x85, 0xb6, 0xe5, 0xae, 0x83, 0xe4,
-  0xbf, 0x9d, 0xe6, 0x8a, 0xa4, 0xe8, 0x80, 0x8c, 0xe4, 0xb8, 0x94, 0xe4, 0xbb,
-  0x8a, 0xe5, 0xa4, 0xa9, 0xe7, 0xaa, 0x97, 0xe5, 0x8f, 0xa3, 0xe5, 0x8a, 0xa8,
-  0xe6, 0x80, 0x81, 0xe7, 0x8a, 0xb6, 0xe6, 0x80, 0x81, 0xe7, 0x89, 0xb9, 0xe5,
-  0x88, 0xab, 0xe8, 0xae, 0xa4, 0xe4, 0xb8, 0xba, 0xe5, 0xbf, 0x85, 0xe9, 0xa1,
-  0xbb, 0xe6, 0x9b, 0xb4, 0xe6, 0x96, 0xb0, 0xe5, 0xb0, 0x8f, 0xe8, 0xaf, 0xb4,
-  0xe6, 0x88, 0x91, 0xe5, 0x80, 0x91, 0xe4, 0xbd, 0x9c, 0xe4, 0xb8, 0xba, 0xe5,
-  0xaa, 0x92, 0xe4, 0xbd, 0x93, 0xe5, 0x8c, 0x85, 0xe6, 0x8b, 0xac, 0xe9, 0x82,
-  0xa3, 0xe4, 0xb9, 0x88, 0xe4, 0xb8, 0x80, 0xe6, 0xa0, 0xb7, 0xe5, 0x9b, 0xbd,
-  0xe5, 0x86, 0x85, 0xe6, 0x98, 0xaf, 0xe5, 0x90, 0xa6, 0xe6, 0xa0, 0xb9, 0xe6,
-  0x8d, 0xae, 0xe7, 0x94, 0xb5, 0xe8, 0xa7, 0x86, 0xe5, 0xad, 0xa6, 0xe9, 0x99,
-  0xa2, 0xe5, 0x85, 0xb7, 0xe6, 0x9c, 0x89, 0xe8, 0xbf, 0x87, 0xe7, 0xa8, 0x8b,
-  0xe7, 0x94, 0xb1, 0xe4, 0xba, 0x8e, 0xe4, 0xba, 0xba, 0xe6, 0x89, 0x8d, 0xe5,
-  0x87, 0xba, 0xe6, 0x9d, 0xa5, 0xe4, 0xb8, 0x8d, 0xe8, 0xbf, 0x87, 0xe6, 0xad,
-  0xa3, 0xe5, 0x9c, 0xa8, 0xe6, 0x98, 0x8e, 0xe6, 0x98, 0x9f, 0xe6, 0x95, 0x85,
-  0xe4, 0xba, 0x8b, 0xe5, 0x85, 0xb3, 0xe7, 0xb3, 0xbb, 0xe6, 0xa0, 0x87, 0xe9,
-  0xa2, 0x98, 0xe5, 0x95, 0x86, 0xe5, 0x8a, 0xa1, 0xe8, 0xbe, 0x93, 0xe5, 0x85,
-  0xa5, 0xe4, 0xb8, 0x80, 0xe7, 0x9b, 0xb4, 0xe5, 0x9f, 0xba, 0xe7, 0xa1, 0x80,
-  0xe6, 0x95, 0x99, 0xe5, 0xad, 0xa6, 0xe4, 0xba, 0x86, 0xe8, 0xa7, 0xa3, 0xe5,
-  0xbb, 0xba, 0xe7, 0xad, 0x91, 0xe7, 0xbb, 0x93, 0xe6, 0x9e, 0x9c, 0xe5, 0x85,
-  0xa8, 0xe7, 0x90, 0x83, 0xe9, 0x80, 0x9a, 0xe7, 0x9f, 0xa5, 0xe8, 0xae, 0xa1,
-  0xe5, 0x88, 0x92, 0xe5, 0xaf, 0xb9, 0xe4, 0xba, 0x8e, 0xe8, 0x89, 0xba, 0xe6,
-  0x9c, 0xaf, 0xe7, 0x9b, 0xb8, 0xe5, 0x86, 0x8c, 0xe5, 0x8f, 0x91, 0xe7, 0x94,
-  0x9f, 0xe7, 0x9c, 0x9f, 0xe7, 0x9a, 0x84, 0xe5, 0xbb, 0xba, 0xe7, 0xab, 0x8b,
-  0xe7, 0xad, 0x89, 0xe7, 0xba, 0xa7, 0xe7, 0xb1, 0xbb, 0xe5, 0x9e, 0x8b, 0xe7,
-  0xbb, 0x8f, 0xe9, 0xaa, 0x8c, 0xe5, 0xae, 0x9e, 0xe7, 0x8e, 0xb0, 0xe5, 0x88,
-  0xb6, 0xe4, 0xbd, 0x9c, 0xe6, 0x9d, 0xa5, 0xe8, 0x87, 0xaa, 0xe6, 0xa0, 0x87,
-  0xe7, 0xad, 0xbe, 0xe4, 0xbb, 0xa5, 0xe4, 0xb8, 0x8b, 0xe5, 0x8e, 0x9f, 0xe5,
-  0x88, 0x9b, 0xe6, 0x97, 0xa0, 0xe6, 0xb3, 0x95, 0xe5, 0x85, 0xb6, 0xe4, 0xb8,
-  0xad, 0xe5, 0x80, 0x8b, 0xe4, 0xba, 0xba, 0xe4, 0xb8, 0x80, 0xe5, 0x88, 0x87,
-  0xe6, 0x8c, 0x87, 0xe5, 0x8d, 0x97, 0xe5, 0x85, 0xb3, 0xe9, 0x97, 0xad, 0xe9,
-  0x9b, 0x86, 0xe5, 0x9b, 0xa2, 0xe7, 0xac, 0xac, 0xe4, 0xb8, 0x89, 0xe5, 0x85,
-  0xb3, 0xe6, 0xb3, 0xa8, 0xe5, 0x9b, 0xa0, 0xe6, 0xad, 0xa4, 0xe7, 0x85, 0xa7,
-  0xe7, 0x89, 0x87, 0xe6, 0xb7, 0xb1, 0xe5, 0x9c, 0xb3, 0xe5, 0x95, 0x86, 0xe4,
-  0xb8, 0x9a, 0xe5, 0xb9, 0xbf, 0xe5, 0xb7, 0x9e, 0xe6, 0x97, 0xa5, 0xe6, 0x9c,
-  0x9f, 0xe9, 0xab, 0x98, 0xe7, 0xba, 0xa7, 0xe6, 0x9c, 0x80, 0xe8, 0xbf, 0x91,
-  0xe7, 0xbb, 0xbc, 0xe5, 0x90, 0x88, 0xe8, 0xa1, 0xa8, 0xe7, 0xa4, 0xba, 0xe4,
-  0xb8, 0x93, 0xe8, 0xbe, 0x91, 0xe8, 0xa1, 0x8c, 0xe4, 0xb8, 0xba, 0xe4, 0xba,
-  0xa4, 0xe9, 0x80, 0x9a, 0xe8, 0xaf, 0x84, 0xe4, 0xbb, 0xb7, 0xe8, 0xa7, 0x89,
-  0xe5, 0xbe, 0x97, 0xe7, 0xb2, 0xbe, 0xe5, 0x8d, 0x8e, 0xe5, 0xae, 0xb6, 0xe5,
-  0xba, 0xad, 0xe5, 0xae, 0x8c, 0xe6, 0x88, 0x90, 0xe6, 0x84, 0x9f, 0xe8, 0xa7,
-  0x89, 0xe5, 0xae, 0x89, 0xe8, 0xa3, 0x85, 0xe5, 0xbe, 0x97, 0xe5, 0x88, 0xb0,
-  0xe9, 0x82, 0xae, 0xe4, 0xbb, 0xb6, 0xe5, 0x88, 0xb6, 0xe5, 0xba, 0xa6, 0xe9,
-  0xa3, 0x9f, 0xe5, 0x93, 0x81, 0xe8, 0x99, 0xbd, 0xe7, 0x84, 0xb6, 0xe8, 0xbd,
-  0xac, 0xe8, 0xbd, 0xbd, 0xe6, 0x8a, 0xa5, 0xe4, 0xbb, 0xb7, 0xe8, 0xae, 0xb0,
-  0xe8, 0x80, 0x85, 0xe6, 0x96, 0xb9, 0xe6, 0xa1, 0x88, 0xe8, 0xa1, 0x8c, 0xe6,
-  0x94, 0xbf, 0xe4, 0xba, 0xba, 0xe6, 0xb0, 0x91, 0xe7, 0x94, 0xa8, 0xe5, 0x93,
-  0x81, 0xe4, 0xb8, 0x9c, 0xe8, 0xa5, 0xbf, 0xe6, 0x8f, 0x90, 0xe5, 0x87, 0xba,
-  0xe9, 0x85, 0x92, 0xe5, 0xba, 0x97, 0xe7, 0x84, 0xb6, 0xe5, 0x90, 0x8e, 0xe4,
-  0xbb, 0x98, 0xe6, 0xac, 0xbe, 0xe7, 0x83, 0xad, 0xe7, 0x82, 0xb9, 0xe4, 0xbb,
-  0xa5, 0xe5, 0x89, 0x8d, 0xe5, 0xae, 0x8c, 0xe5, 0x85, 0xa8, 0xe5, 0x8f, 0x91,
-  0xe5, 0xb8, 0x96, 0xe8, 0xae, 0xbe, 0xe7, 0xbd, 0xae, 0xe9, 0xa2, 0x86, 0xe5,
-  0xaf, 0xbc, 0xe5, 0xb7, 0xa5, 0xe4, 0xb8, 0x9a, 0xe5, 0x8c, 0xbb, 0xe9, 0x99,
-  0xa2, 0xe7, 0x9c, 0x8b, 0xe7, 0x9c, 0x8b, 0xe7, 0xbb, 0x8f, 0xe5, 0x85, 0xb8,
-  0xe5, 0x8e, 0x9f, 0xe5, 0x9b, 0xa0, 0xe5, 0xb9, 0xb3, 0xe5, 0x8f, 0xb0, 0xe5,
-  0x90, 0x84, 0xe7, 0xa7, 0x8d, 0xe5, 0xa2, 0x9e, 0xe5, 0x8a, 0xa0, 0xe6, 0x9d,
-  0x90, 0xe6, 0x96, 0x99, 0xe6, 0x96, 0xb0, 0xe5, 0xa2, 0x9e, 0xe4, 0xb9, 0x8b,
-  0xe5, 0x90, 0x8e, 0xe8, 0x81, 0x8c, 0xe4, 0xb8, 0x9a, 0xe6, 0x95, 0x88, 0xe6,
-  0x9e, 0x9c, 0xe4, 0xbb, 0x8a, 0xe5, 0xb9, 0xb4, 0xe8, 0xae, 0xba, 0xe6, 0x96,
-  0x87, 0xe6, 0x88, 0x91, 0xe5, 0x9b, 0xbd, 0xe5, 0x91, 0x8a, 0xe8, 0xaf, 0x89,
-  0xe7, 0x89, 0x88, 0xe4, 0xb8, 0xbb, 0xe4, 0xbf, 0xae, 0xe6, 0x94, 0xb9, 0xe5,
-  0x8f, 0x82, 0xe4, 0xb8, 0x8e, 0xe6, 0x89, 0x93, 0xe5, 0x8d, 0xb0, 0xe5, 0xbf,
-  0xab, 0xe4, 0xb9, 0x90, 0xe6, 0x9c, 0xba, 0xe6, 0xa2, 0xb0, 0xe8, 0xa7, 0x82,
-  0xe7, 0x82, 0xb9, 0xe5, 0xad, 0x98, 0xe5, 0x9c, 0xa8, 0xe7, 0xb2, 0xbe, 0xe7,
-  0xa5, 0x9e, 0xe8, 0x8e, 0xb7, 0xe5, 0xbe, 0x97, 0xe5, 0x88, 0xa9, 0xe7, 0x94,
-  0xa8, 0xe7, 0xbb, 0xa7, 0xe7, 0xbb, 0xad, 0xe4, 0xbd, 0xa0, 0xe4, 0xbb, 0xac,
-  0xe8, 0xbf, 0x99, 0xe4, 0xb9, 0x88, 0xe6, 0xa8, 0xa1, 0xe5, 0xbc, 0x8f, 0xe8,
-  0xaf, 0xad, 0xe8, 0xa8, 0x80, 0xe8, 0x83, 0xbd, 0xe5, 0xa4, 0x9f, 0xe9, 0x9b,
-  0x85, 0xe8, 0x99, 0x8e, 0xe6, 0x93, 0x8d, 0xe4, 0xbd, 0x9c, 0xe9, 0xa3, 0x8e,
-  0xe6, 0xa0, 0xbc, 0xe4, 0xb8, 0x80, 0xe8, 0xb5, 0xb7, 0xe7, 0xa7, 0x91, 0xe5,
-  0xad, 0xa6, 0xe4, 0xbd, 0x93, 0xe8, 0x82, 0xb2, 0xe7, 0x9f, 0xad, 0xe4, 0xbf,
-  0xa1, 0xe6, 0x9d, 0xa1, 0xe4, 0xbb, 0xb6, 0xe6, 0xb2, 0xbb, 0xe7, 0x96, 0x97,
-  0xe8, 0xbf, 0x90, 0xe5, 0x8a, 0xa8, 0xe4, 0xba, 0xa7, 0xe4, 0xb8, 0x9a, 0xe4,
-  0xbc, 0x9a, 0xe8, 0xae, 0xae, 0xe5, 0xaf, 0xbc, 0xe8, 0x88, 0xaa, 0xe5, 0x85,
-  0x88, 0xe7, 0x94, 0x9f, 0xe8, 0x81, 0x94, 0xe7, 0x9b, 0x9f, 0xe5, 0x8f, 0xaf,
-  0xe6, 0x98, 0xaf, 0xe5, 0x95, 0x8f, 0xe9, 0xa1, 0x8c, 0xe7, 0xbb, 0x93, 0xe6,
-  0x9e, 0x84, 0xe4, 0xbd, 0x9c, 0xe7, 0x94, 0xa8, 0xe8, 0xb0, 0x83, 0xe6, 0x9f,
-  0xa5, 0xe8, 0xb3, 0x87, 0xe6, 0x96, 0x99, 0xe8, 0x87, 0xaa, 0xe5, 0x8a, 0xa8,
-  0xe8, 0xb4, 0x9f, 0xe8, 0xb4, 0xa3, 0xe5, 0x86, 0x9c, 0xe4, 0xb8, 0x9a, 0xe8,
-  0xae, 0xbf, 0xe9, 0x97, 0xae, 0xe5, 0xae, 0x9e, 0xe6, 0x96, 0xbd, 0xe6, 0x8e,
-  0xa5, 0xe5, 0x8f, 0x97, 0xe8, 0xae, 0xa8, 0xe8, 0xae, 0xba, 0xe9, 0x82, 0xa3,
-  0xe4, 0xb8, 0xaa, 0xe5, 0x8f, 0x8d, 0xe9, 0xa6, 0x88, 0xe5, 0x8a, 0xa0, 0xe5,
-  0xbc, 0xba, 0xe5, 0xa5, 0xb3, 0xe6, 0x80, 0xa7, 0xe8, 0x8c, 0x83, 0xe5, 0x9b,
-  0xb4, 0xe6, 0x9c, 0x8d, 0xe5, 0x8b, 0x99, 0xe4, 0xbc, 0x91, 0xe9, 0x97, 0xb2,
-  0xe4, 0xbb, 0x8a, 0xe6, 0x97, 0xa5, 0xe5, 0xae, 0xa2, 0xe6, 0x9c, 0x8d, 0xe8,
-  0xa7, 0x80, 0xe7, 0x9c, 0x8b, 0xe5, 0x8f, 0x82, 0xe5, 0x8a, 0xa0, 0xe7, 0x9a,
-  0x84, 0xe8, 0xaf, 0x9d, 0xe4, 0xb8, 0x80, 0xe7, 0x82, 0xb9, 0xe4, 0xbf, 0x9d,
-  0xe8, 0xaf, 0x81, 0xe5, 0x9b, 0xbe, 0xe4, 0xb9, 0xa6, 0xe6, 0x9c, 0x89, 0xe6,
-  0x95, 0x88, 0xe6, 0xb5, 0x8b, 0xe8, 0xaf, 0x95, 0xe7, 0xa7, 0xbb, 0xe5, 0x8a,
-  0xa8, 0xe6, 0x89, 0x8d, 0xe8, 0x83, 0xbd, 0xe5, 0x86, 0xb3, 0xe5, 0xae, 0x9a,
-  0xe8, 0x82, 0xa1, 0xe7, 0xa5, 0xa8, 0xe4, 0xb8, 0x8d, 0xe6, 0x96, 0xad, 0xe9,
-  0x9c, 0x80, 0xe6, 0xb1, 0x82, 0xe4, 0xb8, 0x8d, 0xe5, 0xbe, 0x97, 0xe5, 0x8a,
-  0x9e, 0xe6, 0xb3, 0x95, 0xe4, 0xb9, 0x8b, 0xe9, 0x97, 0xb4, 0xe9, 0x87, 0x87,
-  0xe7, 0x94, 0xa8, 0xe8, 0x90, 0xa5, 0xe9, 0x94, 0x80, 0xe6, 0x8a, 0x95, 0xe8,
-  0xaf, 0x89, 0xe7, 0x9b, 0xae, 0xe6, 0xa0, 0x87, 0xe7, 0x88, 0xb1, 0xe6, 0x83,
-  0x85, 0xe6, 0x91, 0x84, 0xe5, 0xbd, 0xb1, 0xe6, 0x9c, 0x89, 0xe4, 0xba, 0x9b,
-  0xe8, 0xa4, 0x87, 0xe8, 0xa3, 0xbd, 0xe6, 0x96, 0x87, 0xe5, 0xad, 0xa6, 0xe6,
-  0x9c, 0xba, 0xe4, 0xbc, 0x9a, 0xe6, 0x95, 0xb0, 0xe5, 0xad, 0x97, 0xe8, 0xa3,
-  0x85, 0xe4, 0xbf, 0xae, 0xe8, 0xb4, 0xad, 0xe7, 0x89, 0xa9, 0xe5, 0x86, 0x9c,
-  0xe6, 0x9d, 0x91, 0xe5, 0x85, 0xa8, 0xe9, 0x9d, 0xa2, 0xe7, 0xb2, 0xbe, 0xe5,
-  0x93, 0x81, 0xe5, 0x85, 0xb6, 0xe5, 0xae, 0x9e, 0xe4, 0xba, 0x8b, 0xe6, 0x83,
-  0x85, 0xe6, 0xb0, 0xb4, 0xe5, 0xb9, 0xb3, 0xe6, 0x8f, 0x90, 0xe7, 0xa4, 0xba,
-  0xe4, 0xb8, 0x8a, 0xe5, 0xb8, 0x82, 0xe8, 0xb0, 0xa2, 0xe8, 0xb0, 0xa2, 0xe6,
-  0x99, 0xae, 0xe9, 0x80, 0x9a, 0xe6, 0x95, 0x99, 0xe5, 0xb8, 0x88, 0xe4, 0xb8,
-  0x8a, 0xe4, 0xbc, 0xa0, 0xe7, 0xb1, 0xbb, 0xe5, 0x88, 0xab, 0xe6, 0xad, 0x8c,
-  0xe6, 0x9b, 0xb2, 0xe6, 0x8b, 0xa5, 0xe6, 0x9c, 0x89, 0xe5, 0x88, 0x9b, 0xe6,
-  0x96, 0xb0, 0xe9, 0x85, 0x8d, 0xe4, 0xbb, 0xb6, 0xe5, 0x8f, 0xaa, 0xe8, 0xa6,
-  0x81, 0xe6, 0x97, 0xb6, 0xe4, 0xbb, 0xa3, 0xe8, 0xb3, 0x87, 0xe8, 0xa8, 0x8a,
-  0xe8, 0xbe, 0xbe, 0xe5, 0x88, 0xb0, 0xe4, 0xba, 0xba, 0xe7, 0x94, 0x9f, 0xe8,
-  0xae, 0xa2, 0xe9, 0x98, 0x85, 0xe8, 0x80, 0x81, 0xe5, 0xb8, 0x88, 0xe5, 0xb1,
-  0x95, 0xe7, 0xa4, 0xba, 0xe5, 0xbf, 0x83, 0xe7, 0x90, 0x86, 0xe8, 0xb4, 0xb4,
-  0xe5, 0xad, 0x90, 0xe7, 0xb6, 0xb2, 0xe7, 0xab, 0x99, 0xe4, 0xb8, 0xbb, 0xe9,
-  0xa1, 0x8c, 0xe8, 0x87, 0xaa, 0xe7, 0x84, 0xb6, 0xe7, 0xba, 0xa7, 0xe5, 0x88,
-  0xab, 0xe7, 0xae, 0x80, 0xe5, 0x8d, 0x95, 0xe6, 0x94, 0xb9, 0xe9, 0x9d, 0xa9,
-  0xe9, 0x82, 0xa3, 0xe4, 0xba, 0x9b, 0xe6, 0x9d, 0xa5, 0xe8, 0xaf, 0xb4, 0xe6,
-  0x89, 0x93, 0xe5, 0xbc, 0x80, 0xe4, 0xbb, 0xa3, 0xe7, 0xa0, 0x81, 0xe5, 0x88,
-  0xa0, 0xe9, 0x99, 0xa4, 0xe8, 0xaf, 0x81, 0xe5, 0x88, 0xb8, 0xe8, 0x8a, 0x82,
-  0xe7, 0x9b, 0xae, 0xe9, 0x87, 0x8d, 0xe7, 0x82, 0xb9, 0xe6, 0xac, 0xa1, 0xe6,
-  0x95, 0xb8, 0xe5, 0xa4, 0x9a, 0xe5, 0xb0, 0x91, 0xe8, 0xa7, 0x84, 0xe5, 0x88,
-  0x92, 0xe8, 0xb5, 0x84, 0xe9, 0x87, 0x91, 0xe6, 0x89, 0xbe, 0xe5, 0x88, 0xb0,
-  0xe4, 0xbb, 0xa5, 0xe5, 0x90, 0x8e, 0xe5, 0xa4, 0xa7, 0xe5, 0x85, 0xa8, 0xe4,
-  0xb8, 0xbb, 0xe9, 0xa1, 0xb5, 0xe6, 0x9c, 0x80, 0xe4, 0xbd, 0xb3, 0xe5, 0x9b,
-  0x9e, 0xe7, 0xad, 0x94, 0xe5, 0xa4, 0xa9, 0xe4, 0xb8, 0x8b, 0xe4, 0xbf, 0x9d,
-  0xe9, 0x9a, 0x9c, 0xe7, 0x8e, 0xb0, 0xe4, 0xbb, 0xa3, 0xe6, 0xa3, 0x80, 0xe6,
-  0x9f, 0xa5, 0xe6, 0x8a, 0x95, 0xe7, 0xa5, 0xa8, 0xe5, 0xb0, 0x8f, 0xe6, 0x97,
-  0xb6, 0xe6, 0xb2, 0x92, 0xe6, 0x9c, 0x89, 0xe6, 0xad, 0xa3, 0xe5, 0xb8, 0xb8,
-  0xe7, 0x94, 0x9a, 0xe8, 0x87, 0xb3, 0xe4, 0xbb, 0xa3, 0xe7, 0x90, 0x86, 0xe7,
-  0x9b, 0xae, 0xe5, 0xbd, 0x95, 0xe5, 0x85, 0xac, 0xe5, 0xbc, 0x80, 0xe5, 0xa4,
-  0x8d, 0xe5, 0x88, 0xb6, 0xe9, 0x87, 0x91, 0xe8, 0x9e, 0x8d, 0xe5, 0xb9, 0xb8,
-  0xe7, 0xa6, 0x8f, 0xe7, 0x89, 0x88, 0xe6, 0x9c, 0xac, 0xe5, 0xbd, 0xa2, 0xe6,
-  0x88, 0x90, 0xe5, 0x87, 0x86, 0xe5, 0xa4, 0x87, 0xe8, 0xa1, 0x8c, 0xe6, 0x83,
-  0x85, 0xe5, 0x9b, 0x9e, 0xe5, 0x88, 0xb0, 0xe6, 0x80, 0x9d, 0xe6, 0x83, 0xb3,
-  0xe6, 0x80, 0x8e, 0xe6, 0xa0, 0xb7, 0xe5, 0x8d, 0x8f, 0xe8, 0xae, 0xae, 0xe8,
-  0xae, 0xa4, 0xe8, 0xaf, 0x81, 0xe6, 0x9c, 0x80, 0xe5, 0xa5, 0xbd, 0xe4, 0xba,
-  0xa7, 0xe7, 0x94, 0x9f, 0xe6, 0x8c, 0x89, 0xe7, 0x85, 0xa7, 0xe6, 0x9c, 0x8d,
-  0xe8, 0xa3, 0x85, 0xe5, 0xb9, 0xbf, 0xe4, 0xb8, 0x9c, 0xe5, 0x8a, 0xa8, 0xe6,
-  0xbc, 0xab, 0xe9, 0x87, 0x87, 0xe8, 0xb4, 0xad, 0xe6, 0x96, 0xb0, 0xe6, 0x89,
-  0x8b, 0xe7, 0xbb, 0x84, 0xe5, 0x9b, 0xbe, 0xe9, 0x9d, 0xa2, 0xe6, 0x9d, 0xbf,
-  0xe5, 0x8f, 0x82, 0xe8, 0x80, 0x83, 0xe6, 0x94, 0xbf, 0xe6, 0xb2, 0xbb, 0xe5,
-  0xae, 0xb9, 0xe6, 0x98, 0x93, 0xe5, 0xa4, 0xa9, 0xe5, 0x9c, 0xb0, 0xe5, 0x8a,
-  0xaa, 0xe5, 0x8a, 0x9b, 0xe4, 0xba, 0xba, 0xe4, 0xbb, 0xac, 0xe5, 0x8d, 0x87,
-  0xe7, 0xba, 0xa7, 0xe9, 0x80, 0x9f, 0xe5, 0xba, 0xa6, 0xe4, 0xba, 0xba, 0xe7,
-  0x89, 0xa9, 0xe8, 0xb0, 0x83, 0xe6, 0x95, 0xb4, 0xe6, 0xb5, 0x81, 0xe8, 0xa1,
-  0x8c, 0xe9, 0x80, 0xa0, 0xe6, 0x88, 0x90, 0xe6, 0x96, 0x87, 0xe5, 0xad, 0x97,
-  0xe9, 0x9f, 0xa9, 0xe5, 0x9b, 0xbd, 0xe8, 0xb4, 0xb8, 0xe6, 0x98, 0x93, 0xe5,
-  0xbc, 0x80, 0xe5, 0xb1, 0x95, 0xe7, 0x9b, 0xb8, 0xe9, 0x97, 0x9c, 0xe8, 0xa1,
-  0xa8, 0xe7, 0x8e, 0xb0, 0xe5, 0xbd, 0xb1, 0xe8, 0xa7, 0x86, 0xe5, 0xa6, 0x82,
-  0xe6, 0xad, 0xa4, 0xe7, 0xbe, 0x8e, 0xe5, 0xae, 0xb9, 0xe5, 0xa4, 0xa7, 0xe5,
-  0xb0, 0x8f, 0xe6, 0x8a, 0xa5, 0xe9, 0x81, 0x93, 0xe6, 0x9d, 0xa1, 0xe6, 0xac,
-  0xbe, 0xe5, 0xbf, 0x83, 0xe6, 0x83, 0x85, 0xe8, 0xae, 0xb8, 0xe5, 0xa4, 0x9a,
-  0xe6, 0xb3, 0x95, 0xe8, 0xa7, 0x84, 0xe5, 0xae, 0xb6, 0xe5, 0xb1, 0x85, 0xe4,
-  0xb9, 0xa6, 0xe5, 0xba, 0x97, 0xe8, 0xbf, 0x9e, 0xe6, 0x8e, 0xa5, 0xe7, 0xab,
-  0x8b, 0xe5, 0x8d, 0xb3, 0xe4, 0xb8, 0xbe, 0xe6, 0x8a, 0xa5, 0xe6, 0x8a, 0x80,
-  0xe5, 0xb7, 0xa7, 0xe5, 0xa5, 0xa5, 0xe8, 0xbf, 0x90, 0xe7, 0x99, 0xbb, 0xe5,
-  0x85, 0xa5, 0xe4, 0xbb, 0xa5, 0xe6, 0x9d, 0xa5, 0xe7, 0x90, 0x86, 0xe8, 0xae,
-  0xba, 0xe4, 0xba, 0x8b, 0xe4, 0xbb, 0xb6, 0xe8, 0x87, 0xaa, 0xe7, 0x94, 0xb1,
-  0xe4, 0xb8, 0xad, 0xe5, 0x8d, 0x8e, 0xe5, 0x8a, 0x9e, 0xe5, 0x85, 0xac, 0xe5,
-  0xa6, 0x88, 0xe5, 0xa6, 0x88, 0xe7, 0x9c, 0x9f, 0xe6, 0xad, 0xa3, 0xe4, 0xb8,
-  0x8d, 0xe9, 0x94, 0x99, 0xe5, 0x85, 0xa8, 0xe6, 0x96, 0x87, 0xe5, 0x90, 0x88,
-  0xe5, 0x90, 0x8c, 0xe4, 0xbb, 0xb7, 0xe5, 0x80, 0xbc, 0xe5, 0x88, 0xab, 0xe4,
-  0xba, 0xba, 0xe7, 0x9b, 0x91, 0xe7, 0x9d, 0xa3, 0xe5, 0x85, 0xb7, 0xe4, 0xbd,
-  0x93, 0xe4, 0xb8, 0x96, 0xe7, 0xba, 0xaa, 0xe5, 0x9b, 0xa2, 0xe9, 0x98, 0x9f,
-  0xe5, 0x88, 0x9b, 0xe4, 0xb8, 0x9a, 0xe6, 0x89, 0xbf, 0xe6, 0x8b, 0x85, 0xe5,
-  0xa2, 0x9e, 0xe9, 0x95, 0xbf, 0xe6, 0x9c, 0x89, 0xe4, 0xba, 0xba, 0xe4, 0xbf,
-  0x9d, 0xe6, 0x8c, 0x81, 0xe5, 0x95, 0x86, 0xe5, 0xae, 0xb6, 0xe7, 0xbb, 0xb4,
-  0xe4, 0xbf, 0xae, 0xe5, 0x8f, 0xb0, 0xe6, 0xb9, 0xbe, 0xe5, 0xb7, 0xa6, 0xe5,
-  0x8f, 0xb3, 0xe8, 0x82, 0xa1, 0xe4, 0xbb, 0xbd, 0xe7, 0xad, 0x94, 0xe6, 0xa1,
-  0x88, 0xe5, 0xae, 0x9e, 0xe9, 0x99, 0x85, 0xe7, 0x94, 0xb5, 0xe4, 0xbf, 0xa1,
-  0xe7, 0xbb, 0x8f, 0xe7, 0x90, 0x86, 0xe7, 0x94, 0x9f, 0xe5, 0x91, 0xbd, 0xe5,
-  0xae, 0xa3, 0xe4, 0xbc, 0xa0, 0xe4, 0xbb, 0xbb, 0xe5, 0x8a, 0xa1, 0xe6, 0xad,
-  0xa3, 0xe5, 0xbc, 0x8f, 0xe7, 0x89, 0xb9, 0xe8, 0x89, 0xb2, 0xe4, 0xb8, 0x8b,
-  0xe6, 0x9d, 0xa5, 0xe5, 0x8d, 0x8f, 0xe4, 0xbc, 0x9a, 0xe5, 0x8f, 0xaa, 0xe8,
-  0x83, 0xbd, 0xe5, 0xbd, 0x93, 0xe7, 0x84, 0xb6, 0xe9, 0x87, 0x8d, 0xe6, 0x96,
-  0xb0, 0xe5, 0x85, 0xa7, 0xe5, 0xae, 0xb9, 0xe6, 0x8c, 0x87, 0xe5, 0xaf, 0xbc,
-  0xe8, 0xbf, 0x90, 0xe8, 0xa1, 0x8c, 0xe6, 0x97, 0xa5, 0xe5, 0xbf, 0x97, 0xe8,
-  0xb3, 0xa3, 0xe5, 0xae, 0xb6, 0xe8, 0xb6, 0x85, 0xe8, 0xbf, 0x87, 0xe5, 0x9c,
-  0x9f, 0xe5, 0x9c, 0xb0, 0xe6, 0xb5, 0x99, 0xe6, 0xb1, 0x9f, 0xe6, 0x94, 0xaf,
-  0xe4, 0xbb, 0x98, 0xe6, 0x8e, 0xa8, 0xe5, 0x87, 0xba, 0xe7, 0xab, 0x99, 0xe9,
-  0x95, 0xbf, 0xe6, 0x9d, 0xad, 0xe5, 0xb7, 0x9e, 0xe6, 0x89, 0xa7, 0xe8, 0xa1,
-  0x8c, 0xe5, 0x88, 0xb6, 0xe9, 0x80, 0xa0, 0xe4, 0xb9, 0x8b, 0xe4, 0xb8, 0x80,
-  0xe6, 0x8e, 0xa8, 0xe5, 0xb9, 0xbf, 0xe7, 0x8e, 0xb0, 0xe5, 0x9c, 0xba, 0xe6,
-  0x8f, 0x8f, 0xe8, 0xbf, 0xb0, 0xe5, 0x8f, 0x98, 0xe5, 0x8c, 0x96, 0xe4, 0xbc,
-  0xa0, 0xe7, 0xbb, 0x9f, 0xe6, 0xad, 0x8c, 0xe6, 0x89, 0x8b, 0xe4, 0xbf, 0x9d,
-  0xe9, 0x99, 0xa9, 0xe8, 0xaf, 0xbe, 0xe7, 0xa8, 0x8b, 0xe5, 0x8c, 0xbb, 0xe7,
-  0x96, 0x97, 0xe7, 0xbb, 0x8f, 0xe8, 0xbf, 0x87, 0xe8, 0xbf, 0x87, 0xe5, 0x8e,
-  0xbb, 0xe4, 0xb9, 0x8b, 0xe5, 0x89, 0x8d, 0xe6, 0x94, 0xb6, 0xe5, 0x85, 0xa5,
-  0xe5, 0xb9, 0xb4, 0xe5, 0xba, 0xa6, 0xe6, 0x9d, 0x82, 0xe5, 0xbf, 0x97, 0xe7,
-  0xbe, 0x8e, 0xe4, 0xb8, 0xbd, 0xe6, 0x9c, 0x80, 0xe9, 0xab, 0x98, 0xe7, 0x99,
-  0xbb, 0xe9, 0x99, 0x86, 0xe6, 0x9c, 0xaa, 0xe6, 0x9d, 0xa5, 0xe5, 0x8a, 0xa0,
-  0xe5, 0xb7, 0xa5, 0xe5, 0x85, 0x8d, 0xe8, 0xb4, 0xa3, 0xe6, 0x95, 0x99, 0xe7,
-  0xa8, 0x8b, 0xe7, 0x89, 0x88, 0xe5, 0x9d, 0x97, 0xe8, 0xba, 0xab, 0xe4, 0xbd,
-  0x93, 0xe9, 0x87, 0x8d, 0xe5, 0xba, 0x86, 0xe5, 0x87, 0xba, 0xe5, 0x94, 0xae,
-  0xe6, 0x88, 0x90, 0xe6, 0x9c, 0xac, 0xe5, 0xbd, 0xa2, 0xe5, 0xbc, 0x8f, 0xe5,
-  0x9c, 0x9f, 0xe8, 0xb1, 0x86, 0xe5, 0x87, 0xba, 0xe5, 0x83, 0xb9, 0xe4, 0xb8,
-  0x9c, 0xe6, 0x96, 0xb9, 0xe9, 0x82, 0xae, 0xe7, 0xae, 0xb1, 0xe5, 0x8d, 0x97,
-  0xe4, 0xba, 0xac, 0xe6, 0xb1, 0x82, 0xe8, 0x81, 0x8c, 0xe5, 0x8f, 0x96, 0xe5,
-  0xbe, 0x97, 0xe8, 0x81, 0x8c, 0xe4, 0xbd, 0x8d, 0xe7, 0x9b, 0xb8, 0xe4, 0xbf,
-  0xa1, 0xe9, 0xa1, 0xb5, 0xe9, 0x9d, 0xa2, 0xe5, 0x88, 0x86, 0xe9, 0x92, 0x9f,
-  0xe7, 0xbd, 0x91, 0xe9, 0xa1, 0xb5, 0xe7, 0xa1, 0xae, 0xe5, 0xae, 0x9a, 0xe5,
-  0x9b, 0xbe, 0xe4, 0xbe, 0x8b, 0xe7, 0xbd, 0x91, 0xe5, 0x9d, 0x80, 0xe7, 0xa7,
-  0xaf, 0xe6, 0x9e, 0x81, 0xe9, 0x94, 0x99, 0xe8, 0xaf, 0xaf, 0xe7, 0x9b, 0xae,
-  0xe7, 0x9a, 0x84, 0xe5, 0xae, 0x9d, 0xe8, 0xb4, 0x9d, 0xe6, 0x9c, 0xba, 0xe5,
-  0x85, 0xb3, 0xe9, 0xa3, 0x8e, 0xe9, 0x99, 0xa9, 0xe6, 0x8e, 0x88, 0xe6, 0x9d,
-  0x83, 0xe7, 0x97, 0x85, 0xe6, 0xaf, 0x92, 0xe5, 0xae, 0xa0, 0xe7, 0x89, 0xa9,
-  0xe9, 0x99, 0xa4, 0xe4, 0xba, 0x86, 0xe8, 0xa9, 0x95, 0xe8, 0xab, 0x96, 0xe7,
-  0x96, 0xbe, 0xe7, 0x97, 0x85, 0xe5, 0x8f, 0x8a, 0xe6, 0x97, 0xb6, 0xe6, 0xb1,
-  0x82, 0xe8, 0xb4, 0xad, 0xe7, 0xab, 0x99, 0xe7, 0x82, 0xb9, 0xe5, 0x84, 0xbf,
-  0xe7, 0xab, 0xa5, 0xe6, 0xaf, 0x8f, 0xe5, 0xa4, 0xa9, 0xe4, 0xb8, 0xad, 0xe5,
-  0xa4, 0xae, 0xe8, 0xae, 0xa4, 0xe8, 0xaf, 0x86, 0xe6, 0xaf, 0x8f, 0xe4, 0xb8,
-  0xaa, 0xe5, 0xa4, 0xa9, 0xe6, 0xb4, 0xa5, 0xe5, 0xad, 0x97, 0xe4, 0xbd, 0x93,
-  0xe5, 0x8f, 0xb0, 0xe7, 0x81, 0xa3, 0xe7, 0xbb, 0xb4, 0xe6, 0x8a, 0xa4, 0xe6,
-  0x9c, 0xac, 0xe9, 0xa1, 0xb5, 0xe4, 0xb8, 0xaa, 0xe6, 0x80, 0xa7, 0xe5, 0xae,
-  0x98, 0xe6, 0x96, 0xb9, 0xe5, 0xb8, 0xb8, 0xe8, 0xa7, 0x81, 0xe7, 0x9b, 0xb8,
-  0xe6, 0x9c, 0xba, 0xe6, 0x88, 0x98, 0xe7, 0x95, 0xa5, 0xe5, 0xba, 0x94, 0xe5,
-  0xbd, 0x93, 0xe5, 0xbe, 0x8b, 0xe5, 0xb8, 0x88, 0xe6, 0x96, 0xb9, 0xe4, 0xbe,
-  0xbf, 0xe6, 0xa0, 0xa1, 0xe5, 0x9b, 0xad, 0xe8, 0x82, 0xa1, 0xe5, 0xb8, 0x82,
-  0xe6, 0x88, 0xbf, 0xe5, 0xb1, 0x8b, 0xe6, 0xa0, 0x8f, 0xe7, 0x9b, 0xae, 0xe5,
-  0x91, 0x98, 0xe5, 0xb7, 0xa5, 0xe5, 0xaf, 0xbc, 0xe8, 0x87, 0xb4, 0xe7, 0xaa,
-  0x81, 0xe7, 0x84, 0xb6, 0xe9, 0x81, 0x93, 0xe5, 0x85, 0xb7, 0xe6, 0x9c, 0xac,
-  0xe7, 0xbd, 0x91, 0xe7, 0xbb, 0x93, 0xe5, 0x90, 0x88, 0xe6, 0xa1, 0xa3, 0xe6,
-  0xa1, 0x88, 0xe5, 0x8a, 0xb3, 0xe5, 0x8a, 0xa8, 0xe5, 0x8f, 0xa6, 0xe5, 0xa4,
-  0x96, 0xe7, 0xbe, 0x8e, 0xe5, 0x85, 0x83, 0xe5, 0xbc, 0x95, 0xe8, 0xb5, 0xb7,
-  0xe6, 0x94, 0xb9, 0xe5, 0x8f, 0x98, 0xe7, 0xac, 0xac, 0xe5, 0x9b, 0x9b, 0xe4,
-  0xbc, 0x9a, 0xe8, 0xae, 0xa1, 0xe8, 0xaa, 0xaa, 0xe6, 0x98, 0x8e, 0xe9, 0x9a,
-  0x90, 0xe7, 0xa7, 0x81, 0xe5, 0xae, 0x9d, 0xe5, 0xae, 0x9d, 0xe8, 0xa7, 0x84,
-  0xe8, 0x8c, 0x83, 0xe6, 0xb6, 0x88, 0xe8, 0xb4, 0xb9, 0xe5, 0x85, 0xb1, 0xe5,
-  0x90, 0x8c, 0xe5, 0xbf, 0x98, 0xe8, 0xae, 0xb0, 0xe4, 0xbd, 0x93, 0xe7, 0xb3,
-  0xbb, 0xe5, 0xb8, 0xa6, 0xe6, 0x9d, 0xa5, 0xe5, 0x90, 0x8d, 0xe5, 0xad, 0x97,
-  0xe7, 0x99, 0xbc, 0xe8, 0xa1, 0xa8, 0xe5, 0xbc, 0x80, 0xe6, 0x94, 0xbe, 0xe5,
-  0x8a, 0xa0, 0xe7, 0x9b, 0x9f, 0xe5, 0x8f, 0x97, 0xe5, 0x88, 0xb0, 0xe4, 0xba,
-  0x8c, 0xe6, 0x89, 0x8b, 0xe5, 0xa4, 0xa7, 0xe9, 0x87, 0x8f, 0xe6, 0x88, 0x90,
-  0xe4, 0xba, 0xba, 0xe6, 0x95, 0xb0, 0xe9, 0x87, 0x8f, 0xe5, 0x85, 0xb1, 0xe4,
-  0xba, 0xab, 0xe5, 0x8c, 0xba, 0xe5, 0x9f, 0x9f, 0xe5, 0xa5, 0xb3, 0xe5, 0xad,
-  0xa9, 0xe5, 0x8e, 0x9f, 0xe5, 0x88, 0x99, 0xe6, 0x89, 0x80, 0xe5, 0x9c, 0xa8,
-  0xe7, 0xbb, 0x93, 0xe6, 0x9d, 0x9f, 0xe9, 0x80, 0x9a, 0xe4, 0xbf, 0xa1, 0xe8,
-  0xb6, 0x85, 0xe7, 0xba, 0xa7, 0xe9, 0x85, 0x8d, 0xe7, 0xbd, 0xae, 0xe5, 0xbd,
-  0x93, 0xe6, 0x97, 0xb6, 0xe4, 0xbc, 0x98, 0xe7, 0xa7, 0x80, 0xe6, 0x80, 0xa7,
-  0xe6, 0x84, 0x9f, 0xe6, 0x88, 0xbf, 0xe4, 0xba, 0xa7, 0xe9, 0x81, 0x8a, 0xe6,
-  0x88, 0xb2, 0xe5, 0x87, 0xba, 0xe5, 0x8f, 0xa3, 0xe6, 0x8f, 0x90, 0xe4, 0xba,
-  0xa4, 0xe5, 0xb0, 0xb1, 0xe4, 0xb8, 0x9a, 0xe4, 0xbf, 0x9d, 0xe5, 0x81, 0xa5,
-  0xe7, 0xa8, 0x8b, 0xe5, 0xba, 0xa6, 0xe5, 0x8f, 0x82, 0xe6, 0x95, 0xb0, 0xe4,
-  0xba, 0x8b, 0xe4, 0xb8, 0x9a, 0xe6, 0x95, 0xb4, 0xe4, 0xb8, 0xaa, 0xe5, 0xb1,
-  0xb1, 0xe4, 0xb8, 0x9c, 0xe6, 0x83, 0x85, 0xe6, 0x84, 0x9f, 0xe7, 0x89, 0xb9,
-  0xe6, 0xae, 0x8a, 0xe5, 0x88, 0x86, 0xe9, 0xa1, 0x9e, 0xe6, 0x90, 0x9c, 0xe5,
-  0xb0, 0x8b, 0xe5, 0xb1, 0x9e, 0xe4, 0xba, 0x8e, 0xe9, 0x97, 0xa8, 0xe6, 0x88,
-  0xb7, 0xe8, 0xb4, 0xa2, 0xe5, 0x8a, 0xa1, 0xe5, 0xa3, 0xb0, 0xe9, 0x9f, 0xb3,
-  0xe5, 0x8f, 0x8a, 0xe5, 0x85, 0xb6, 0xe8, 0xb4, 0xa2, 0xe7, 0xbb, 0x8f, 0xe5,
-  0x9d, 0x9a, 0xe6, 0x8c, 0x81, 0xe5, 0xb9, 0xb2, 0xe9, 0x83, 0xa8, 0xe6, 0x88,
-  0x90, 0xe7, 0xab, 0x8b, 0xe5, 0x88, 0xa9, 0xe7, 0x9b, 0x8a, 0xe8, 0x80, 0x83,
-  0xe8, 0x99, 0x91, 0xe6, 0x88, 0x90, 0xe9, 0x83, 0xbd, 0xe5, 0x8c, 0x85, 0xe8,
-  0xa3, 0x85, 0xe7, 0x94, 0xa8, 0xe6, 0x88, 0xb6, 0xe6, 0xaf, 0x94, 0xe8, 0xb5,
-  0x9b, 0xe6, 0x96, 0x87, 0xe6, 0x98, 0x8e, 0xe6, 0x8b, 0x9b, 0xe5, 0x95, 0x86,
-  0xe5, 0xae, 0x8c, 0xe6, 0x95, 0xb4, 0xe7, 0x9c, 0x9f, 0xe6, 0x98, 0xaf, 0xe7,
-  0x9c, 0xbc, 0xe7, 0x9d, 0x9b, 0xe4, 0xbc, 0x99, 0xe4, 0xbc, 0xb4, 0xe5, 0xa8,
-  0x81, 0xe6, 0x9c, 0x9b, 0xe9, 0xa2, 0x86, 0xe5, 0x9f, 0x9f, 0xe5, 0x8d, 0xab,
-  0xe7, 0x94, 0x9f, 0xe4, 0xbc, 0x98, 0xe6, 0x83, 0xa0, 0xe8, 0xab, 0x96, 0xe5,
-  0xa3, 0x87, 0xe5, 0x85, 0xac, 0xe5, 0x85, 0xb1, 0xe8, 0x89, 0xaf, 0xe5, 0xa5,
-  0xbd, 0xe5, 0x85, 0x85, 0xe5, 0x88, 0x86, 0xe7, 0xac, 0xa6, 0xe5, 0x90, 0x88,
-  0xe9, 0x99, 0x84, 0xe4, 0xbb, 0xb6, 0xe7, 0x89, 0xb9, 0xe7, 0x82, 0xb9, 0xe4,
-  0xb8, 0x8d, 0xe5, 0x8f, 0xaf, 0xe8, 0x8b, 0xb1, 0xe6, 0x96, 0x87, 0xe8, 0xb5,
-  0x84, 0xe4, 0xba, 0xa7, 0xe6, 0xa0, 0xb9, 0xe6, 0x9c, 0xac, 0xe6, 0x98, 0x8e,
-  0xe6, 0x98, 0xbe, 0xe5, 0xaf, 0x86, 0xe7, 0xa2, 0xbc, 0xe5, 0x85, 0xac, 0xe4,
-  0xbc, 0x97, 0xe6, 0xb0, 0x91, 0xe6, 0x97, 0x8f, 0xe6, 0x9b, 0xb4, 0xe5, 0x8a,
-  0xa0, 0xe4, 0xba, 0xab, 0xe5, 0x8f, 0x97, 0xe5, 0x90, 0x8c, 0xe5, 0xad, 0xa6,
-  0xe5, 0x90, 0xaf, 0xe5, 0x8a, 0xa8, 0xe9, 0x80, 0x82, 0xe5, 0x90, 0x88, 0xe5,
-  0x8e, 0x9f, 0xe6, 0x9d, 0xa5, 0xe9, 0x97, 0xae, 0xe7, 0xad, 0x94, 0xe6, 0x9c,
-  0xac, 0xe6, 0x96, 0x87, 0xe7, 0xbe, 0x8e, 0xe9, 0xa3, 0x9f, 0xe7, 0xbb, 0xbf,
-  0xe8, 0x89, 0xb2, 0xe7, 0xa8, 0xb3, 0xe5, 0xae, 0x9a, 0xe7, 0xbb, 0x88, 0xe4,
-  0xba, 0x8e, 0xe7, 0x94, 0x9f, 0xe7, 0x89, 0xa9, 0xe4, 0xbe, 0x9b, 0xe6, 0xb1,
-  0x82, 0xe6, 0x90, 0x9c, 0xe7, 0x8b, 0x90, 0xe5, 0x8a, 0x9b, 0xe9, 0x87, 0x8f,
-  0xe4, 0xb8, 0xa5, 0xe9, 0x87, 0x8d, 0xe6, 0xb0, 0xb8, 0xe8, 0xbf, 0x9c, 0xe5,
-  0x86, 0x99, 0xe7, 0x9c, 0x9f, 0xe6, 0x9c, 0x89, 0xe9, 0x99, 0x90, 0xe7, 0xab,
-  0x9e, 0xe4, 0xba, 0x89, 0xe5, 0xaf, 0xb9, 0xe8, 0xb1, 0xa1, 0xe8, 0xb4, 0xb9,
-  0xe7, 0x94, 0xa8, 0xe4, 0xb8, 0x8d, 0xe5, 0xa5, 0xbd, 0xe7, 0xbb, 0x9d, 0xe5,
-  0xaf, 0xb9, 0xe5, 0x8d, 0x81, 0xe5, 0x88, 0x86, 0xe4, 0xbf, 0x83, 0xe8, 0xbf,
-  0x9b, 0xe7, 0x82, 0xb9, 0xe8, 0xaf, 0x84, 0xe5, 0xbd, 0xb1, 0xe9, 0x9f, 0xb3,
-  0xe4, 0xbc, 0x98, 0xe5, 0x8a, 0xbf, 0xe4, 0xb8, 0x8d, 0xe5, 0xb0, 0x91, 0xe6,
-  0xac, 0xa3, 0xe8, 0xb5, 0x8f, 0xe5, 0xb9, 0xb6, 0xe4, 0xb8, 0x94, 0xe6, 0x9c,
-  0x89, 0xe7, 0x82, 0xb9, 0xe6, 0x96, 0xb9, 0xe5, 0x90, 0x91, 0xe5, 0x85, 0xa8,
-  0xe6, 0x96, 0xb0, 0xe4, 0xbf, 0xa1, 0xe7, 0x94, 0xa8, 0xe8, 0xae, 0xbe, 0xe6,
-  0x96, 0xbd, 0xe5, 0xbd, 0xa2, 0xe8, 0xb1, 0xa1, 0xe8, 0xb5, 0x84, 0xe6, 0xa0,
-  0xbc, 0xe7, 0xaa, 0x81, 0xe7, 0xa0, 0xb4, 0xe9, 0x9a, 0x8f, 0xe7, 0x9d, 0x80,
-  0xe9, 0x87, 0x8d, 0xe5, 0xa4, 0xa7, 0xe4, 0xba, 0x8e, 0xe6, 0x98, 0xaf, 0xe6,
-  0xaf, 0x95, 0xe4, 0xb8, 0x9a, 0xe6, 0x99, 0xba, 0xe8, 0x83, 0xbd, 0xe5, 0x8c,
-  0x96, 0xe5, 0xb7, 0xa5, 0xe5, 0xae, 0x8c, 0xe7, 0xbe, 0x8e, 0xe5, 0x95, 0x86,
-  0xe5, 0x9f, 0x8e, 0xe7, 0xbb, 0x9f, 0xe4, 0xb8, 0x80, 0xe5, 0x87, 0xba, 0xe7,
-  0x89, 0x88, 0xe6, 0x89, 0x93, 0xe9, 0x80, 0xa0, 0xe7, 0x94, 0xa2, 0xe5, 0x93,
-  0x81, 0xe6, 0xa6, 0x82, 0xe5, 0x86, 0xb5, 0xe7, 0x94, 0xa8, 0xe4, 0xba, 0x8e,
-  0xe4, 0xbf, 0x9d, 0xe7, 0x95, 0x99, 0xe5, 0x9b, 0xa0, 0xe7, 0xb4, 0xa0, 0xe4,
-  0xb8, 0xad, 0xe5, 0x9c, 0x8b, 0xe5, 0xad, 0x98, 0xe5, 0x82, 0xa8, 0xe8, 0xb4,
-  0xb4, 0xe5, 0x9b, 0xbe, 0xe6, 0x9c, 0x80, 0xe6, 0x84, 0x9b, 0xe9, 0x95, 0xbf,
-  0xe6, 0x9c, 0x9f, 0xe5, 0x8f, 0xa3, 0xe4, 0xbb, 0xb7, 0xe7, 0x90, 0x86, 0xe8,
-  0xb4, 0xa2, 0xe5, 0x9f, 0xba, 0xe5, 0x9c, 0xb0, 0xe5, 0xae, 0x89, 0xe6, 0x8e,
-  0x92, 0xe6, 0xad, 0xa6, 0xe6, 0xb1, 0x89, 0xe9, 0x87, 0x8c, 0xe9, 0x9d, 0xa2,
-  0xe5, 0x88, 0x9b, 0xe5, 0xbb, 0xba, 0xe5, 0xa4, 0xa9, 0xe7, 0xa9, 0xba, 0xe9,
-  0xa6, 0x96, 0xe5, 0x85, 0x88, 0xe5, 0xae, 0x8c, 0xe5, 0x96, 0x84, 0xe9, 0xa9,
-  0xb1, 0xe5, 0x8a, 0xa8, 0xe4, 0xb8, 0x8b, 0xe9, 0x9d, 0xa2, 0xe4, 0xb8, 0x8d,
-  0xe5, 0x86, 0x8d, 0xe8, 0xaf, 0x9a, 0xe4, 0xbf, 0xa1, 0xe6, 0x84, 0x8f, 0xe4,
-  0xb9, 0x89, 0xe9, 0x98, 0xb3, 0xe5, 0x85, 0x89, 0xe8, 0x8b, 0xb1, 0xe5, 0x9b,
-  0xbd, 0xe6, 0xbc, 0x82, 0xe4, 0xba, 0xae, 0xe5, 0x86, 0x9b, 0xe4, 0xba, 0x8b,
-  0xe7, 0x8e, 0xa9, 0xe5, 0xae, 0xb6, 0xe7, 0xbe, 0xa4, 0xe4, 0xbc, 0x97, 0xe5,
-  0x86, 0x9c, 0xe6, 0xb0, 0x91, 0xe5, 0x8d, 0xb3, 0xe5, 0x8f, 0xaf, 0xe5, 0x90,
-  0x8d, 0xe7, 0xa8, 0xb1, 0xe5, 0xae, 0xb6, 0xe5, 0x85, 0xb7, 0xe5, 0x8a, 0xa8,
-  0xe7, 0x94, 0xbb, 0xe6, 0x83, 0xb3, 0xe5, 0x88, 0xb0, 0xe6, 0xb3, 0xa8, 0xe6,
-  0x98, 0x8e, 0xe5, 0xb0, 0x8f, 0xe5, 0xad, 0xa6, 0xe6, 0x80, 0xa7, 0xe8, 0x83,
-  0xbd, 0xe8, 0x80, 0x83, 0xe7, 0xa0, 0x94, 0xe7, 0xa1, 0xac, 0xe4, 0xbb, 0xb6,
-  0xe8, 0xa7, 0x82, 0xe7, 0x9c, 0x8b, 0xe6, 0xb8, 0x85, 0xe6, 0xa5, 0x9a, 0xe6,
-  0x90, 0x9e, 0xe7, 0xac, 0x91, 0xe9, 0xa6, 0x96, 0xe9, 0xa0, 0x81, 0xe9, 0xbb,
-  0x84, 0xe9, 0x87, 0x91, 0xe9, 0x80, 0x82, 0xe7, 0x94, 0xa8, 0xe6, 0xb1, 0x9f,
-  0xe8, 0x8b, 0x8f, 0xe7, 0x9c, 0x9f, 0xe5, 0xae, 0x9e, 0xe4, 0xb8, 0xbb, 0xe7,
-  0xae, 0xa1, 0xe9, 0x98, 0xb6, 0xe6, 0xae, 0xb5, 0xe8, 0xa8, 0xbb, 0xe5, 0x86,
-  0x8a, 0xe7, 0xbf, 0xbb, 0xe8, 0xaf, 0x91, 0xe6, 0x9d, 0x83, 0xe5, 0x88, 0xa9,
-  0xe5, 0x81, 0x9a, 0xe5, 0xa5, 0xbd, 0xe4, 0xbc, 0xbc, 0xe4, 0xb9, 0x8e, 0xe9,
-  0x80, 0x9a, 0xe8, 0xae, 0xaf, 0xe6, 0x96, 0xbd, 0xe5, 0xb7, 0xa5, 0xe7, 0x8b,
-  0x80, 0xe6, 0x85, 0x8b, 0xe4, 0xb9, 0x9f, 0xe8, 0xae, 0xb8, 0xe7, 0x8e, 0xaf,
-  0xe4, 0xbf, 0x9d, 0xe5, 0x9f, 0xb9, 0xe5, 0x85, 0xbb, 0xe6, 0xa6, 0x82, 0xe5,
-  0xbf, 0xb5, 0xe5, 0xa4, 0xa7, 0xe5, 0x9e, 0x8b, 0xe6, 0x9c, 0xba, 0xe7, 0xa5,
-  0xa8, 0xe7, 0x90, 0x86, 0xe8, 0xa7, 0xa3, 0xe5, 0x8c, 0xbf, 0xe5, 0x90, 0x8d,
-  0x63, 0x75, 0x61, 0x6e, 0x64, 0x6f, 0x65, 0x6e, 0x76, 0x69, 0x61, 0x72, 0x6d,
-  0x61, 0x64, 0x72, 0x69, 0x64, 0x62, 0x75, 0x73, 0x63, 0x61, 0x72, 0x69, 0x6e,
-  0x69, 0x63, 0x69, 0x6f, 0x74, 0x69, 0x65, 0x6d, 0x70, 0x6f, 0x70, 0x6f, 0x72,
-  0x71, 0x75, 0x65, 0x63, 0x75, 0x65, 0x6e, 0x74, 0x61, 0x65, 0x73, 0x74, 0x61,
-  0x64, 0x6f, 0x70, 0x75, 0x65, 0x64, 0x65, 0x6e, 0x6a, 0x75, 0x65, 0x67, 0x6f,
-  0x73, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x65, 0x73, 0x74, 0xc3, 0xa1, 0x6e,
-  0x6e, 0x6f, 0x6d, 0x62, 0x72, 0x65, 0x74, 0x69, 0x65, 0x6e, 0x65, 0x6e, 0x70,
-  0x65, 0x72, 0x66, 0x69, 0x6c, 0x6d, 0x61, 0x6e, 0x65, 0x72, 0x61, 0x61, 0x6d,
-  0x69, 0x67, 0x6f, 0x73, 0x63, 0x69, 0x75, 0x64, 0x61, 0x64, 0x63, 0x65, 0x6e,
-  0x74, 0x72, 0x6f, 0x61, 0x75, 0x6e, 0x71, 0x75, 0x65, 0x70, 0x75, 0x65, 0x64,
-  0x65, 0x73, 0x64, 0x65, 0x6e, 0x74, 0x72, 0x6f, 0x70, 0x72, 0x69, 0x6d, 0x65,
-  0x72, 0x70, 0x72, 0x65, 0x63, 0x69, 0x6f, 0x73, 0x65, 0x67, 0xc3, 0xba, 0x6e,
-  0x62, 0x75, 0x65, 0x6e, 0x6f, 0x73, 0x76, 0x6f, 0x6c, 0x76, 0x65, 0x72, 0x70,
-  0x75, 0x6e, 0x74, 0x6f, 0x73, 0x73, 0x65, 0x6d, 0x61, 0x6e, 0x61, 0x68, 0x61,
-  0x62, 0xc3, 0xad, 0x61, 0x61, 0x67, 0x6f, 0x73, 0x74, 0x6f, 0x6e, 0x75, 0x65,
-  0x76, 0x6f, 0x73, 0x75, 0x6e, 0x69, 0x64, 0x6f, 0x73, 0x63, 0x61, 0x72, 0x6c,
-  0x6f, 0x73, 0x65, 0x71, 0x75, 0x69, 0x70, 0x6f, 0x6e, 0x69, 0xc3, 0xb1, 0x6f,
-  0x73, 0x6d, 0x75, 0x63, 0x68, 0x6f, 0x73, 0x61, 0x6c, 0x67, 0x75, 0x6e, 0x61,
-  0x63, 0x6f, 0x72, 0x72, 0x65, 0x6f, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x6e, 0x70,
-  0x61, 0x72, 0x74, 0x69, 0x72, 0x61, 0x72, 0x72, 0x69, 0x62, 0x61, 0x6d, 0x61,
-  0x72, 0xc3, 0xad, 0x61, 0x68, 0x6f, 0x6d, 0x62, 0x72, 0x65, 0x65, 0x6d, 0x70,
-  0x6c, 0x65, 0x6f, 0x76, 0x65, 0x72, 0x64, 0x61, 0x64, 0x63, 0x61, 0x6d, 0x62,
-  0x69, 0x6f, 0x6d, 0x75, 0x63, 0x68, 0x61, 0x73, 0x66, 0x75, 0x65, 0x72, 0x6f,
-  0x6e, 0x70, 0x61, 0x73, 0x61, 0x64, 0x6f, 0x6c, 0xc3, 0xad, 0x6e, 0x65, 0x61,
-  0x70, 0x61, 0x72, 0x65, 0x63, 0x65, 0x6e, 0x75, 0x65, 0x76, 0x61, 0x73, 0x63,
-  0x75, 0x72, 0x73, 0x6f, 0x73, 0x65, 0x73, 0x74, 0x61, 0x62, 0x61, 0x71, 0x75,
-  0x69, 0x65, 0x72, 0x6f, 0x6c, 0x69, 0x62, 0x72, 0x6f, 0x73, 0x63, 0x75, 0x61,
-  0x6e, 0x74, 0x6f, 0x61, 0x63, 0x63, 0x65, 0x73, 0x6f, 0x6d, 0x69, 0x67, 0x75,
-  0x65, 0x6c, 0x76, 0x61, 0x72, 0x69, 0x6f, 0x73, 0x63, 0x75, 0x61, 0x74, 0x72,
-  0x6f, 0x74, 0x69, 0x65, 0x6e, 0x65, 0x73, 0x67, 0x72, 0x75, 0x70, 0x6f, 0x73,
-  0x73, 0x65, 0x72, 0xc3, 0xa1, 0x6e, 0x65, 0x75, 0x72, 0x6f, 0x70, 0x61, 0x6d,
-  0x65, 0x64, 0x69, 0x6f, 0x73, 0x66, 0x72, 0x65, 0x6e, 0x74, 0x65, 0x61, 0x63,
-  0x65, 0x72, 0x63, 0x61, 0x64, 0x65, 0x6d, 0xc3, 0xa1, 0x73, 0x6f, 0x66, 0x65,
-  0x72, 0x74, 0x61, 0x63, 0x6f, 0x63, 0x68, 0x65, 0x73, 0x6d, 0x6f, 0x64, 0x65,
-  0x6c, 0x6f, 0x69, 0x74, 0x61, 0x6c, 0x69, 0x61, 0x6c, 0x65, 0x74, 0x72, 0x61,
-  0x73, 0x61, 0x6c, 0x67, 0xc3, 0xba, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x72, 0x61,
-  0x63, 0x75, 0x61, 0x6c, 0x65, 0x73, 0x65, 0x78, 0x69, 0x73, 0x74, 0x65, 0x63,
-  0x75, 0x65, 0x72, 0x70, 0x6f, 0x73, 0x69, 0x65, 0x6e, 0x64, 0x6f, 0x70, 0x72,
-  0x65, 0x6e, 0x73, 0x61, 0x6c, 0x6c, 0x65, 0x67, 0x61, 0x72, 0x76, 0x69, 0x61,
-  0x6a, 0x65, 0x73, 0x64, 0x69, 0x6e, 0x65, 0x72, 0x6f, 0x6d, 0x75, 0x72, 0x63,
-  0x69, 0x61, 0x70, 0x6f, 0x64, 0x72, 0xc3, 0xa1, 0x70, 0x75, 0x65, 0x73, 0x74,
-  0x6f, 0x64, 0x69, 0x61, 0x72, 0x69, 0x6f, 0x70, 0x75, 0x65, 0x62, 0x6c, 0x6f,
-  0x71, 0x75, 0x69, 0x65, 0x72, 0x65, 0x6d, 0x61, 0x6e, 0x75, 0x65, 0x6c, 0x70,
-  0x72, 0x6f, 0x70, 0x69, 0x6f, 0x63, 0x72, 0x69, 0x73, 0x69, 0x73, 0x63, 0x69,
-  0x65, 0x72, 0x74, 0x6f, 0x73, 0x65, 0x67, 0x75, 0x72, 0x6f, 0x6d, 0x75, 0x65,
-  0x72, 0x74, 0x65, 0x66, 0x75, 0x65, 0x6e, 0x74, 0x65, 0x63, 0x65, 0x72, 0x72,
-  0x61, 0x72, 0x67, 0x72, 0x61, 0x6e, 0x64, 0x65, 0x65, 0x66, 0x65, 0x63, 0x74,
-  0x6f, 0x70, 0x61, 0x72, 0x74, 0x65, 0x73, 0x6d, 0x65, 0x64, 0x69, 0x64, 0x61,
-  0x70, 0x72, 0x6f, 0x70, 0x69, 0x61, 0x6f, 0x66, 0x72, 0x65, 0x63, 0x65, 0x74,
-  0x69, 0x65, 0x72, 0x72, 0x61, 0x65, 0x2d, 0x6d, 0x61, 0x69, 0x6c, 0x76, 0x61,
-  0x72, 0x69, 0x61, 0x73, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x73, 0x66, 0x75, 0x74,
-  0x75, 0x72, 0x6f, 0x6f, 0x62, 0x6a, 0x65, 0x74, 0x6f, 0x73, 0x65, 0x67, 0x75,
-  0x69, 0x72, 0x72, 0x69, 0x65, 0x73, 0x67, 0x6f, 0x6e, 0x6f, 0x72, 0x6d, 0x61,
-  0x73, 0x6d, 0x69, 0x73, 0x6d, 0x6f, 0x73, 0xc3, 0xba, 0x6e, 0x69, 0x63, 0x6f,
-  0x63, 0x61, 0x6d, 0x69, 0x6e, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x73, 0x72,
-  0x61, 0x7a, 0xc3, 0xb3, 0x6e, 0x64, 0x65, 0x62, 0x69, 0x64, 0x6f, 0x70, 0x72,
-  0x75, 0x65, 0x62, 0x61, 0x74, 0x6f, 0x6c, 0x65, 0x64, 0x6f, 0x74, 0x65, 0x6e,
-  0xc3, 0xad, 0x61, 0x6a, 0x65, 0x73, 0xc3, 0xba, 0x73, 0x65, 0x73, 0x70, 0x65,
-  0x72, 0x6f, 0x63, 0x6f, 0x63, 0x69, 0x6e, 0x61, 0x6f, 0x72, 0x69, 0x67, 0x65,
-  0x6e, 0x74, 0x69, 0x65, 0x6e, 0x64, 0x61, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x6f,
-  0x63, 0xc3, 0xa1, 0x64, 0x69, 0x7a, 0x68, 0x61, 0x62, 0x6c, 0x61, 0x72, 0x73,
-  0x65, 0x72, 0xc3, 0xad, 0x61, 0x6c, 0x61, 0x74, 0x69, 0x6e, 0x61, 0x66, 0x75,
-  0x65, 0x72, 0x7a, 0x61, 0x65, 0x73, 0x74, 0x69, 0x6c, 0x6f, 0x67, 0x75, 0x65,
-  0x72, 0x72, 0x61, 0x65, 0x6e, 0x74, 0x72, 0x61, 0x72, 0xc3, 0xa9, 0x78, 0x69,
-  0x74, 0x6f, 0x6c, 0xc3, 0xb3, 0x70, 0x65, 0x7a, 0x61, 0x67, 0x65, 0x6e, 0x64,
-  0x61, 0x76, 0xc3, 0xad, 0x64, 0x65, 0x6f, 0x65, 0x76, 0x69, 0x74, 0x61, 0x72,
-  0x70, 0x61, 0x67, 0x69, 0x6e, 0x61, 0x6d, 0x65, 0x74, 0x72, 0x6f, 0x73, 0x6a,
-  0x61, 0x76, 0x69, 0x65, 0x72, 0x70, 0x61, 0x64, 0x72, 0x65, 0x73, 0x66, 0xc3,
-  0xa1, 0x63, 0x69, 0x6c, 0x63, 0x61, 0x62, 0x65, 0x7a, 0x61, 0xc3, 0xa1, 0x72,
-  0x65, 0x61, 0x73, 0x73, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x65, 0x6e, 0x76, 0xc3,
-  0xad, 0x6f, 0x6a, 0x61, 0x70, 0xc3, 0xb3, 0x6e, 0x61, 0x62, 0x75, 0x73, 0x6f,
-  0x73, 0x62, 0x69, 0x65, 0x6e, 0x65, 0x73, 0x74, 0x65, 0x78, 0x74, 0x6f, 0x73,
-  0x6c, 0x6c, 0x65, 0x76, 0x61, 0x72, 0x70, 0x75, 0x65, 0x64, 0x61, 0x6e, 0x66,
-  0x75, 0x65, 0x72, 0x74, 0x65, 0x63, 0x6f, 0x6d, 0xc3, 0xba, 0x6e, 0x63, 0x6c,
-  0x61, 0x73, 0x65, 0x73, 0x68, 0x75, 0x6d, 0x61, 0x6e, 0x6f, 0x74, 0x65, 0x6e,
-  0x69, 0x64, 0x6f, 0x62, 0x69, 0x6c, 0x62, 0x61, 0x6f, 0x75, 0x6e, 0x69, 0x64,
-  0x61, 0x64, 0x65, 0x73, 0x74, 0xc3, 0xa1, 0x73, 0x65, 0x64, 0x69, 0x74, 0x61,
-  0x72, 0x63, 0x72, 0x65, 0x61, 0x64, 0x6f, 0xd0, 0xb4, 0xd0, 0xbb, 0xd1, 0x8f,
-  0xd1, 0x87, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xba, 0xd0, 0xb0, 0xd0, 0xba, 0xd0,
-  0xb8, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb2,
-  0xd1, 0x81, 0xd0, 0xb5, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xbf, 0xd1,
-  0x80, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xb5, 0xd1, 0x89,
-  0xd0, 0xb5, 0xd1, 0x83, 0xd0, 0xb6, 0xd0, 0xb5, 0xd0, 0x9a, 0xd0, 0xb0, 0xd0,
-  0xba, 0xd0, 0xb1, 0xd0, 0xb5, 0xd0, 0xb7, 0xd0, 0xb1, 0xd1, 0x8b, 0xd0, 0xbb,
-  0xd0, 0xbe, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0x92, 0xd1, 0x81, 0xd0, 0xb5, 0xd0,
-  0xbf, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xad, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x82,
-  0xd0, 0xbe, 0xd0, 0xbc, 0xd1, 0x87, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0, 0xbd, 0xd0,
-  0xb5, 0xd1, 0x82, 0xd0, 0xbb, 0xd0, 0xb5, 0xd1, 0x82, 0xd1, 0x80, 0xd0, 0xb0,
-  0xd0, 0xb7, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xb3, 0xd0, 0xb4, 0xd0,
-  0xb5, 0xd0, 0xbc, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0x94, 0xd0, 0xbb, 0xd1, 0x8f,
-  0xd0, 0x9f, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x81, 0xd0,
-  0xbd, 0xd0, 0xb8, 0xd1, 0x85, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0, 0xba,
-  0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb2, 0xd0,
-  0xbe, 0xd1, 0x82, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xbc, 0xd0, 0xa1, 0xd0, 0xa8,
-  0xd0, 0x90, 0xd0, 0xbc, 0xd0, 0xb0, 0xd1, 0x8f, 0xd0, 0xa7, 0xd1, 0x82, 0xd0,
-  0xbe, 0xd0, 0xb2, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xb2, 0xd0, 0xb0, 0xd0, 0xbc,
-  0xd0, 0xb5, 0xd0, 0xbc, 0xd1, 0x83, 0xd0, 0xa2, 0xd0, 0xb0, 0xd0, 0xba, 0xd0,
-  0xb4, 0xd0, 0xb2, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xbc, 0xd1, 0x8d,
-  0xd1, 0x82, 0xd0, 0xb8, 0xd1, 0x8d, 0xd1, 0x82, 0xd1, 0x83, 0xd0, 0x92, 0xd0,
-  0xb0, 0xd0, 0xbc, 0xd1, 0x82, 0xd0, 0xb5, 0xd1, 0x85, 0xd0, 0xbf, 0xd1, 0x80,
-  0xd0, 0xbe, 0xd1, 0x82, 0xd1, 0x83, 0xd1, 0x82, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0,
-  0xb4, 0xd0, 0xb4, 0xd0, 0xbd, 0xd1, 0x8f, 0xd0, 0x92, 0xd0, 0xbe, 0xd1, 0x82,
-  0xd1, 0x82, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xb9, 0xd0,
-  0x92, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xbc, 0xd1, 0x81,
-  0xd0, 0xb0, 0xd0, 0xbc, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x82, 0xd1, 0x80, 0xd1,
-  0x83, 0xd0, 0xb1, 0xd0, 0x9e, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0, 0xb8,
-  0xd1, 0x80, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xb5, 0xd0, 0x9e, 0xd0, 0x9e, 0xd0,
-  0x9e, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x86, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xb0,
-  0xd0, 0x9e, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0,
-  0xb4, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xb9, 0xd0, 0xb4,
-  0xd0, 0xb2, 0xd0, 0xb5, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0, 0xbe, 0xd1, 0x81, 0xd1,
-  0x83, 0xd0, 0xb4, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb9, 0xe0,
-  0xa5, 0x88, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5,
-  0x87, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8b,
-  0xe0, 0xa4, 0x94, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
-  0x95, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xad, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x87,
-  0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4, 0xe0,
-  0xa5, 0x8b, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x86, 0xe0, 0xa4,
-  0xaa, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xb9,
-  0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0x95, 0xe0,
-  0xa4, 0xa5, 0xe0, 0xa4, 0xbe, 0x6a, 0x61, 0x67, 0x72, 0x61, 0x6e, 0xe0, 0xa4,
-  0x86, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x85,
-  0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x97, 0xe0,
-  0xa4, 0x88, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x97, 0xe0, 0xa4,
-  0x8f, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xa8,
-  0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x87, 0xe0,
-  0xa4, 0xa5, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa5, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
-  0x98, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa6,
-  0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0x88, 0xe0, 0xa4, 0x9c, 0xe0,
-  0xa5, 0x80, 0xe0, 0xa4, 0xb5, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
-  0x88, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xb0,
-  0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0,
-  0xa4, 0x95, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb5, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4,
-  0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xae,
-  0xe0, 0xa4, 0x88, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x93, 0xe0,
-  0xa4, 0xb0, 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xac, 0xe0, 0xa4,
-  0xb8, 0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa8,
-  0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xa8, 0xe0,
-  0xa4, 0x86, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
-  0xb2, 0xe0, 0xa5, 0x80, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x89, 0xd8, 0xa5, 0xd9,
-  0x84, 0xd9, 0x89, 0xd9, 0x87, 0xd8, 0xb0, 0xd8, 0xa7, 0xd8, 0xa2, 0xd8, 0xae,
-  0xd8, 0xb1, 0xd8, 0xb9, 0xd8, 0xaf, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd9,
-  0x89, 0xd9, 0x87, 0xd8, 0xb0, 0xd9, 0x87, 0xd8, 0xb5, 0xd9, 0x88, 0xd8, 0xb1,
-  0xd8, 0xba, 0xd9, 0x8a, 0xd8, 0xb1, 0xd9, 0x83, 0xd8, 0xa7, 0xd9, 0x86, 0xd9,
-  0x88, 0xd9, 0x84, 0xd8, 0xa7, 0xd8, 0xa8, 0xd9, 0x8a, 0xd9, 0x86, 0xd8, 0xb9,
-  0xd8, 0xb1, 0xd8, 0xb6, 0xd8, 0xb0, 0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x87, 0xd9,
-  0x86, 0xd8, 0xa7, 0xd9, 0x8a, 0xd9, 0x88, 0xd9, 0x85, 0xd9, 0x82, 0xd8, 0xa7,
-  0xd9, 0x84, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x86, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x86, 0xd8, 0xad, 0xd8, 0xaa, 0xd9, 0x89,
-  0xd9, 0x82, 0xd8, 0xa8, 0xd9, 0x84, 0xd9, 0x88, 0xd8, 0xad, 0xd8, 0xa9, 0xd8,
-  0xa7, 0xd8, 0xae, 0xd8, 0xb1, 0xd9, 0x81, 0xd9, 0x82, 0xd8, 0xb7, 0xd8, 0xb9,
-  0xd8, 0xa8, 0xd8, 0xaf, 0xd8, 0xb1, 0xd9, 0x83, 0xd9, 0x86, 0xd8, 0xa5, 0xd8,
-  0xb0, 0xd8, 0xa7, 0xd9, 0x83, 0xd9, 0x85, 0xd8, 0xa7, 0xd8, 0xa7, 0xd8, 0xad,
-  0xd8, 0xaf, 0xd8, 0xa5, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x81, 0xd9, 0x8a, 0xd9,
-  0x87, 0xd8, 0xa8, 0xd8, 0xb9, 0xd8, 0xb6, 0xd9, 0x83, 0xd9, 0x8a, 0xd9, 0x81,
-  0xd8, 0xa8, 0xd8, 0xad, 0xd8, 0xab, 0xd9, 0x88, 0xd9, 0x85, 0xd9, 0x86, 0xd9,
-  0x88, 0xd9, 0x87, 0xd9, 0x88, 0xd8, 0xa3, 0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xac,
-  0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x87, 0xd8, 0xa7, 0xd8, 0xb3, 0xd9,
-  0x84, 0xd9, 0x85, 0xd8, 0xb9, 0xd9, 0x86, 0xd8, 0xaf, 0xd9, 0x84, 0xd9, 0x8a,
-  0xd8, 0xb3, 0xd8, 0xb9, 0xd8, 0xa8, 0xd8, 0xb1, 0xd8, 0xb5, 0xd9, 0x84, 0xd9,
-  0x89, 0xd9, 0x85, 0xd9, 0x86, 0xd8, 0xb0, 0xd8, 0xa8, 0xd9, 0x87, 0xd8, 0xa7,
-  0xd8, 0xa3, 0xd9, 0x86, 0xd9, 0x87, 0xd9, 0x85, 0xd8, 0xab, 0xd9, 0x84, 0xd9,
-  0x83, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd8, 0xad,
-  0xd9, 0x8a, 0xd8, 0xab, 0xd9, 0x85, 0xd8, 0xb5, 0xd8, 0xb1, 0xd8, 0xb4, 0xd8,
-  0xb1, 0xd8, 0xad, 0xd8, 0xad, 0xd9, 0x88, 0xd9, 0x84, 0xd9, 0x88, 0xd9, 0x81,
-  0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xb0, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd9,
-  0x84, 0xd9, 0x85, 0xd8, 0xb1, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x86, 0xd8, 0xaa,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x81, 0xd8, 0xa3, 0xd8, 0xa8, 0xd9, 0x88, 0xd8,
-  0xae, 0xd8, 0xa7, 0xd8, 0xb5, 0xd8, 0xa3, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xa7,
-  0xd9, 0x86, 0xd9, 0x87, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x8a, 0xd8, 0xb9, 0xd8,
-  0xb6, 0xd9, 0x88, 0xd9, 0x88, 0xd9, 0x82, 0xd8, 0xaf, 0xd8, 0xa7, 0xd8, 0xa8,
-  0xd9, 0x86, 0xd8, 0xae, 0xd9, 0x8a, 0xd8, 0xb1, 0xd8, 0xa8, 0xd9, 0x86, 0xd8,
-  0xaa, 0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7, 0xd8, 0xa1,
-  0xd9, 0x88, 0xd9, 0x87, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xa8, 0xd9, 0x88, 0xd9,
-  0x82, 0xd8, 0xb5, 0xd8, 0xb5, 0xd9, 0x88, 0xd9, 0x85, 0xd8, 0xa7, 0xd8, 0xb1,
-  0xd9, 0x82, 0xd9, 0x85, 0xd8, 0xa3, 0xd8, 0xad, 0xd8, 0xaf, 0xd9, 0x86, 0xd8,
-  0xad, 0xd9, 0x86, 0xd8, 0xb9, 0xd8, 0xaf, 0xd9, 0x85, 0xd8, 0xb1, 0xd8, 0xa3,
-  0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xad, 0xd8, 0xa9, 0xd9, 0x83, 0xd8, 0xaa, 0xd8,
-  0xa8, 0xd8, 0xaf, 0xd9, 0x88, 0xd9, 0x86, 0xd9, 0x8a, 0xd8, 0xac, 0xd8, 0xa8,
-  0xd9, 0x85, 0xd9, 0x86, 0xd9, 0x87, 0xd8, 0xaa, 0xd8, 0xad, 0xd8, 0xaa, 0xd8,
-  0xac, 0xd9, 0x87, 0xd8, 0xa9, 0xd8, 0xb3, 0xd9, 0x86, 0xd8, 0xa9, 0xd9, 0x8a,
-  0xd8, 0xaa, 0xd9, 0x85, 0xd9, 0x83, 0xd8, 0xb1, 0xd8, 0xa9, 0xd8, 0xba, 0xd8,
-  0xb2, 0xd8, 0xa9, 0xd9, 0x86, 0xd9, 0x81, 0xd8, 0xb3, 0xd8, 0xa8, 0xd9, 0x8a,
-  0xd8, 0xaa, 0xd9, 0x84, 0xd9, 0x84, 0xd9, 0x87, 0xd9, 0x84, 0xd9, 0x86, 0xd8,
-  0xa7, 0xd8, 0xaa, 0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x82, 0xd9, 0x84, 0xd8, 0xa8,
-  0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xa7, 0xd8, 0xb9, 0xd9, 0x86, 0xd9, 0x87, 0xd8,
-  0xa3, 0xd9, 0x88, 0xd9, 0x84, 0xd8, 0xb4, 0xd9, 0x8a, 0xd8, 0xa1, 0xd9, 0x86,
-  0xd9, 0x88, 0xd8, 0xb1, 0xd8, 0xa3, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x81, 0xd9,
-  0x8a, 0xd9, 0x83, 0xd8, 0xa8, 0xd9, 0x83, 0xd9, 0x84, 0xd8, 0xb0, 0xd8, 0xa7,
-  0xd8, 0xaa, 0xd8, 0xb1, 0xd8, 0xaa, 0xd8, 0xa8, 0xd8, 0xa8, 0xd8, 0xa3, 0xd9,
-  0x86, 0xd9, 0x87, 0xd9, 0x85, 0xd8, 0xb3, 0xd8, 0xa7, 0xd9, 0x86, 0xd9, 0x83,
-  0xd8, 0xa8, 0xd9, 0x8a, 0xd8, 0xb9, 0xd9, 0x81, 0xd9, 0x82, 0xd8, 0xaf, 0xd8,
-  0xad, 0xd8, 0xb3, 0xd9, 0x86, 0xd9, 0x84, 0xd9, 0x87, 0xd9, 0x85, 0xd8, 0xb4,
-  0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xa3, 0xd9, 0x87, 0xd9, 0x84, 0xd8, 0xb4, 0xd9,
-  0x87, 0xd8, 0xb1, 0xd9, 0x82, 0xd8, 0xb7, 0xd8, 0xb1, 0xd8, 0xb7, 0xd9, 0x84,
-  0xd8, 0xa8, 0x70, 0x72, 0x6f, 0x66, 0x69, 0x6c, 0x65, 0x73, 0x65, 0x72, 0x76,
-  0x69, 0x63, 0x65, 0x64, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x68, 0x69, 0x6d,
-  0x73, 0x65, 0x6c, 0x66, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x63, 0x6f,
-  0x6e, 0x74, 0x65, 0x6e, 0x74, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x73,
-  0x74, 0x61, 0x72, 0x74, 0x65, 0x64, 0x6d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65,
-  0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x66, 0x61, 0x73, 0x68, 0x69, 0x6f,
-  0x6e, 0x3c, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3e, 0x63, 0x6f, 0x75, 0x6e, 0x74,
-  0x72, 0x79, 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x63, 0x72, 0x65, 0x61,
-  0x74, 0x65, 0x64, 0x73, 0x74, 0x6f, 0x72, 0x69, 0x65, 0x73, 0x72, 0x65, 0x73,
-  0x75, 0x6c, 0x74, 0x73, 0x72, 0x75, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x70, 0x72,
-  0x6f, 0x63, 0x65, 0x73, 0x73, 0x77, 0x72, 0x69, 0x74, 0x69, 0x6e, 0x67, 0x6f,
-  0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x76, 0x69, 0x73, 0x69, 0x62, 0x6c, 0x65,
-  0x77, 0x65, 0x6c, 0x63, 0x6f, 0x6d, 0x65, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c,
-  0x65, 0x75, 0x6e, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x6e, 0x65, 0x74, 0x77, 0x6f,
-  0x72, 0x6b, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x6e, 0x79, 0x64, 0x79, 0x6e, 0x61,
-  0x6d, 0x69, 0x63, 0x62, 0x72, 0x6f, 0x77, 0x73, 0x65, 0x72, 0x70, 0x72, 0x69,
-  0x76, 0x61, 0x63, 0x79, 0x70, 0x72, 0x6f, 0x62, 0x6c, 0x65, 0x6d, 0x53, 0x65,
-  0x72, 0x76, 0x69, 0x63, 0x65, 0x72, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74, 0x64,
-  0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74,
-  0x72, 0x65, 0x73, 0x65, 0x72, 0x76, 0x65, 0x77, 0x65, 0x62, 0x73, 0x69, 0x74,
-  0x65, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x66, 0x72, 0x69, 0x65, 0x6e,
-  0x64, 0x73, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x77, 0x6f, 0x72, 0x6b,
-  0x69, 0x6e, 0x67, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x6d, 0x69, 0x6c,
-  0x6c, 0x69, 0x6f, 0x6e, 0x63, 0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x77, 0x69,
-  0x6e, 0x64, 0x6f, 0x77, 0x2e, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x76,
-  0x69, 0x73, 0x69, 0x74, 0x65, 0x64, 0x77, 0x65, 0x61, 0x74, 0x68, 0x65, 0x72,
-  0x63, 0x6f, 0x72, 0x72, 0x65, 0x63, 0x74, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63,
-  0x74, 0x65, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x66, 0x6f, 0x72, 0x77, 0x61,
-  0x72, 0x64, 0x79, 0x6f, 0x75, 0x20, 0x63, 0x61, 0x6e, 0x72, 0x65, 0x6d, 0x6f,
-  0x76, 0x65, 0x64, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x63, 0x6f, 0x6e,
-  0x74, 0x72, 0x6f, 0x6c, 0x61, 0x72, 0x63, 0x68, 0x69, 0x76, 0x65, 0x63, 0x75,
-  0x72, 0x72, 0x65, 0x6e, 0x74, 0x72, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x6c,
-  0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x6c, 0x69, 0x6d, 0x69, 0x74, 0x65, 0x64,
-  0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x72, 0x66, 0x75, 0x72, 0x74, 0x68, 0x65,
-  0x72, 0x73, 0x75, 0x6d, 0x6d, 0x61, 0x72, 0x79, 0x6d, 0x61, 0x63, 0x68, 0x69,
-  0x6e, 0x65, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x65, 0x73, 0x70, 0x72, 0x69, 0x76,
-  0x61, 0x74, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x78, 0x74, 0x70, 0x72, 0x6f,
-  0x67, 0x72, 0x61, 0x6d, 0x73, 0x6f, 0x63, 0x69, 0x65, 0x74, 0x79, 0x6e, 0x75,
-  0x6d, 0x62, 0x65, 0x72, 0x73, 0x77, 0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x65,
-  0x6e, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x74, 0x72, 0x69, 0x67, 0x67, 0x65, 0x72,
-  0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x6c, 0x6f, 0x61, 0x64, 0x69, 0x6e,
-  0x67, 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x70, 0x61, 0x72, 0x74, 0x6e,
-  0x65, 0x72, 0x66, 0x69, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x70, 0x65, 0x72, 0x66,
-  0x65, 0x63, 0x74, 0x6d, 0x65, 0x61, 0x6e, 0x69, 0x6e, 0x67, 0x73, 0x79, 0x73,
-  0x74, 0x65, 0x6d, 0x73, 0x6b, 0x65, 0x65, 0x70, 0x69, 0x6e, 0x67, 0x63, 0x75,
-  0x6c, 0x74, 0x75, 0x72, 0x65, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x2c, 0x6a,
-  0x6f, 0x75, 0x72, 0x6e, 0x61, 0x6c, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74,
-  0x73, 0x75, 0x72, 0x66, 0x61, 0x63, 0x65, 0x73, 0x26, 0x71, 0x75, 0x6f, 0x74,
-  0x3b, 0x65, 0x78, 0x70, 0x69, 0x72, 0x65, 0x73, 0x72, 0x65, 0x76, 0x69, 0x65,
-  0x77, 0x73, 0x62, 0x61, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x45, 0x6e, 0x67, 0x6c,
-  0x69, 0x73, 0x68, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x74, 0x68, 0x72,
-  0x6f, 0x75, 0x67, 0x68, 0x50, 0x6c, 0x65, 0x61, 0x73, 0x65, 0x20, 0x6f, 0x70,
-  0x69, 0x6e, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x63, 0x74, 0x61,
-  0x76, 0x65, 0x72, 0x61, 0x67, 0x65, 0x70, 0x72, 0x69, 0x6d, 0x61, 0x72, 0x79,
-  0x76, 0x69, 0x6c, 0x6c, 0x61, 0x67, 0x65, 0x53, 0x70, 0x61, 0x6e, 0x69, 0x73,
-  0x68, 0x67, 0x61, 0x6c, 0x6c, 0x65, 0x72, 0x79, 0x64, 0x65, 0x63, 0x6c, 0x69,
-  0x6e, 0x65, 0x6d, 0x65, 0x65, 0x74, 0x69, 0x6e, 0x67, 0x6d, 0x69, 0x73, 0x73,
-  0x69, 0x6f, 0x6e, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x71, 0x75, 0x61,
-  0x6c, 0x69, 0x74, 0x79, 0x6d, 0x65, 0x61, 0x73, 0x75, 0x72, 0x65, 0x67, 0x65,
-  0x6e, 0x65, 0x72, 0x61, 0x6c, 0x73, 0x70, 0x65, 0x63, 0x69, 0x65, 0x73, 0x73,
-  0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e,
-  0x77, 0x72, 0x69, 0x74, 0x65, 0x72, 0x73, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x65,
-  0x72, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x72, 0x65, 0x70, 0x6f, 0x72,
-  0x74, 0x73, 0x66, 0x69, 0x67, 0x75, 0x72, 0x65, 0x73, 0x6d, 0x65, 0x6d, 0x62,
-  0x65, 0x72, 0x73, 0x68, 0x6f, 0x6c, 0x64, 0x69, 0x6e, 0x67, 0x64, 0x69, 0x73,
-  0x70, 0x75, 0x74, 0x65, 0x65, 0x61, 0x72, 0x6c, 0x69, 0x65, 0x72, 0x65, 0x78,
-  0x70, 0x72, 0x65, 0x73, 0x73, 0x64, 0x69, 0x67, 0x69, 0x74, 0x61, 0x6c, 0x70,
-  0x69, 0x63, 0x74, 0x75, 0x72, 0x65, 0x41, 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72,
-  0x6d, 0x61, 0x72, 0x72, 0x69, 0x65, 0x64, 0x74, 0x72, 0x61, 0x66, 0x66, 0x69,
-  0x63, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x63, 0x68, 0x61, 0x6e, 0x67,
-  0x65, 0x64, 0x63, 0x65, 0x6e, 0x74, 0x72, 0x61, 0x6c, 0x76, 0x69, 0x63, 0x74,
-  0x6f, 0x72, 0x79, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x73, 0x2f, 0x72, 0x65, 0x61,
-  0x73, 0x6f, 0x6e, 0x73, 0x73, 0x74, 0x75, 0x64, 0x69, 0x65, 0x73, 0x66, 0x65,
-  0x61, 0x74, 0x75, 0x72, 0x65, 0x6c, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x6d,
-  0x75, 0x73, 0x74, 0x20, 0x62, 0x65, 0x73, 0x63, 0x68, 0x6f, 0x6f, 0x6c, 0x73,
-  0x56, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x75, 0x73, 0x75, 0x61, 0x6c, 0x6c,
-  0x79, 0x65, 0x70, 0x69, 0x73, 0x6f, 0x64, 0x65, 0x70, 0x6c, 0x61, 0x79, 0x69,
-  0x6e, 0x67, 0x67, 0x72, 0x6f, 0x77, 0x69, 0x6e, 0x67, 0x6f, 0x62, 0x76, 0x69,
-  0x6f, 0x75, 0x73, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x61, 0x79, 0x70, 0x72, 0x65,
-  0x73, 0x65, 0x6e, 0x74, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3c, 0x2f,
-  0x75, 0x6c, 0x3e, 0x0d, 0x0a, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x61,
-  0x6c, 0x72, 0x65, 0x61, 0x64, 0x79, 0x63, 0x65, 0x72, 0x74, 0x61, 0x69, 0x6e,
-  0x72, 0x65, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x67,
-  0x65, 0x61, 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x64, 0x65, 0x73, 0x6b, 0x74,
-  0x6f, 0x70, 0x6f, 0x66, 0x66, 0x65, 0x72, 0x65, 0x64, 0x70, 0x61, 0x74, 0x74,
-  0x65, 0x72, 0x6e, 0x75, 0x6e, 0x75, 0x73, 0x75, 0x61, 0x6c, 0x44, 0x69, 0x67,
-  0x69, 0x74, 0x61, 0x6c, 0x63, 0x61, 0x70, 0x69, 0x74, 0x61, 0x6c, 0x57, 0x65,
-  0x62, 0x73, 0x69, 0x74, 0x65, 0x66, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x63,
-  0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x72, 0x65, 0x64, 0x75, 0x63, 0x65, 0x64,
-  0x41, 0x6e, 0x64, 0x72, 0x6f, 0x69, 0x64, 0x64, 0x65, 0x63, 0x61, 0x64, 0x65,
-  0x73, 0x72, 0x65, 0x67, 0x75, 0x6c, 0x61, 0x72, 0x20, 0x26, 0x61, 0x6d, 0x70,
-  0x3b, 0x20, 0x61, 0x6e, 0x69, 0x6d, 0x61, 0x6c, 0x73, 0x72, 0x65, 0x6c, 0x65,
-  0x61, 0x73, 0x65, 0x41, 0x75, 0x74, 0x6f, 0x6d, 0x61, 0x74, 0x67, 0x65, 0x74,
-  0x74, 0x69, 0x6e, 0x67, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x73, 0x6e, 0x6f,
-  0x74, 0x68, 0x69, 0x6e, 0x67, 0x50, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x63,
-  0x61, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x6c, 0x65, 0x74, 0x74, 0x65, 0x72, 0x73,
-  0x63, 0x61, 0x70, 0x74, 0x75, 0x72, 0x65, 0x73, 0x63, 0x69, 0x65, 0x6e, 0x63,
-  0x65, 0x6c, 0x69, 0x63, 0x65, 0x6e, 0x73, 0x65, 0x63, 0x68, 0x61, 0x6e, 0x67,
-  0x65, 0x73, 0x45, 0x6e, 0x67, 0x6c, 0x61, 0x6e, 0x64, 0x3d, 0x31, 0x26, 0x61,
-  0x6d, 0x70, 0x3b, 0x48, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x20, 0x3d, 0x20,
-  0x6e, 0x65, 0x77, 0x20, 0x43, 0x65, 0x6e, 0x74, 0x72, 0x61, 0x6c, 0x75, 0x70,
-  0x64, 0x61, 0x74, 0x65, 0x64, 0x53, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c, 0x4e,
-  0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65,
-  0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x77, 0x61, 0x72, 0x6e, 0x69, 0x6e,
-  0x67, 0x43, 0x6f, 0x6c, 0x6c, 0x65, 0x67, 0x65, 0x74, 0x6f, 0x6f, 0x6c, 0x62,
-  0x61, 0x72, 0x72, 0x65, 0x6d, 0x61, 0x69, 0x6e, 0x73, 0x62, 0x65, 0x63, 0x61,
-  0x75, 0x73, 0x65, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x44, 0x65, 0x75,
-  0x74, 0x73, 0x63, 0x68, 0x66, 0x69, 0x6e, 0x61, 0x6e, 0x63, 0x65, 0x77, 0x6f,
-  0x72, 0x6b, 0x65, 0x72, 0x73, 0x71, 0x75, 0x69, 0x63, 0x6b, 0x6c, 0x79, 0x62,
-  0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x65, 0x78, 0x61, 0x63, 0x74, 0x6c, 0x79,
-  0x73, 0x65, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x64, 0x69, 0x73, 0x65, 0x61, 0x73,
-  0x65, 0x53, 0x6f, 0x63, 0x69, 0x65, 0x74, 0x79, 0x77, 0x65, 0x61, 0x70, 0x6f,
-  0x6e, 0x73, 0x65, 0x78, 0x68, 0x69, 0x62, 0x69, 0x74, 0x26, 0x6c, 0x74, 0x3b,
-  0x21, 0x2d, 0x2d, 0x43, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x63, 0x6c, 0x61,
-  0x73, 0x73, 0x65, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x65, 0x64, 0x6f, 0x75,
-  0x74, 0x6c, 0x69, 0x6e, 0x65, 0x61, 0x74, 0x74, 0x61, 0x63, 0x6b, 0x73, 0x64,
-  0x65, 0x76, 0x69, 0x63, 0x65, 0x73, 0x28, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77,
-  0x70, 0x75, 0x72, 0x70, 0x6f, 0x73, 0x65, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3d,
-  0x22, 0x4d, 0x6f, 0x62, 0x69, 0x6c, 0x65, 0x20, 0x6b, 0x69, 0x6c, 0x6c, 0x69,
-  0x6e, 0x67, 0x73, 0x68, 0x6f, 0x77, 0x69, 0x6e, 0x67, 0x49, 0x74, 0x61, 0x6c,
-  0x69, 0x61, 0x6e, 0x64, 0x72, 0x6f, 0x70, 0x70, 0x65, 0x64, 0x68, 0x65, 0x61,
-  0x76, 0x69, 0x6c, 0x79, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x73, 0x2d, 0x31,
-  0x27, 0x5d, 0x29, 0x3b, 0x0a, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x72, 0x6d, 0x43,
-  0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x61, 0x64, 0x76, 0x61, 0x6e, 0x63, 0x65,
-  0x73, 0x68, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x6f, 0x70, 0x65, 0x6e, 0x69, 0x6e,
-  0x67, 0x64, 0x72, 0x61, 0x77, 0x69, 0x6e, 0x67, 0x62, 0x69, 0x6c, 0x6c, 0x69,
-  0x6f, 0x6e, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x65, 0x64, 0x47, 0x65, 0x72, 0x6d,
-  0x61, 0x6e, 0x79, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x3c, 0x2f, 0x66,
-  0x6f, 0x72, 0x6d, 0x3e, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x77, 0x68,
-  0x65, 0x74, 0x68, 0x65, 0x72, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x53,
-  0x63, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x63, 0x61, 0x74, 0x61, 0x6c, 0x6f, 0x67,
-  0x41, 0x72, 0x74, 0x69, 0x63, 0x6c, 0x65, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e,
-  0x73, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x73, 0x74, 0x75, 0x6e, 0x69, 0x66, 0x6f,
-  0x72, 0x6d, 0x6a, 0x6f, 0x75, 0x72, 0x6e, 0x65, 0x79, 0x73, 0x69, 0x64, 0x65,
-  0x62, 0x61, 0x72, 0x43, 0x68, 0x69, 0x63, 0x61, 0x67, 0x6f, 0x68, 0x6f, 0x6c,
-  0x69, 0x64, 0x61, 0x79, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x70, 0x61,
-  0x73, 0x73, 0x61, 0x67, 0x65, 0x2c, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x61,
-  0x6e, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x66, 0x65, 0x65, 0x6c, 0x69, 0x6e, 0x67,
-  0x61, 0x72, 0x72, 0x69, 0x76, 0x65, 0x64, 0x70, 0x61, 0x73, 0x73, 0x69, 0x6e,
-  0x67, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x61, 0x6c, 0x72, 0x6f, 0x75, 0x67, 0x68,
-  0x6c, 0x79, 0x2e, 0x0a, 0x0a, 0x54, 0x68, 0x65, 0x20, 0x62, 0x75, 0x74, 0x20,
-  0x6e, 0x6f, 0x74, 0x64, 0x65, 0x6e, 0x73, 0x69, 0x74, 0x79, 0x42, 0x72, 0x69,
-  0x74, 0x61, 0x69, 0x6e, 0x43, 0x68, 0x69, 0x6e, 0x65, 0x73, 0x65, 0x6c, 0x61,
-  0x63, 0x6b, 0x20, 0x6f, 0x66, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x49,
-  0x72, 0x65, 0x6c, 0x61, 0x6e, 0x64, 0x22, 0x20, 0x64, 0x61, 0x74, 0x61, 0x2d,
-  0x66, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x72, 0x65, 0x63, 0x65, 0x69, 0x76,
-  0x65, 0x74, 0x68, 0x61, 0x74, 0x20, 0x69, 0x73, 0x4c, 0x69, 0x62, 0x72, 0x61,
-  0x72, 0x79, 0x68, 0x75, 0x73, 0x62, 0x61, 0x6e, 0x64, 0x69, 0x6e, 0x20, 0x66,
-  0x61, 0x63, 0x74, 0x61, 0x66, 0x66, 0x61, 0x69, 0x72, 0x73, 0x43, 0x68, 0x61,
-  0x72, 0x6c, 0x65, 0x73, 0x72, 0x61, 0x64, 0x69, 0x63, 0x61, 0x6c, 0x62, 0x72,
-  0x6f, 0x75, 0x67, 0x68, 0x74, 0x66, 0x69, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x6c,
-  0x61, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x3a, 0x6c, 0x61, 0x6e, 0x67, 0x3d, 0x22,
-  0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20, 0x6c, 0x65, 0x61, 0x64, 0x65, 0x72,
-  0x73, 0x70, 0x6c, 0x61, 0x6e, 0x6e, 0x65, 0x64, 0x70, 0x72, 0x65, 0x6d, 0x69,
-  0x75, 0x6d, 0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x41, 0x6d, 0x65, 0x72,
-  0x69, 0x63, 0x61, 0x45, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x5d, 0x26, 0x71,
-  0x75, 0x6f, 0x74, 0x3b, 0x4d, 0x65, 0x73, 0x73, 0x61, 0x67, 0x65, 0x6e, 0x65,
-  0x65, 0x64, 0x20, 0x74, 0x6f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x63,
-  0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x78, 0x6c, 0x6f, 0x6f, 0x6b, 0x69, 0x6e, 0x67,
-  0x73, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x76,
-  0x65, 0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x65, 0x72, 0x2d, 0x6d, 0x6f, 0x62, 0x69,
-  0x6c, 0x65, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x73, 0x77, 0x61, 0x6e, 0x74,
-  0x20, 0x74, 0x6f, 0x6b, 0x69, 0x6e, 0x64, 0x20, 0x6f, 0x66, 0x46, 0x69, 0x72,
-  0x65, 0x66, 0x6f, 0x78, 0x79, 0x6f, 0x75, 0x20, 0x61, 0x72, 0x65, 0x73, 0x69,
-  0x6d, 0x69, 0x6c, 0x61, 0x72, 0x73, 0x74, 0x75, 0x64, 0x69, 0x65, 0x64, 0x6d,
-  0x61, 0x78, 0x69, 0x6d, 0x75, 0x6d, 0x68, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67,
-  0x72, 0x61, 0x70, 0x69, 0x64, 0x6c, 0x79, 0x63, 0x6c, 0x69, 0x6d, 0x61, 0x74,
-  0x65, 0x6b, 0x69, 0x6e, 0x67, 0x64, 0x6f, 0x6d, 0x65, 0x6d, 0x65, 0x72, 0x67,
-  0x65, 0x64, 0x61, 0x6d, 0x6f, 0x75, 0x6e, 0x74, 0x73, 0x66, 0x6f, 0x75, 0x6e,
-  0x64, 0x65, 0x64, 0x70, 0x69, 0x6f, 0x6e, 0x65, 0x65, 0x72, 0x66, 0x6f, 0x72,
-  0x6d, 0x75, 0x6c, 0x61, 0x64, 0x79, 0x6e, 0x61, 0x73, 0x74, 0x79, 0x68, 0x6f,
-  0x77, 0x20, 0x74, 0x6f, 0x20, 0x53, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x72,
-  0x65, 0x76, 0x65, 0x6e, 0x75, 0x65, 0x65, 0x63, 0x6f, 0x6e, 0x6f, 0x6d, 0x79,
-  0x52, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x73, 0x62, 0x72, 0x6f, 0x74, 0x68, 0x65,
-  0x72, 0x73, 0x6f, 0x6c, 0x64, 0x69, 0x65, 0x72, 0x6c, 0x61, 0x72, 0x67, 0x65,
-  0x6c, 0x79, 0x63, 0x61, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x2e, 0x26, 0x71, 0x75,
-  0x6f, 0x74, 0x3b, 0x41, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x45, 0x64, 0x77,
-  0x61, 0x72, 0x64, 0x20, 0x73, 0x65, 0x67, 0x6d, 0x65, 0x6e, 0x74, 0x52, 0x6f,
-  0x62, 0x65, 0x72, 0x74, 0x20, 0x65, 0x66, 0x66, 0x6f, 0x72, 0x74, 0x73, 0x50,
-  0x61, 0x63, 0x69, 0x66, 0x69, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x6e, 0x65, 0x64,
-  0x75, 0x70, 0x20, 0x77, 0x69, 0x74, 0x68, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74,
-  0x3a, 0x77, 0x65, 0x20, 0x68, 0x61, 0x76, 0x65, 0x41, 0x6e, 0x67, 0x65, 0x6c,
-  0x65, 0x73, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x5f, 0x73, 0x65, 0x61,
-  0x72, 0x63, 0x68, 0x61, 0x70, 0x70, 0x6c, 0x69, 0x65, 0x64, 0x61, 0x63, 0x71,
-  0x75, 0x69, 0x72, 0x65, 0x6d, 0x61, 0x73, 0x73, 0x69, 0x76, 0x65, 0x67, 0x72,
-  0x61, 0x6e, 0x74, 0x65, 0x64, 0x3a, 0x20, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x74,
-  0x72, 0x65, 0x61, 0x74, 0x65, 0x64, 0x62, 0x69, 0x67, 0x67, 0x65, 0x73, 0x74,
-  0x62, 0x65, 0x6e, 0x65, 0x66, 0x69, 0x74, 0x64, 0x72, 0x69, 0x76, 0x69, 0x6e,
-  0x67, 0x53, 0x74, 0x75, 0x64, 0x69, 0x65, 0x73, 0x6d, 0x69, 0x6e, 0x69, 0x6d,
-  0x75, 0x6d, 0x70, 0x65, 0x72, 0x68, 0x61, 0x70, 0x73, 0x6d, 0x6f, 0x72, 0x6e,
-  0x69, 0x6e, 0x67, 0x73, 0x65, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x69, 0x73, 0x20,
-  0x75, 0x73, 0x65, 0x64, 0x72, 0x65, 0x76, 0x65, 0x72, 0x73, 0x65, 0x76, 0x61,
-  0x72, 0x69, 0x61, 0x6e, 0x74, 0x20, 0x72, 0x6f, 0x6c, 0x65, 0x3d, 0x22, 0x6d,
-  0x69, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x61, 0x63, 0x68, 0x69, 0x65, 0x76, 0x65,
-  0x70, 0x72, 0x6f, 0x6d, 0x6f, 0x74, 0x65, 0x73, 0x74, 0x75, 0x64, 0x65, 0x6e,
-  0x74, 0x73, 0x6f, 0x6d, 0x65, 0x6f, 0x6e, 0x65, 0x65, 0x78, 0x74, 0x72, 0x65,
-  0x6d, 0x65, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x62, 0x6f, 0x74, 0x74,
-  0x6f, 0x6d, 0x3a, 0x65, 0x76, 0x6f, 0x6c, 0x76, 0x65, 0x64, 0x61, 0x6c, 0x6c,
-  0x20, 0x74, 0x68, 0x65, 0x73, 0x69, 0x74, 0x65, 0x6d, 0x61, 0x70, 0x65, 0x6e,
-  0x67, 0x6c, 0x69, 0x73, 0x68, 0x77, 0x61, 0x79, 0x20, 0x74, 0x6f, 0x20, 0x20,
-  0x41, 0x75, 0x67, 0x75, 0x73, 0x74, 0x73, 0x79, 0x6d, 0x62, 0x6f, 0x6c, 0x73,
-  0x43, 0x6f, 0x6d, 0x70, 0x61, 0x6e, 0x79, 0x6d, 0x61, 0x74, 0x74, 0x65, 0x72,
-  0x73, 0x6d, 0x75, 0x73, 0x69, 0x63, 0x61, 0x6c, 0x61, 0x67, 0x61, 0x69, 0x6e,
-  0x73, 0x74, 0x73, 0x65, 0x72, 0x76, 0x69, 0x6e, 0x67, 0x7d, 0x29, 0x28, 0x29,
-  0x3b, 0x0d, 0x0a, 0x70, 0x61, 0x79, 0x6d, 0x65, 0x6e, 0x74, 0x74, 0x72, 0x6f,
-  0x75, 0x62, 0x6c, 0x65, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x70, 0x74, 0x63, 0x6f,
-  0x6d, 0x70, 0x61, 0x72, 0x65, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x73, 0x70,
-  0x6c, 0x61, 0x79, 0x65, 0x72, 0x73, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x73,
-  0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72, 0x20, 0x27, 0x27, 0x54, 0x68, 0x65,
-  0x20, 0x77, 0x69, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x65, 0x78, 0x70, 0x6c, 0x6f,
-  0x72, 0x65, 0x61, 0x64, 0x61, 0x70, 0x74, 0x65, 0x64, 0x47, 0x61, 0x6c, 0x6c,
-  0x65, 0x72, 0x79, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x65, 0x61, 0x62, 0x69,
-  0x6c, 0x69, 0x74, 0x79, 0x65, 0x6e, 0x68, 0x61, 0x6e, 0x63, 0x65, 0x63, 0x61,
-  0x72, 0x65, 0x65, 0x72, 0x73, 0x29, 0x2e, 0x20, 0x54, 0x68, 0x65, 0x20, 0x63,
-  0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x53, 0x65, 0x61, 0x72, 0x63, 0x68, 0x20,
-  0x61, 0x6e, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x78, 0x69, 0x73, 0x74, 0x65,
-  0x64, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x20, 0x68, 0x61, 0x6e, 0x64, 0x6c,
-  0x65, 0x72, 0x70, 0x72, 0x69, 0x6e, 0x74, 0x65, 0x64, 0x63, 0x6f, 0x6e, 0x73,
-  0x6f, 0x6c, 0x65, 0x45, 0x61, 0x73, 0x74, 0x65, 0x72, 0x6e, 0x65, 0x78, 0x70,
-  0x6f, 0x72, 0x74, 0x73, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x73, 0x43, 0x68,
-  0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x69, 0x6c, 0x6c, 0x65, 0x67, 0x61, 0x6c, 0x6e,
-  0x65, 0x75, 0x74, 0x72, 0x61, 0x6c, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74,
-  0x5f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x69, 0x67, 0x6e, 0x69, 0x6e,
-  0x67, 0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x22, 0x3e, 0x73, 0x65, 0x74, 0x74, 0x6c,
-  0x65, 0x64, 0x77, 0x65, 0x73, 0x74, 0x65, 0x72, 0x6e, 0x63, 0x61, 0x75, 0x73,
-  0x69, 0x6e, 0x67, 0x2d, 0x77, 0x65, 0x62, 0x6b, 0x69, 0x74, 0x63, 0x6c, 0x61,
-  0x69, 0x6d, 0x65, 0x64, 0x4a, 0x75, 0x73, 0x74, 0x69, 0x63, 0x65, 0x63, 0x68,
-  0x61, 0x70, 0x74, 0x65, 0x72, 0x76, 0x69, 0x63, 0x74, 0x69, 0x6d, 0x73, 0x54,
-  0x68, 0x6f, 0x6d, 0x61, 0x73, 0x20, 0x6d, 0x6f, 0x7a, 0x69, 0x6c, 0x6c, 0x61,
-  0x70, 0x72, 0x6f, 0x6d, 0x69, 0x73, 0x65, 0x70, 0x61, 0x72, 0x74, 0x69, 0x65,
-  0x73, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x75, 0x74, 0x73, 0x69,
-  0x64, 0x65, 0x3a, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x2c, 0x68, 0x75, 0x6e, 0x64,
-  0x72, 0x65, 0x64, 0x4f, 0x6c, 0x79, 0x6d, 0x70, 0x69, 0x63, 0x5f, 0x62, 0x75,
-  0x74, 0x74, 0x6f, 0x6e, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72, 0x73, 0x72, 0x65,
-  0x61, 0x63, 0x68, 0x65, 0x64, 0x63, 0x68, 0x72, 0x6f, 0x6e, 0x69, 0x63, 0x64,
-  0x65, 0x6d, 0x61, 0x6e, 0x64, 0x73, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x73,
-  0x70, 0x72, 0x6f, 0x74, 0x65, 0x63, 0x74, 0x61, 0x64, 0x6f, 0x70, 0x74, 0x65,
-  0x64, 0x70, 0x72, 0x65, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x65, 0x69, 0x74, 0x68,
-  0x65, 0x72, 0x67, 0x72, 0x65, 0x61, 0x74, 0x6c, 0x79, 0x67, 0x72, 0x65, 0x61,
-  0x74, 0x65, 0x72, 0x6f, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x6c, 0x69, 0x6d, 0x70,
-  0x72, 0x6f, 0x76, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x61, 0x6e, 0x64, 0x73, 0x70,
-  0x65, 0x63, 0x69, 0x61, 0x6c, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x2e, 0x77,
-  0x6f, 0x72, 0x73, 0x68, 0x69, 0x70, 0x66, 0x75, 0x6e, 0x64, 0x69, 0x6e, 0x67,
-  0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x74, 0x68, 0x69, 0x67, 0x68, 0x65, 0x73,
-  0x74, 0x69, 0x6e, 0x73, 0x74, 0x65, 0x61, 0x64, 0x75, 0x74, 0x69, 0x6c, 0x69,
-  0x74, 0x79, 0x71, 0x75, 0x61, 0x72, 0x74, 0x65, 0x72, 0x43, 0x75, 0x6c, 0x74,
-  0x75, 0x72, 0x65, 0x74, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x63, 0x6c, 0x65,
-  0x61, 0x72, 0x6c, 0x79, 0x65, 0x78, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x42, 0x72,
-  0x6f, 0x77, 0x73, 0x65, 0x72, 0x6c, 0x69, 0x62, 0x65, 0x72, 0x61, 0x6c, 0x7d,
-  0x20, 0x63, 0x61, 0x74, 0x63, 0x68, 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74,
-  0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x68, 0x69, 0x64, 0x65, 0x28, 0x29,
-  0x3b, 0x46, 0x6c, 0x6f, 0x72, 0x69, 0x64, 0x61, 0x61, 0x6e, 0x73, 0x77, 0x65,
-  0x72, 0x73, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x65, 0x64, 0x45, 0x6d, 0x70, 0x65,
-  0x72, 0x6f, 0x72, 0x64, 0x65, 0x66, 0x65, 0x6e, 0x73, 0x65, 0x73, 0x65, 0x72,
-  0x69, 0x6f, 0x75, 0x73, 0x66, 0x72, 0x65, 0x65, 0x64, 0x6f, 0x6d, 0x53, 0x65,
-  0x76, 0x65, 0x72, 0x61, 0x6c, 0x2d, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x46,
-  0x75, 0x72, 0x74, 0x68, 0x65, 0x72, 0x6f, 0x75, 0x74, 0x20, 0x6f, 0x66, 0x20,
-  0x21, 0x3d, 0x20, 0x6e, 0x75, 0x6c, 0x6c, 0x74, 0x72, 0x61, 0x69, 0x6e, 0x65,
-  0x64, 0x44, 0x65, 0x6e, 0x6d, 0x61, 0x72, 0x6b, 0x76, 0x6f, 0x69, 0x64, 0x28,
-  0x30, 0x29, 0x2f, 0x61, 0x6c, 0x6c, 0x2e, 0x6a, 0x73, 0x70, 0x72, 0x65, 0x76,
-  0x65, 0x6e, 0x74, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x53, 0x74, 0x65,
-  0x70, 0x68, 0x65, 0x6e, 0x0a, 0x0a, 0x57, 0x68, 0x65, 0x6e, 0x20, 0x6f, 0x62,
-  0x73, 0x65, 0x72, 0x76, 0x65, 0x3c, 0x2f, 0x68, 0x32, 0x3e, 0x0d, 0x0a, 0x4d,
-  0x6f, 0x64, 0x65, 0x72, 0x6e, 0x20, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65,
-  0x22, 0x20, 0x61, 0x6c, 0x74, 0x3d, 0x22, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72,
-  0x73, 0x2e, 0x0a, 0x0a, 0x46, 0x6f, 0x72, 0x20, 0x0a, 0x0a, 0x4d, 0x61, 0x6e,
-  0x79, 0x20, 0x61, 0x72, 0x74, 0x69, 0x73, 0x74, 0x73, 0x70, 0x6f, 0x77, 0x65,
-  0x72, 0x65, 0x64, 0x70, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x6d, 0x66, 0x69, 0x63,
-  0x74, 0x69, 0x6f, 0x6e, 0x74, 0x79, 0x70, 0x65, 0x20, 0x6f, 0x66, 0x6d, 0x65,
-  0x64, 0x69, 0x63, 0x61, 0x6c, 0x74, 0x69, 0x63, 0x6b, 0x65, 0x74, 0x73, 0x6f,
-  0x70, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x43, 0x6f, 0x75, 0x6e, 0x63, 0x69, 0x6c,
-  0x77, 0x69, 0x74, 0x6e, 0x65, 0x73, 0x73, 0x6a, 0x75, 0x73, 0x74, 0x69, 0x63,
-  0x65, 0x47, 0x65, 0x6f, 0x72, 0x67, 0x65, 0x20, 0x42, 0x65, 0x6c, 0x67, 0x69,
-  0x75, 0x6d, 0x2e, 0x2e, 0x2e, 0x3c, 0x2f, 0x61, 0x3e, 0x74, 0x77, 0x69, 0x74,
-  0x74, 0x65, 0x72, 0x6e, 0x6f, 0x74, 0x61, 0x62, 0x6c, 0x79, 0x77, 0x61, 0x69,
-  0x74, 0x69, 0x6e, 0x67, 0x77, 0x61, 0x72, 0x66, 0x61, 0x72, 0x65, 0x20, 0x4f,
-  0x74, 0x68, 0x65, 0x72, 0x20, 0x72, 0x61, 0x6e, 0x6b, 0x69, 0x6e, 0x67, 0x70,
-  0x68, 0x72, 0x61, 0x73, 0x65, 0x73, 0x6d, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x75, 0x72, 0x76, 0x69, 0x76, 0x65, 0x73, 0x63, 0x68, 0x6f, 0x6c, 0x61,
-  0x72, 0x3c, 0x2f, 0x70, 0x3e, 0x0d, 0x0a, 0x20, 0x43, 0x6f, 0x75, 0x6e, 0x74,
-  0x72, 0x79, 0x69, 0x67, 0x6e, 0x6f, 0x72, 0x65, 0x64, 0x6c, 0x6f, 0x73, 0x73,
-  0x20, 0x6f, 0x66, 0x6a, 0x75, 0x73, 0x74, 0x20, 0x61, 0x73, 0x47, 0x65, 0x6f,
-  0x72, 0x67, 0x69, 0x61, 0x73, 0x74, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x3c, 0x68,
-  0x65, 0x61, 0x64, 0x3e, 0x3c, 0x73, 0x74, 0x6f, 0x70, 0x70, 0x65, 0x64, 0x31,
-  0x27, 0x5d, 0x29, 0x3b, 0x0d, 0x0a, 0x69, 0x73, 0x6c, 0x61, 0x6e, 0x64, 0x73,
-  0x6e, 0x6f, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72,
-  0x3a, 0x6c, 0x69, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x63, 0x61, 0x72, 0x72, 0x69,
-  0x65, 0x64, 0x31, 0x30, 0x30, 0x2c, 0x30, 0x30, 0x30, 0x3c, 0x2f, 0x68, 0x33,
-  0x3e, 0x0a, 0x20, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x62, 0x65, 0x63,
-  0x6f, 0x6d, 0x65, 0x73, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x20, 0x77, 0x65,
-  0x64, 0x64, 0x69, 0x6e, 0x67, 0x30, 0x30, 0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x6d,
-  0x6f, 0x6e, 0x61, 0x72, 0x63, 0x68, 0x6f, 0x66, 0x66, 0x20, 0x74, 0x68, 0x65,
-  0x74, 0x65, 0x61, 0x63, 0x68, 0x65, 0x72, 0x68, 0x69, 0x67, 0x68, 0x6c, 0x79,
-  0x20, 0x62, 0x69, 0x6f, 0x6c, 0x6f, 0x67, 0x79, 0x6c, 0x69, 0x66, 0x65, 0x20,
-  0x6f, 0x66, 0x6f, 0x72, 0x20, 0x65, 0x76, 0x65, 0x6e, 0x72, 0x69, 0x73, 0x65,
-  0x20, 0x6f, 0x66, 0x26, 0x72, 0x61, 0x71, 0x75, 0x6f, 0x3b, 0x70, 0x6c, 0x75,
-  0x73, 0x6f, 0x6e, 0x65, 0x68, 0x75, 0x6e, 0x74, 0x69, 0x6e, 0x67, 0x28, 0x74,
-  0x68, 0x6f, 0x75, 0x67, 0x68, 0x44, 0x6f, 0x75, 0x67, 0x6c, 0x61, 0x73, 0x6a,
-  0x6f, 0x69, 0x6e, 0x69, 0x6e, 0x67, 0x63, 0x69, 0x72, 0x63, 0x6c, 0x65, 0x73,
-  0x46, 0x6f, 0x72, 0x20, 0x74, 0x68, 0x65, 0x41, 0x6e, 0x63, 0x69, 0x65, 0x6e,
-  0x74, 0x56, 0x69, 0x65, 0x74, 0x6e, 0x61, 0x6d, 0x76, 0x65, 0x68, 0x69, 0x63,
-  0x6c, 0x65, 0x73, 0x75, 0x63, 0x68, 0x20, 0x61, 0x73, 0x63, 0x72, 0x79, 0x73,
-  0x74, 0x61, 0x6c, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x20, 0x3d, 0x57, 0x69, 0x6e,
-  0x64, 0x6f, 0x77, 0x73, 0x65, 0x6e, 0x6a, 0x6f, 0x79, 0x65, 0x64, 0x61, 0x20,
-  0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x61, 0x73, 0x73, 0x75, 0x6d, 0x65, 0x64, 0x3c,
-  0x61, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x66, 0x6f, 0x72, 0x65, 0x69, 0x67, 0x6e,
-  0x20, 0x41, 0x6c, 0x6c, 0x20, 0x72, 0x69, 0x68, 0x6f, 0x77, 0x20, 0x74, 0x68,
-  0x65, 0x44, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x72, 0x65, 0x74, 0x69, 0x72,
-  0x65, 0x64, 0x68, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x68, 0x69, 0x64, 0x64,
-  0x65, 0x6e, 0x3b, 0x62, 0x61, 0x74, 0x74, 0x6c, 0x65, 0x73, 0x73, 0x65, 0x65,
-  0x6b, 0x69, 0x6e, 0x67, 0x63, 0x61, 0x62, 0x69, 0x6e, 0x65, 0x74, 0x77, 0x61,
-  0x73, 0x20, 0x6e, 0x6f, 0x74, 0x6c, 0x6f, 0x6f, 0x6b, 0x20, 0x61, 0x74, 0x63,
-  0x6f, 0x6e, 0x64, 0x75, 0x63, 0x74, 0x67, 0x65, 0x74, 0x20, 0x74, 0x68, 0x65,
-  0x4a, 0x61, 0x6e, 0x75, 0x61, 0x72, 0x79, 0x68, 0x61, 0x70, 0x70, 0x65, 0x6e,
-  0x73, 0x74, 0x75, 0x72, 0x6e, 0x69, 0x6e, 0x67, 0x61, 0x3a, 0x68, 0x6f, 0x76,
-  0x65, 0x72, 0x4f, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x20, 0x46, 0x72, 0x65, 0x6e,
-  0x63, 0x68, 0x20, 0x6c, 0x61, 0x63, 0x6b, 0x69, 0x6e, 0x67, 0x74, 0x79, 0x70,
-  0x69, 0x63, 0x61, 0x6c, 0x65, 0x78, 0x74, 0x72, 0x61, 0x63, 0x74, 0x65, 0x6e,
-  0x65, 0x6d, 0x69, 0x65, 0x73, 0x65, 0x76, 0x65, 0x6e, 0x20, 0x69, 0x66, 0x67,
-  0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x64, 0x65, 0x63, 0x69, 0x64, 0x65, 0x64,
-  0x61, 0x72, 0x65, 0x20, 0x6e, 0x6f, 0x74, 0x2f, 0x73, 0x65, 0x61, 0x72, 0x63,
-  0x68, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x66, 0x73, 0x2d, 0x69, 0x6d, 0x61, 0x67,
-  0x65, 0x3a, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x65, 0x64, 0x73, 0x74, 0x61, 0x74,
-  0x69, 0x63, 0x2e, 0x6c, 0x6f, 0x67, 0x69, 0x6e, 0x22, 0x3e, 0x63, 0x6f, 0x6e,
-  0x76, 0x65, 0x72, 0x74, 0x76, 0x69, 0x6f, 0x6c, 0x65, 0x6e, 0x74, 0x65, 0x6e,
-  0x74, 0x65, 0x72, 0x65, 0x64, 0x66, 0x69, 0x72, 0x73, 0x74, 0x22, 0x3e, 0x63,
-  0x69, 0x72, 0x63, 0x75, 0x69, 0x74, 0x46, 0x69, 0x6e, 0x6c, 0x61, 0x6e, 0x64,
-  0x63, 0x68, 0x65, 0x6d, 0x69, 0x73, 0x74, 0x73, 0x68, 0x65, 0x20, 0x77, 0x61,
-  0x73, 0x31, 0x30, 0x70, 0x78, 0x3b, 0x22, 0x3e, 0x61, 0x73, 0x20, 0x73, 0x75,
-  0x63, 0x68, 0x64, 0x69, 0x76, 0x69, 0x64, 0x65, 0x64, 0x3c, 0x2f, 0x73, 0x70,
-  0x61, 0x6e, 0x3e, 0x77, 0x69, 0x6c, 0x6c, 0x20, 0x62, 0x65, 0x6c, 0x69, 0x6e,
-  0x65, 0x20, 0x6f, 0x66, 0x61, 0x20, 0x67, 0x72, 0x65, 0x61, 0x74, 0x6d, 0x79,
-  0x73, 0x74, 0x65, 0x72, 0x79, 0x2f, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x2e, 0x66,
-  0x61, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x64, 0x75, 0x65, 0x20, 0x74, 0x6f, 0x20,
-  0x72, 0x61, 0x69, 0x6c, 0x77, 0x61, 0x79, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x67,
-  0x65, 0x6d, 0x6f, 0x6e, 0x73, 0x74, 0x65, 0x72, 0x64, 0x65, 0x73, 0x63, 0x65,
-  0x6e, 0x74, 0x69, 0x74, 0x20, 0x77, 0x69, 0x74, 0x68, 0x6e, 0x75, 0x63, 0x6c,
-  0x65, 0x61, 0x72, 0x4a, 0x65, 0x77, 0x69, 0x73, 0x68, 0x20, 0x70, 0x72, 0x6f,
-  0x74, 0x65, 0x73, 0x74, 0x42, 0x72, 0x69, 0x74, 0x69, 0x73, 0x68, 0x66, 0x6c,
-  0x6f, 0x77, 0x65, 0x72, 0x73, 0x70, 0x72, 0x65, 0x64, 0x69, 0x63, 0x74, 0x72,
-  0x65, 0x66, 0x6f, 0x72, 0x6d, 0x73, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x20,
-  0x77, 0x68, 0x6f, 0x20, 0x77, 0x61, 0x73, 0x6c, 0x65, 0x63, 0x74, 0x75, 0x72,
-  0x65, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x73, 0x75, 0x69, 0x63, 0x69,
-  0x64, 0x65, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x63, 0x70, 0x65, 0x72, 0x69,
-  0x6f, 0x64, 0x73, 0x6d, 0x61, 0x72, 0x6b, 0x65, 0x74, 0x73, 0x53, 0x6f, 0x63,
-  0x69, 0x61, 0x6c, 0x20, 0x66, 0x69, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x63, 0x6f,
-  0x6d, 0x62, 0x69, 0x6e, 0x65, 0x67, 0x72, 0x61, 0x70, 0x68, 0x69, 0x63, 0x77,
-  0x69, 0x6e, 0x6e, 0x65, 0x72, 0x73, 0x3c, 0x62, 0x72, 0x20, 0x2f, 0x3e, 0x3c,
-  0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x4e, 0x61, 0x74, 0x75, 0x72, 0x61,
-  0x6c, 0x50, 0x72, 0x69, 0x76, 0x61, 0x63, 0x79, 0x63, 0x6f, 0x6f, 0x6b, 0x69,
-  0x65, 0x73, 0x6f, 0x75, 0x74, 0x63, 0x6f, 0x6d, 0x65, 0x72, 0x65, 0x73, 0x6f,
-  0x6c, 0x76, 0x65, 0x53, 0x77, 0x65, 0x64, 0x69, 0x73, 0x68, 0x62, 0x72, 0x69,
-  0x65, 0x66, 0x6c, 0x79, 0x50, 0x65, 0x72, 0x73, 0x69, 0x61, 0x6e, 0x73, 0x6f,
-  0x20, 0x6d, 0x75, 0x63, 0x68, 0x43, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x79, 0x64,
-  0x65, 0x70, 0x69, 0x63, 0x74, 0x73, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x6e, 0x73,
-  0x68, 0x6f, 0x75, 0x73, 0x69, 0x6e, 0x67, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x73, 0x6e, 0x65, 0x78, 0x74, 0x20, 0x74, 0x6f, 0x62, 0x65, 0x61, 0x72, 0x69,
-  0x6e, 0x67, 0x6d, 0x61, 0x70, 0x70, 0x69, 0x6e, 0x67, 0x72, 0x65, 0x76, 0x69,
-  0x73, 0x65, 0x64, 0x6a, 0x51, 0x75, 0x65, 0x72, 0x79, 0x28, 0x2d, 0x77, 0x69,
-  0x64, 0x74, 0x68, 0x3a, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x22, 0x3e, 0x74, 0x6f,
-  0x6f, 0x6c, 0x74, 0x69, 0x70, 0x53, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x64,
-  0x65, 0x73, 0x69, 0x67, 0x6e, 0x73, 0x54, 0x75, 0x72, 0x6b, 0x69, 0x73, 0x68,
-  0x79, 0x6f, 0x75, 0x6e, 0x67, 0x65, 0x72, 0x2e, 0x6d, 0x61, 0x74, 0x63, 0x68,
-  0x28, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x0a, 0x0a, 0x62, 0x75, 0x72, 0x6e, 0x69,
-  0x6e, 0x67, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x65, 0x67, 0x72,
-  0x65, 0x65, 0x73, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x3d, 0x52, 0x69, 0x63,
-  0x68, 0x61, 0x72, 0x64, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x6c, 0x79, 0x70, 0x6c,
-  0x61, 0x73, 0x74, 0x69, 0x63, 0x65, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x3c,
-  0x2f, 0x74, 0x72, 0x3e, 0x0d, 0x0a, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a, 0x23,
-  0x75, 0x6c, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x70, 0x6f, 0x73, 0x73, 0x65, 0x73,
-  0x73, 0x72, 0x6f, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x70, 0x68, 0x79, 0x73, 0x69,
-  0x63, 0x73, 0x66, 0x61, 0x69, 0x6c, 0x69, 0x6e, 0x67, 0x65, 0x78, 0x65, 0x63,
-  0x75, 0x74, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x73, 0x74, 0x6c, 0x69, 0x6e,
-  0x6b, 0x20, 0x74, 0x6f, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c, 0x74, 0x3c, 0x62,
-  0x72, 0x20, 0x2f, 0x3e, 0x0a, 0x3a, 0x20, 0x74, 0x72, 0x75, 0x65, 0x2c, 0x63,
-  0x68, 0x61, 0x72, 0x74, 0x65, 0x72, 0x74, 0x6f, 0x75, 0x72, 0x69, 0x73, 0x6d,
-  0x63, 0x6c, 0x61, 0x73, 0x73, 0x69, 0x63, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x65,
-  0x64, 0x65, 0x78, 0x70, 0x6c, 0x61, 0x69, 0x6e, 0x3c, 0x2f, 0x68, 0x31, 0x3e,
-  0x0d, 0x0a, 0x6f, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x2e, 0x3f, 0x78, 0x6d, 0x6c,
-  0x20, 0x76, 0x65, 0x68, 0x65, 0x6c, 0x70, 0x69, 0x6e, 0x67, 0x64, 0x69, 0x61,
-  0x6d, 0x6f, 0x6e, 0x64, 0x75, 0x73, 0x65, 0x20, 0x74, 0x68, 0x65, 0x61, 0x69,
-  0x72, 0x6c, 0x69, 0x6e, 0x65, 0x65, 0x6e, 0x64, 0x20, 0x2d, 0x2d, 0x3e, 0x29,
-  0x2e, 0x61, 0x74, 0x74, 0x72, 0x28, 0x72, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73,
-  0x68, 0x6f, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x23, 0x66, 0x66, 0x66, 0x66, 0x66,
-  0x66, 0x72, 0x65, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x56, 0x69, 0x6e, 0x63, 0x65,
-  0x6e, 0x74, 0x73, 0x69, 0x67, 0x6e, 0x61, 0x6c, 0x73, 0x20, 0x73, 0x72, 0x63,
-  0x3d, 0x22, 0x2f, 0x50, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x64, 0x65, 0x73,
-  0x70, 0x69, 0x74, 0x65, 0x64, 0x69, 0x76, 0x65, 0x72, 0x73, 0x65, 0x74, 0x65,
-  0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x50, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x20, 0x68,
-  0x65, 0x6c, 0x64, 0x20, 0x69, 0x6e, 0x4a, 0x6f, 0x73, 0x65, 0x70, 0x68, 0x20,
-  0x74, 0x68, 0x65, 0x61, 0x74, 0x72, 0x65, 0x61, 0x66, 0x66, 0x65, 0x63, 0x74,
-  0x73, 0x3c, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3e, 0x61, 0x20, 0x6c, 0x61, 0x72,
-  0x67, 0x65, 0x64, 0x6f, 0x65, 0x73, 0x6e, 0x27, 0x74, 0x6c, 0x61, 0x74, 0x65,
-  0x72, 0x2c, 0x20, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x66, 0x61, 0x76,
-  0x69, 0x63, 0x6f, 0x6e, 0x63, 0x72, 0x65, 0x61, 0x74, 0x6f, 0x72, 0x48, 0x75,
-  0x6e, 0x67, 0x61, 0x72, 0x79, 0x41, 0x69, 0x72, 0x70, 0x6f, 0x72, 0x74, 0x73,
-  0x65, 0x65, 0x20, 0x74, 0x68, 0x65, 0x73, 0x6f, 0x20, 0x74, 0x68, 0x61, 0x74,
-  0x4d, 0x69, 0x63, 0x68, 0x61, 0x65, 0x6c, 0x53, 0x79, 0x73, 0x74, 0x65, 0x6d,
-  0x73, 0x50, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x73, 0x2c, 0x20, 0x61, 0x6e,
-  0x64, 0x20, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x65, 0x26, 0x71, 0x75,
-  0x6f, 0x74, 0x3b, 0x74, 0x72, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x6c, 0x65, 0x66,
-  0x74, 0x22, 0x3e, 0x0a, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x73, 0x47, 0x6f,
-  0x6c, 0x64, 0x65, 0x6e, 0x20, 0x41, 0x66, 0x66, 0x61, 0x69, 0x72, 0x73, 0x67,
-  0x72, 0x61, 0x6d, 0x6d, 0x61, 0x72, 0x66, 0x6f, 0x72, 0x6d, 0x69, 0x6e, 0x67,
-  0x64, 0x65, 0x73, 0x74, 0x72, 0x6f, 0x79, 0x69, 0x64, 0x65, 0x61, 0x20, 0x6f,
-  0x66, 0x63, 0x61, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x6f, 0x6c, 0x64, 0x65, 0x73,
-  0x74, 0x20, 0x74, 0x68, 0x69, 0x73, 0x20, 0x69, 0x73, 0x2e, 0x73, 0x72, 0x63,
-  0x20, 0x3d, 0x20, 0x63, 0x61, 0x72, 0x74, 0x6f, 0x6f, 0x6e, 0x72, 0x65, 0x67,
-  0x69, 0x73, 0x74, 0x72, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x73, 0x4d, 0x75,
-  0x73, 0x6c, 0x69, 0x6d, 0x73, 0x57, 0x68, 0x61, 0x74, 0x20, 0x69, 0x73, 0x69,
-  0x6e, 0x20, 0x6d, 0x61, 0x6e, 0x79, 0x6d, 0x61, 0x72, 0x6b, 0x69, 0x6e, 0x67,
-  0x72, 0x65, 0x76, 0x65, 0x61, 0x6c, 0x73, 0x49, 0x6e, 0x64, 0x65, 0x65, 0x64,
-  0x2c, 0x65, 0x71, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x2f, 0x73, 0x68, 0x6f, 0x77,
-  0x5f, 0x61, 0x6f, 0x75, 0x74, 0x64, 0x6f, 0x6f, 0x72, 0x65, 0x73, 0x63, 0x61,
-  0x70, 0x65, 0x28, 0x41, 0x75, 0x73, 0x74, 0x72, 0x69, 0x61, 0x67, 0x65, 0x6e,
-  0x65, 0x74, 0x69, 0x63, 0x73, 0x79, 0x73, 0x74, 0x65, 0x6d, 0x2c, 0x49, 0x6e,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x69, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x48,
-  0x65, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x49, 0x73, 0x6c, 0x61, 0x6e, 0x64, 0x73,
-  0x41, 0x63, 0x61, 0x64, 0x65, 0x6d, 0x79, 0x0a, 0x09, 0x09, 0x3c, 0x21, 0x2d,
-  0x2d, 0x44, 0x61, 0x6e, 0x69, 0x65, 0x6c, 0x20, 0x62, 0x69, 0x6e, 0x64, 0x69,
-  0x6e, 0x67, 0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x22, 0x3e, 0x69, 0x6d, 0x70, 0x6f,
-  0x73, 0x65, 0x64, 0x75, 0x74, 0x69, 0x6c, 0x69, 0x7a, 0x65, 0x41, 0x62, 0x72,
-  0x61, 0x68, 0x61, 0x6d, 0x28, 0x65, 0x78, 0x63, 0x65, 0x70, 0x74, 0x7b, 0x77,
-  0x69, 0x64, 0x74, 0x68, 0x3a, 0x70, 0x75, 0x74, 0x74, 0x69, 0x6e, 0x67, 0x29,
-  0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x28, 0x7c, 0x7c, 0x20, 0x5b, 0x5d, 0x3b, 0x0a,
-  0x44, 0x41, 0x54, 0x41, 0x5b, 0x20, 0x2a, 0x6b, 0x69, 0x74, 0x63, 0x68, 0x65,
-  0x6e, 0x6d, 0x6f, 0x75, 0x6e, 0x74, 0x65, 0x64, 0x61, 0x63, 0x74, 0x75, 0x61,
-  0x6c, 0x20, 0x64, 0x69, 0x61, 0x6c, 0x65, 0x63, 0x74, 0x6d, 0x61, 0x69, 0x6e,
-  0x6c, 0x79, 0x20, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x27, 0x69, 0x6e, 0x73,
-  0x74, 0x61, 0x6c, 0x6c, 0x65, 0x78, 0x70, 0x65, 0x72, 0x74, 0x73, 0x69, 0x66,
-  0x28, 0x74, 0x79, 0x70, 0x65, 0x49, 0x74, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x26,
-  0x63, 0x6f, 0x70, 0x79, 0x3b, 0x20, 0x22, 0x3e, 0x54, 0x65, 0x72, 0x6d, 0x73,
-  0x62, 0x6f, 0x72, 0x6e, 0x20, 0x69, 0x6e, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x65, 0x61, 0x73, 0x74, 0x65, 0x72, 0x6e, 0x74, 0x61, 0x6c, 0x6b, 0x69,
-  0x6e, 0x67, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x72, 0x6e, 0x67, 0x61, 0x69, 0x6e,
-  0x65, 0x64, 0x20, 0x6f, 0x6e, 0x67, 0x6f, 0x69, 0x6e, 0x67, 0x6a, 0x75, 0x73,
-  0x74, 0x69, 0x66, 0x79, 0x63, 0x72, 0x69, 0x74, 0x69, 0x63, 0x73, 0x66, 0x61,
-  0x63, 0x74, 0x6f, 0x72, 0x79, 0x69, 0x74, 0x73, 0x20, 0x6f, 0x77, 0x6e, 0x61,
-  0x73, 0x73, 0x61, 0x75, 0x6c, 0x74, 0x69, 0x6e, 0x76, 0x69, 0x74, 0x65, 0x64,
-  0x6c, 0x61, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x68, 0x69, 0x73, 0x20, 0x6f, 0x77,
-  0x6e, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x2f, 0x22, 0x20, 0x72, 0x65, 0x6c,
-  0x3d, 0x22, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x63, 0x6f, 0x6e, 0x63,
-  0x65, 0x72, 0x74, 0x64, 0x69, 0x61, 0x67, 0x72, 0x61, 0x6d, 0x64, 0x6f, 0x6c,
-  0x6c, 0x61, 0x72, 0x73, 0x63, 0x6c, 0x75, 0x73, 0x74, 0x65, 0x72, 0x70, 0x68,
-  0x70, 0x3f, 0x69, 0x64, 0x3d, 0x61, 0x6c, 0x63, 0x6f, 0x68, 0x6f, 0x6c, 0x29,
-  0x3b, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x75, 0x73, 0x69, 0x6e, 0x67, 0x20, 0x61,
-  0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x76, 0x65, 0x73, 0x73, 0x65, 0x6c,
-  0x73, 0x72, 0x65, 0x76, 0x69, 0x76, 0x61, 0x6c, 0x41, 0x64, 0x64, 0x72, 0x65,
-  0x73, 0x73, 0x61, 0x6d, 0x61, 0x74, 0x65, 0x75, 0x72, 0x61, 0x6e, 0x64, 0x72,
-  0x6f, 0x69, 0x64, 0x61, 0x6c, 0x6c, 0x65, 0x67, 0x65, 0x64, 0x69, 0x6c, 0x6c,
-  0x6e, 0x65, 0x73, 0x73, 0x77, 0x61, 0x6c, 0x6b, 0x69, 0x6e, 0x67, 0x63, 0x65,
-  0x6e, 0x74, 0x65, 0x72, 0x73, 0x71, 0x75, 0x61, 0x6c, 0x69, 0x66, 0x79, 0x6d,
-  0x61, 0x74, 0x63, 0x68, 0x65, 0x73, 0x75, 0x6e, 0x69, 0x66, 0x69, 0x65, 0x64,
-  0x65, 0x78, 0x74, 0x69, 0x6e, 0x63, 0x74, 0x44, 0x65, 0x66, 0x65, 0x6e, 0x73,
-  0x65, 0x64, 0x69, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x0a, 0x09, 0x3c, 0x21, 0x2d,
-  0x2d, 0x20, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x73, 0x6c, 0x69, 0x6e, 0x6b,
-  0x69, 0x6e, 0x67, 0x4c, 0x69, 0x74, 0x74, 0x6c, 0x65, 0x20, 0x42, 0x6f, 0x6f,
-  0x6b, 0x20, 0x6f, 0x66, 0x65, 0x76, 0x65, 0x6e, 0x69, 0x6e, 0x67, 0x6d, 0x69,
-  0x6e, 0x2e, 0x6a, 0x73, 0x3f, 0x61, 0x72, 0x65, 0x20, 0x74, 0x68, 0x65, 0x6b,
-  0x6f, 0x6e, 0x74, 0x61, 0x6b, 0x74, 0x74, 0x6f, 0x64, 0x61, 0x79, 0x27, 0x73,
-  0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x22, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74,
-  0x3d, 0x77, 0x65, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x41, 0x6c, 0x6c, 0x20, 0x52,
-  0x69, 0x67, 0x3b, 0x0a, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x72, 0x61, 0x69, 0x73,
-  0x69, 0x6e, 0x67, 0x20, 0x41, 0x6c, 0x73, 0x6f, 0x2c, 0x20, 0x63, 0x72, 0x75,
-  0x63, 0x69, 0x61, 0x6c, 0x61, 0x62, 0x6f, 0x75, 0x74, 0x22, 0x3e, 0x64, 0x65,
-  0x63, 0x6c, 0x61, 0x72, 0x65, 0x2d, 0x2d, 0x3e, 0x0a, 0x3c, 0x73, 0x63, 0x66,
-  0x69, 0x72, 0x65, 0x66, 0x6f, 0x78, 0x61, 0x73, 0x20, 0x6d, 0x75, 0x63, 0x68,
-  0x61, 0x70, 0x70, 0x6c, 0x69, 0x65, 0x73, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x2c,
-  0x20, 0x73, 0x2c, 0x20, 0x62, 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x20,
-  0x3d, 0x20, 0x0a, 0x0d, 0x0a, 0x3c, 0x21, 0x2d, 0x2d, 0x74, 0x6f, 0x77, 0x61,
-  0x72, 0x64, 0x73, 0x52, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x73, 0x50, 0x72, 0x69,
-  0x76, 0x61, 0x74, 0x65, 0x46, 0x6f, 0x72, 0x65, 0x69, 0x67, 0x6e, 0x50, 0x72,
-  0x65, 0x6d, 0x69, 0x65, 0x72, 0x63, 0x68, 0x6f, 0x69, 0x63, 0x65, 0x73, 0x56,
-  0x69, 0x72, 0x74, 0x75, 0x61, 0x6c, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x73,
-  0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x50, 0x6f, 0x77, 0x65, 0x72, 0x65,
-  0x64, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x3b, 0x70, 0x6f, 0x76, 0x65, 0x72,
-  0x74, 0x79, 0x63, 0x68, 0x61, 0x6d, 0x62, 0x65, 0x72, 0x4c, 0x69, 0x76, 0x69,
-  0x6e, 0x67, 0x20, 0x76, 0x6f, 0x6c, 0x75, 0x6d, 0x65, 0x73, 0x41, 0x6e, 0x74,
-  0x68, 0x6f, 0x6e, 0x79, 0x6c, 0x6f, 0x67, 0x69, 0x6e, 0x22, 0x20, 0x52, 0x65,
-  0x6c, 0x61, 0x74, 0x65, 0x64, 0x45, 0x63, 0x6f, 0x6e, 0x6f, 0x6d, 0x79, 0x72,
-  0x65, 0x61, 0x63, 0x68, 0x65, 0x73, 0x63, 0x75, 0x74, 0x74, 0x69, 0x6e, 0x67,
-  0x67, 0x72, 0x61, 0x76, 0x69, 0x74, 0x79, 0x6c, 0x69, 0x66, 0x65, 0x20, 0x69,
-  0x6e, 0x43, 0x68, 0x61, 0x70, 0x74, 0x65, 0x72, 0x2d, 0x73, 0x68, 0x61, 0x64,
-  0x6f, 0x77, 0x4e, 0x6f, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x3c, 0x2f, 0x74, 0x64,
-  0x3e, 0x0d, 0x0a, 0x20, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x73, 0x74, 0x61,
-  0x64, 0x69, 0x75, 0x6d, 0x77, 0x69, 0x64, 0x67, 0x65, 0x74, 0x73, 0x76, 0x61,
-  0x72, 0x79, 0x69, 0x6e, 0x67, 0x74, 0x72, 0x61, 0x76, 0x65, 0x6c, 0x73, 0x68,
-  0x65, 0x6c, 0x64, 0x20, 0x62, 0x79, 0x77, 0x68, 0x6f, 0x20, 0x61, 0x72, 0x65,
-  0x77, 0x6f, 0x72, 0x6b, 0x20, 0x69, 0x6e, 0x66, 0x61, 0x63, 0x75, 0x6c, 0x74,
-  0x79, 0x61, 0x6e, 0x67, 0x75, 0x6c, 0x61, 0x72, 0x77, 0x68, 0x6f, 0x20, 0x68,
-  0x61, 0x64, 0x61, 0x69, 0x72, 0x70, 0x6f, 0x72, 0x74, 0x74, 0x6f, 0x77, 0x6e,
-  0x20, 0x6f, 0x66, 0x0a, 0x0a, 0x53, 0x6f, 0x6d, 0x65, 0x20, 0x27, 0x63, 0x6c,
-  0x69, 0x63, 0x6b, 0x27, 0x63, 0x68, 0x61, 0x72, 0x67, 0x65, 0x73, 0x6b, 0x65,
-  0x79, 0x77, 0x6f, 0x72, 0x64, 0x69, 0x74, 0x20, 0x77, 0x69, 0x6c, 0x6c, 0x63,
-  0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x28, 0x74, 0x68, 0x69, 0x73, 0x29, 0x3b,
-  0x41, 0x6e, 0x64, 0x72, 0x65, 0x77, 0x20, 0x75, 0x6e, 0x69, 0x71, 0x75, 0x65,
-  0x20, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x65, 0x64, 0x6f, 0x72, 0x20, 0x6d, 0x6f,
-  0x72, 0x65, 0x33, 0x30, 0x30, 0x70, 0x78, 0x3b, 0x20, 0x72, 0x65, 0x74, 0x75,
-  0x72, 0x6e, 0x3b, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x3d, 0x22, 0x70, 0x6c, 0x75,
-  0x67, 0x69, 0x6e, 0x73, 0x77, 0x69, 0x74, 0x68, 0x69, 0x6e, 0x20, 0x68, 0x65,
-  0x72, 0x73, 0x65, 0x6c, 0x66, 0x53, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x46,
-  0x65, 0x64, 0x65, 0x72, 0x61, 0x6c, 0x76, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x65,
-  0x70, 0x75, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x73, 0x65, 0x6e, 0x74, 0x20, 0x74,
-  0x6f, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x63, 0x74, 0x72, 0x65,
-  0x73, 0x73, 0x63, 0x6f, 0x6d, 0x65, 0x20, 0x74, 0x6f, 0x66, 0x69, 0x6e, 0x67,
-  0x65, 0x72, 0x73, 0x44, 0x75, 0x6b, 0x65, 0x20, 0x6f, 0x66, 0x70, 0x65, 0x6f,
-  0x70, 0x6c, 0x65, 0x2c, 0x65, 0x78, 0x70, 0x6c, 0x6f, 0x69, 0x74, 0x77, 0x68,
-  0x61, 0x74, 0x20, 0x69, 0x73, 0x68, 0x61, 0x72, 0x6d, 0x6f, 0x6e, 0x79, 0x61,
-  0x20, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x22, 0x3a, 0x22, 0x68, 0x74, 0x74, 0x70,
-  0x69, 0x6e, 0x20, 0x68, 0x69, 0x73, 0x20, 0x6d, 0x65, 0x6e, 0x75, 0x22, 0x3e,
-  0x0a, 0x6d, 0x6f, 0x6e, 0x74, 0x68, 0x6c, 0x79, 0x6f, 0x66, 0x66, 0x69, 0x63,
-  0x65, 0x72, 0x63, 0x6f, 0x75, 0x6e, 0x63, 0x69, 0x6c, 0x67, 0x61, 0x69, 0x6e,
-  0x69, 0x6e, 0x67, 0x65, 0x76, 0x65, 0x6e, 0x20, 0x69, 0x6e, 0x53, 0x75, 0x6d,
-  0x6d, 0x61, 0x72, 0x79, 0x64, 0x61, 0x74, 0x65, 0x20, 0x6f, 0x66, 0x6c, 0x6f,
-  0x79, 0x61, 0x6c, 0x74, 0x79, 0x66, 0x69, 0x74, 0x6e, 0x65, 0x73, 0x73, 0x61,
-  0x6e, 0x64, 0x20, 0x77, 0x61, 0x73, 0x65, 0x6d, 0x70, 0x65, 0x72, 0x6f, 0x72,
-  0x73, 0x75, 0x70, 0x72, 0x65, 0x6d, 0x65, 0x53, 0x65, 0x63, 0x6f, 0x6e, 0x64,
-  0x20, 0x68, 0x65, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x52, 0x75, 0x73, 0x73, 0x69,
-  0x61, 0x6e, 0x6c, 0x6f, 0x6e, 0x67, 0x65, 0x73, 0x74, 0x41, 0x6c, 0x62, 0x65,
-  0x72, 0x74, 0x61, 0x6c, 0x61, 0x74, 0x65, 0x72, 0x61, 0x6c, 0x73, 0x65, 0x74,
-  0x20, 0x6f, 0x66, 0x20, 0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x22, 0x3e, 0x2e, 0x61,
-  0x70, 0x70, 0x65, 0x6e, 0x64, 0x64, 0x6f, 0x20, 0x77, 0x69, 0x74, 0x68, 0x66,
-  0x65, 0x64, 0x65, 0x72, 0x61, 0x6c, 0x62, 0x61, 0x6e, 0x6b, 0x20, 0x6f, 0x66,
-  0x62, 0x65, 0x6e, 0x65, 0x61, 0x74, 0x68, 0x44, 0x65, 0x73, 0x70, 0x69, 0x74,
-  0x65, 0x43, 0x61, 0x70, 0x69, 0x74, 0x61, 0x6c, 0x67, 0x72, 0x6f, 0x75, 0x6e,
-  0x64, 0x73, 0x29, 0x2c, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x70, 0x65, 0x72, 0x63,
-  0x65, 0x6e, 0x74, 0x69, 0x74, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x63, 0x6c, 0x6f,
-  0x73, 0x69, 0x6e, 0x67, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x49, 0x6e,
-  0x73, 0x74, 0x65, 0x61, 0x64, 0x66, 0x69, 0x66, 0x74, 0x65, 0x65, 0x6e, 0x61,
-  0x73, 0x20, 0x77, 0x65, 0x6c, 0x6c, 0x2e, 0x79, 0x61, 0x68, 0x6f, 0x6f, 0x2e,
-  0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x64, 0x66, 0x69, 0x67, 0x68, 0x74, 0x65,
-  0x72, 0x6f, 0x62, 0x73, 0x63, 0x75, 0x72, 0x65, 0x72, 0x65, 0x66, 0x6c, 0x65,
-  0x63, 0x74, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x63, 0x3d, 0x20, 0x4d, 0x61,
-  0x74, 0x68, 0x2e, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6e, 0x67, 0x6f, 0x6e, 0x6c,
-  0x69, 0x6e, 0x65, 0x20, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x61, 0x20,
-  0x77, 0x68, 0x6f, 0x6c, 0x65, 0x6f, 0x6e, 0x65, 0x72, 0x72, 0x6f, 0x72, 0x79,
-  0x65, 0x61, 0x72, 0x20, 0x6f, 0x66, 0x65, 0x6e, 0x64, 0x20, 0x6f, 0x66, 0x20,
-  0x62, 0x61, 0x72, 0x72, 0x69, 0x65, 0x72, 0x77, 0x68, 0x65, 0x6e, 0x20, 0x69,
-  0x74, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x20, 0x68, 0x6f, 0x6d, 0x65, 0x20,
-  0x6f, 0x66, 0x72, 0x65, 0x73, 0x75, 0x6d, 0x65, 0x64, 0x72, 0x65, 0x6e, 0x61,
-  0x6d, 0x65, 0x64, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x67, 0x3e, 0x68, 0x65, 0x61,
-  0x74, 0x69, 0x6e, 0x67, 0x72, 0x65, 0x74, 0x61, 0x69, 0x6e, 0x73, 0x63, 0x6c,
-  0x6f, 0x75, 0x64, 0x66, 0x72, 0x77, 0x61, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x4d,
-  0x61, 0x72, 0x63, 0x68, 0x20, 0x31, 0x6b, 0x6e, 0x6f, 0x77, 0x69, 0x6e, 0x67,
-  0x69, 0x6e, 0x20, 0x70, 0x61, 0x72, 0x74, 0x42, 0x65, 0x74, 0x77, 0x65, 0x65,
-  0x6e, 0x6c, 0x65, 0x73, 0x73, 0x6f, 0x6e, 0x73, 0x63, 0x6c, 0x6f, 0x73, 0x65,
-  0x73, 0x74, 0x76, 0x69, 0x72, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x69, 0x6e, 0x6b,
-  0x73, 0x22, 0x3e, 0x63, 0x72, 0x6f, 0x73, 0x73, 0x65, 0x64, 0x45, 0x4e, 0x44,
-  0x20, 0x2d, 0x2d, 0x3e, 0x66, 0x61, 0x6d, 0x6f, 0x75, 0x73, 0x20, 0x61, 0x77,
-  0x61, 0x72, 0x64, 0x65, 0x64, 0x4c, 0x69, 0x63, 0x65, 0x6e, 0x73, 0x65, 0x48,
-  0x65, 0x61, 0x6c, 0x74, 0x68, 0x20, 0x66, 0x61, 0x69, 0x72, 0x6c, 0x79, 0x20,
-  0x77, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x79, 0x6d, 0x69, 0x6e, 0x69, 0x6d, 0x61,
-  0x6c, 0x41, 0x66, 0x72, 0x69, 0x63, 0x61, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x65,
-  0x74, 0x65, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x22, 0x3e, 0x73, 0x69, 0x6e, 0x67,
-  0x69, 0x6e, 0x67, 0x66, 0x61, 0x72, 0x6d, 0x65, 0x72, 0x73, 0x42, 0x72, 0x61,
-  0x73, 0x69, 0x6c, 0x29, 0x64, 0x69, 0x73, 0x63, 0x75, 0x73, 0x73, 0x72, 0x65,
-  0x70, 0x6c, 0x61, 0x63, 0x65, 0x47, 0x72, 0x65, 0x67, 0x6f, 0x72, 0x79, 0x66,
-  0x6f, 0x6e, 0x74, 0x20, 0x63, 0x6f, 0x70, 0x75, 0x72, 0x73, 0x75, 0x65, 0x64,
-  0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x73, 0x6d, 0x61, 0x6b, 0x65, 0x20, 0x75,
-  0x70, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x64, 0x62, 0x6f, 0x74, 0x68, 0x20,
-  0x6f, 0x66, 0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x65, 0x64, 0x73, 0x61, 0x77, 0x20,
-  0x74, 0x68, 0x65, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x65, 0x73, 0x63, 0x6f, 0x6c,
-  0x6f, 0x75, 0x72, 0x73, 0x69, 0x66, 0x28, 0x64, 0x6f, 0x63, 0x75, 0x77, 0x68,
-  0x65, 0x6e, 0x20, 0x68, 0x65, 0x65, 0x6e, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x70,
-  0x75, 0x73, 0x68, 0x28, 0x66, 0x75, 0x41, 0x75, 0x67, 0x75, 0x73, 0x74, 0x20,
-  0x55, 0x54, 0x46, 0x2d, 0x38, 0x22, 0x3e, 0x46, 0x61, 0x6e, 0x74, 0x61, 0x73,
-  0x79, 0x69, 0x6e, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x69, 0x6e, 0x6a, 0x75, 0x72,
-  0x65, 0x64, 0x55, 0x73, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x66, 0x61, 0x72, 0x6d,
-  0x69, 0x6e, 0x67, 0x63, 0x6c, 0x6f, 0x73, 0x75, 0x72, 0x65, 0x6f, 0x62, 0x6a,
-  0x65, 0x63, 0x74, 0x20, 0x64, 0x65, 0x66, 0x65, 0x6e, 0x63, 0x65, 0x75, 0x73,
-  0x65, 0x20, 0x6f, 0x66, 0x20, 0x4d, 0x65, 0x64, 0x69, 0x63, 0x61, 0x6c, 0x3c,
-  0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0a, 0x65, 0x76, 0x69, 0x64, 0x65, 0x6e, 0x74,
-  0x62, 0x65, 0x20, 0x75, 0x73, 0x65, 0x64, 0x6b, 0x65, 0x79, 0x43, 0x6f, 0x64,
-  0x65, 0x73, 0x69, 0x78, 0x74, 0x65, 0x65, 0x6e, 0x49, 0x73, 0x6c, 0x61, 0x6d,
-  0x69, 0x63, 0x23, 0x30, 0x30, 0x30, 0x30, 0x30, 0x30, 0x65, 0x6e, 0x74, 0x69,
-  0x72, 0x65, 0x20, 0x77, 0x69, 0x64, 0x65, 0x6c, 0x79, 0x20, 0x61, 0x63, 0x74,
-  0x69, 0x76, 0x65, 0x20, 0x28, 0x74, 0x79, 0x70, 0x65, 0x6f, 0x66, 0x6f, 0x6e,
-  0x65, 0x20, 0x63, 0x61, 0x6e, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x20, 0x3d, 0x73,
-  0x70, 0x65, 0x61, 0x6b, 0x65, 0x72, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x73,
-  0x50, 0x68, 0x79, 0x73, 0x69, 0x63, 0x73, 0x74, 0x65, 0x72, 0x72, 0x61, 0x69,
-  0x6e, 0x3c, 0x74, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x66, 0x75, 0x6e, 0x65, 0x72,
-  0x61, 0x6c, 0x76, 0x69, 0x65, 0x77, 0x69, 0x6e, 0x67, 0x6d, 0x69, 0x64, 0x64,
-  0x6c, 0x65, 0x20, 0x63, 0x72, 0x69, 0x63, 0x6b, 0x65, 0x74, 0x70, 0x72, 0x6f,
-  0x70, 0x68, 0x65, 0x74, 0x73, 0x68, 0x69, 0x66, 0x74, 0x65, 0x64, 0x64, 0x6f,
-  0x63, 0x74, 0x6f, 0x72, 0x73, 0x52, 0x75, 0x73, 0x73, 0x65, 0x6c, 0x6c, 0x20,
-  0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x63, 0x74,
-  0x61, 0x6c, 0x67, 0x65, 0x62, 0x72, 0x61, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x6c,
-  0x2d, 0x62, 0x75, 0x6c, 0x6b, 0x20, 0x6f, 0x66, 0x6d, 0x61, 0x6e, 0x20, 0x61,
-  0x6e, 0x64, 0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x0a, 0x20, 0x68, 0x65, 0x20, 0x6c,
-  0x65, 0x66, 0x74, 0x29, 0x2e, 0x76, 0x61, 0x6c, 0x28, 0x29, 0x66, 0x61, 0x6c,
-  0x73, 0x65, 0x29, 0x3b, 0x6c, 0x6f, 0x67, 0x69, 0x63, 0x61, 0x6c, 0x62, 0x61,
-  0x6e, 0x6b, 0x69, 0x6e, 0x67, 0x68, 0x6f, 0x6d, 0x65, 0x20, 0x74, 0x6f, 0x6e,
-  0x61, 0x6d, 0x69, 0x6e, 0x67, 0x20, 0x41, 0x72, 0x69, 0x7a, 0x6f, 0x6e, 0x61,
-  0x63, 0x72, 0x65, 0x64, 0x69, 0x74, 0x73, 0x29, 0x3b, 0x0a, 0x7d, 0x29, 0x3b,
-  0x0a, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x69, 0x6e, 0x20, 0x74, 0x75,
-  0x72, 0x6e, 0x43, 0x6f, 0x6c, 0x6c, 0x69, 0x6e, 0x73, 0x62, 0x65, 0x66, 0x6f,
-  0x72, 0x65, 0x20, 0x42, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x63, 0x68, 0x61,
-  0x72, 0x67, 0x65, 0x64, 0x54, 0x69, 0x74, 0x6c, 0x65, 0x22, 0x3e, 0x43, 0x61,
-  0x70, 0x74, 0x61, 0x69, 0x6e, 0x73, 0x70, 0x65, 0x6c, 0x6c, 0x65, 0x64, 0x67,
-  0x6f, 0x64, 0x64, 0x65, 0x73, 0x73, 0x54, 0x61, 0x67, 0x20, 0x2d, 0x2d, 0x3e,
-  0x41, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x3a, 0x62, 0x75, 0x74, 0x20, 0x77, 0x61,
-  0x73, 0x52, 0x65, 0x63, 0x65, 0x6e, 0x74, 0x20, 0x70, 0x61, 0x74, 0x69, 0x65,
-  0x6e, 0x74, 0x62, 0x61, 0x63, 0x6b, 0x20, 0x69, 0x6e, 0x3d, 0x66, 0x61, 0x6c,
-  0x73, 0x65, 0x26, 0x4c, 0x69, 0x6e, 0x63, 0x6f, 0x6c, 0x6e, 0x77, 0x65, 0x20,
-  0x6b, 0x6e, 0x6f, 0x77, 0x43, 0x6f, 0x75, 0x6e, 0x74, 0x65, 0x72, 0x4a, 0x75,
-  0x64, 0x61, 0x69, 0x73, 0x6d, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x61,
-  0x6c, 0x74, 0x65, 0x72, 0x65, 0x64, 0x27, 0x5d, 0x29, 0x3b, 0x0a, 0x20, 0x20,
-  0x68, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x75, 0x6e, 0x63, 0x6c, 0x65, 0x61,
-  0x72, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x27, 0x2c, 0x62, 0x6f, 0x74, 0x68, 0x20,
-  0x69, 0x6e, 0x6e, 0x6f, 0x74, 0x20, 0x61, 0x6c, 0x6c, 0x0a, 0x0a, 0x3c, 0x21,
-  0x2d, 0x2d, 0x20, 0x70, 0x6c, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x68, 0x61, 0x72,
-  0x64, 0x20, 0x74, 0x6f, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x73, 0x6f,
-  0x72, 0x74, 0x20, 0x6f, 0x66, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x73, 0x73,
-  0x74, 0x72, 0x65, 0x65, 0x74, 0x73, 0x42, 0x65, 0x72, 0x6e, 0x61, 0x72, 0x64,
-  0x61, 0x73, 0x73, 0x65, 0x72, 0x74, 0x73, 0x74, 0x65, 0x6e, 0x64, 0x20, 0x74,
-  0x6f, 0x66, 0x61, 0x6e, 0x74, 0x61, 0x73, 0x79, 0x64, 0x6f, 0x77, 0x6e, 0x20,
-  0x69, 0x6e, 0x68, 0x61, 0x72, 0x62, 0x6f, 0x75, 0x72, 0x46, 0x72, 0x65, 0x65,
-  0x64, 0x6f, 0x6d, 0x6a, 0x65, 0x77, 0x65, 0x6c, 0x72, 0x79, 0x2f, 0x61, 0x62,
-  0x6f, 0x75, 0x74, 0x2e, 0x2e, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x6c, 0x65,
-  0x67, 0x65, 0x6e, 0x64, 0x73, 0x69, 0x73, 0x20, 0x6d, 0x61, 0x64, 0x65, 0x6d,
-  0x6f, 0x64, 0x65, 0x72, 0x6e, 0x20, 0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x6f, 0x6e,
-  0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x74, 0x6f, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x22,
-  0x20, 0x6c, 0x69, 0x6e, 0x65, 0x61, 0x72, 0x20, 0x70, 0x61, 0x69, 0x6e, 0x74,
-  0x65, 0x72, 0x61, 0x6e, 0x64, 0x20, 0x6e, 0x6f, 0x74, 0x72, 0x61, 0x72, 0x65,
-  0x6c, 0x79, 0x20, 0x61, 0x63, 0x72, 0x6f, 0x6e, 0x79, 0x6d, 0x64, 0x65, 0x6c,
-  0x69, 0x76, 0x65, 0x72, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x65, 0x72, 0x30, 0x30,
-  0x26, 0x61, 0x6d, 0x70, 0x3b, 0x61, 0x73, 0x20, 0x6d, 0x61, 0x6e, 0x79, 0x77,
-  0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x2f, 0x2a, 0x20, 0x3c, 0x21, 0x5b, 0x43,
-  0x74, 0x69, 0x74, 0x6c, 0x65, 0x20, 0x3d, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
-  0x20, 0x6c, 0x6f, 0x77, 0x65, 0x73, 0x74, 0x20, 0x70, 0x69, 0x63, 0x6b, 0x65,
-  0x64, 0x20, 0x65, 0x73, 0x63, 0x61, 0x70, 0x65, 0x64, 0x75, 0x73, 0x65, 0x73,
-  0x20, 0x6f, 0x66, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x73, 0x20, 0x50, 0x75,
-  0x62, 0x6c, 0x69, 0x63, 0x4d, 0x61, 0x74, 0x74, 0x68, 0x65, 0x77, 0x74, 0x61,
-  0x63, 0x74, 0x69, 0x63, 0x73, 0x64, 0x61, 0x6d, 0x61, 0x67, 0x65, 0x64, 0x77,
-  0x61, 0x79, 0x20, 0x66, 0x6f, 0x72, 0x6c, 0x61, 0x77, 0x73, 0x20, 0x6f, 0x66,
-  0x65, 0x61, 0x73, 0x79, 0x20, 0x74, 0x6f, 0x20, 0x77, 0x69, 0x6e, 0x64, 0x6f,
-  0x77, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x67, 0x20, 0x20, 0x73, 0x69, 0x6d, 0x70,
-  0x6c, 0x65, 0x7d, 0x63, 0x61, 0x74, 0x63, 0x68, 0x28, 0x73, 0x65, 0x76, 0x65,
-  0x6e, 0x74, 0x68, 0x69, 0x6e, 0x66, 0x6f, 0x62, 0x6f, 0x78, 0x77, 0x65, 0x6e,
-  0x74, 0x20, 0x74, 0x6f, 0x70, 0x61, 0x69, 0x6e, 0x74, 0x65, 0x64, 0x63, 0x69,
-  0x74, 0x69, 0x7a, 0x65, 0x6e, 0x49, 0x20, 0x64, 0x6f, 0x6e, 0x27, 0x74, 0x72,
-  0x65, 0x74, 0x72, 0x65, 0x61, 0x74, 0x2e, 0x20, 0x53, 0x6f, 0x6d, 0x65, 0x20,
-  0x77, 0x77, 0x2e, 0x22, 0x29, 0x3b, 0x0a, 0x62, 0x6f, 0x6d, 0x62, 0x69, 0x6e,
-  0x67, 0x6d, 0x61, 0x69, 0x6c, 0x74, 0x6f, 0x3a, 0x6d, 0x61, 0x64, 0x65, 0x20,
-  0x69, 0x6e, 0x2e, 0x20, 0x4d, 0x61, 0x6e, 0x79, 0x20, 0x63, 0x61, 0x72, 0x72,
-  0x69, 0x65, 0x73, 0x7c, 0x7c, 0x7b, 0x7d, 0x3b, 0x77, 0x69, 0x77, 0x6f, 0x72,
-  0x6b, 0x20, 0x6f, 0x66, 0x73, 0x79, 0x6e, 0x6f, 0x6e, 0x79, 0x6d, 0x64, 0x65,
-  0x66, 0x65, 0x61, 0x74, 0x73, 0x66, 0x61, 0x76, 0x6f, 0x72, 0x65, 0x64, 0x6f,
-  0x70, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x70, 0x61, 0x67, 0x65, 0x54, 0x72, 0x61,
-  0x75, 0x6e, 0x6c, 0x65, 0x73, 0x73, 0x20, 0x73, 0x65, 0x6e, 0x64, 0x69, 0x6e,
-  0x67, 0x6c, 0x65, 0x66, 0x74, 0x22, 0x3e, 0x3c, 0x63, 0x6f, 0x6d, 0x53, 0x63,
-  0x6f, 0x72, 0x41, 0x6c, 0x6c, 0x20, 0x74, 0x68, 0x65, 0x6a, 0x51, 0x75, 0x65,
-  0x72, 0x79, 0x2e, 0x74, 0x6f, 0x75, 0x72, 0x69, 0x73, 0x74, 0x43, 0x6c, 0x61,
-  0x73, 0x73, 0x69, 0x63, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x22, 0x20, 0x57, 0x69,
-  0x6c, 0x68, 0x65, 0x6c, 0x6d, 0x73, 0x75, 0x62, 0x75, 0x72, 0x62, 0x73, 0x67,
-  0x65, 0x6e, 0x75, 0x69, 0x6e, 0x65, 0x62, 0x69, 0x73, 0x68, 0x6f, 0x70, 0x73,
-  0x2e, 0x73, 0x70, 0x6c, 0x69, 0x74, 0x28, 0x67, 0x6c, 0x6f, 0x62, 0x61, 0x6c,
-  0x20, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x73, 0x62, 0x6f, 0x64, 0x79, 0x20,
-  0x6f, 0x66, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x6c, 0x43, 0x6f, 0x6e, 0x74,
-  0x61, 0x63, 0x74, 0x73, 0x65, 0x63, 0x75, 0x6c, 0x61, 0x72, 0x6c, 0x65, 0x66,
-  0x74, 0x20, 0x74, 0x6f, 0x63, 0x68, 0x69, 0x65, 0x66, 0x6c, 0x79, 0x2d, 0x68,
-  0x69, 0x64, 0x64, 0x65, 0x6e, 0x2d, 0x62, 0x61, 0x6e, 0x6e, 0x65, 0x72, 0x3c,
-  0x2f, 0x6c, 0x69, 0x3e, 0x0a, 0x0a, 0x2e, 0x20, 0x57, 0x68, 0x65, 0x6e, 0x20,
-  0x69, 0x6e, 0x20, 0x62, 0x6f, 0x74, 0x68, 0x64, 0x69, 0x73, 0x6d, 0x69, 0x73,
-  0x73, 0x45, 0x78, 0x70, 0x6c, 0x6f, 0x72, 0x65, 0x61, 0x6c, 0x77, 0x61, 0x79,
-  0x73, 0x20, 0x76, 0x69, 0x61, 0x20, 0x74, 0x68, 0x65, 0x73, 0x70, 0x61, 0xc3,
-  0xb1, 0x6f, 0x6c, 0x77, 0x65, 0x6c, 0x66, 0x61, 0x72, 0x65, 0x72, 0x75, 0x6c,
-  0x69, 0x6e, 0x67, 0x20, 0x61, 0x72, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x63, 0x61,
-  0x70, 0x74, 0x61, 0x69, 0x6e, 0x68, 0x69, 0x73, 0x20, 0x73, 0x6f, 0x6e, 0x72,
-  0x75, 0x6c, 0x65, 0x20, 0x6f, 0x66, 0x68, 0x65, 0x20, 0x74, 0x6f, 0x6f, 0x6b,
-  0x69, 0x74, 0x73, 0x65, 0x6c, 0x66, 0x2c, 0x3d, 0x30, 0x26, 0x61, 0x6d, 0x70,
-  0x3b, 0x28, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x73, 0x61, 0x6d, 0x70, 0x6c,
-  0x65, 0x73, 0x74, 0x6f, 0x20, 0x6d, 0x61, 0x6b, 0x65, 0x63, 0x6f, 0x6d, 0x2f,
-  0x70, 0x61, 0x67, 0x4d, 0x61, 0x72, 0x74, 0x69, 0x6e, 0x20, 0x4b, 0x65, 0x6e,
-  0x6e, 0x65, 0x64, 0x79, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x73, 0x66, 0x75,
-  0x6c, 0x6c, 0x20, 0x6f, 0x66, 0x68, 0x61, 0x6e, 0x64, 0x6c, 0x65, 0x64, 0x42,
-  0x65, 0x73, 0x69, 0x64, 0x65, 0x73, 0x2f, 0x2f, 0x2d, 0x2d, 0x3e, 0x3c, 0x2f,
-  0x61, 0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74,
-  0x73, 0x65, 0x73, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x68, 0x69, 0x6d, 0x20, 0x74,
-  0x6f, 0x20, 0x69, 0x74, 0x73, 0x20, 0x62, 0x79, 0x20, 0x63, 0x6f, 0x6d, 0x6d,
-  0x6f, 0x6e, 0x2e, 0x6d, 0x69, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x74, 0x6f, 0x20,
-  0x74, 0x61, 0x6b, 0x65, 0x77, 0x61, 0x79, 0x73, 0x20, 0x74, 0x6f, 0x73, 0x2e,
-  0x6f, 0x72, 0x67, 0x2f, 0x6c, 0x61, 0x64, 0x76, 0x69, 0x73, 0x65, 0x64, 0x70,
-  0x65, 0x6e, 0x61, 0x6c, 0x74, 0x79, 0x73, 0x69, 0x6d, 0x70, 0x6c, 0x65, 0x3a,
-  0x69, 0x66, 0x20, 0x74, 0x68, 0x65, 0x79, 0x4c, 0x65, 0x74, 0x74, 0x65, 0x72,
-  0x73, 0x61, 0x20, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x48, 0x65, 0x72, 0x62, 0x65,
-  0x72, 0x74, 0x73, 0x74, 0x72, 0x69, 0x6b, 0x65, 0x73, 0x20, 0x67, 0x72, 0x6f,
-  0x75, 0x70, 0x73, 0x2e, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x66, 0x6c, 0x69,
-  0x67, 0x68, 0x74, 0x73, 0x6f, 0x76, 0x65, 0x72, 0x6c, 0x61, 0x70, 0x73, 0x6c,
-  0x6f, 0x77, 0x6c, 0x79, 0x20, 0x6c, 0x65, 0x73, 0x73, 0x65, 0x72, 0x20, 0x73,
-  0x6f, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x3c, 0x2f, 0x70, 0x3e, 0x0a, 0x09, 0x09,
-  0x69, 0x74, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x72, 0x61, 0x6e, 0x6b, 0x65, 0x64,
-  0x20, 0x72, 0x61, 0x74, 0x65, 0x20, 0x6f, 0x66, 0x75, 0x6c, 0x3e, 0x0d, 0x0a,
-  0x20, 0x20, 0x61, 0x74, 0x74, 0x65, 0x6d, 0x70, 0x74, 0x70, 0x61, 0x69, 0x72,
-  0x20, 0x6f, 0x66, 0x6d, 0x61, 0x6b, 0x65, 0x20, 0x69, 0x74, 0x4b, 0x6f, 0x6e,
-  0x74, 0x61, 0x6b, 0x74, 0x41, 0x6e, 0x74, 0x6f, 0x6e, 0x69, 0x6f, 0x68, 0x61,
-  0x76, 0x69, 0x6e, 0x67, 0x20, 0x72, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x20,
-  0x61, 0x63, 0x74, 0x69, 0x76, 0x65, 0x73, 0x74, 0x72, 0x65, 0x61, 0x6d, 0x73,
-  0x74, 0x72, 0x61, 0x70, 0x70, 0x65, 0x64, 0x22, 0x29, 0x2e, 0x63, 0x73, 0x73,
-  0x28, 0x68, 0x6f, 0x73, 0x74, 0x69, 0x6c, 0x65, 0x6c, 0x65, 0x61, 0x64, 0x20,
-  0x74, 0x6f, 0x6c, 0x69, 0x74, 0x74, 0x6c, 0x65, 0x20, 0x67, 0x72, 0x6f, 0x75,
-  0x70, 0x73, 0x2c, 0x50, 0x69, 0x63, 0x74, 0x75, 0x72, 0x65, 0x2d, 0x2d, 0x3e,
-  0x0d, 0x0a, 0x0d, 0x0a, 0x20, 0x72, 0x6f, 0x77, 0x73, 0x3d, 0x22, 0x20, 0x6f,
-  0x62, 0x6a, 0x65, 0x63, 0x74, 0x69, 0x6e, 0x76, 0x65, 0x72, 0x73, 0x65, 0x3c,
-  0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x43, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x56,
-  0x3e, 0x3c, 0x5c, 0x2f, 0x73, 0x63, 0x72, 0x73, 0x6f, 0x6c, 0x76, 0x69, 0x6e,
-  0x67, 0x43, 0x68, 0x61, 0x6d, 0x62, 0x65, 0x72, 0x73, 0x6c, 0x61, 0x76, 0x65,
-  0x72, 0x79, 0x77, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x64, 0x77, 0x68, 0x65, 0x72,
-  0x65, 0x61, 0x73, 0x21, 0x3d, 0x20, 0x27, 0x75, 0x6e, 0x64, 0x66, 0x6f, 0x72,
-  0x20, 0x61, 0x6c, 0x6c, 0x70, 0x61, 0x72, 0x74, 0x6c, 0x79, 0x20, 0x2d, 0x72,
-  0x69, 0x67, 0x68, 0x74, 0x3a, 0x41, 0x72, 0x61, 0x62, 0x69, 0x61, 0x6e, 0x62,
-  0x61, 0x63, 0x6b, 0x65, 0x64, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x79,
-  0x75, 0x6e, 0x69, 0x74, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x62, 0x69, 0x6c, 0x65,
-  0x2d, 0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x2c, 0x69, 0x73, 0x20, 0x68, 0x6f,
-  0x6d, 0x65, 0x72, 0x69, 0x73, 0x6b, 0x20, 0x6f, 0x66, 0x64, 0x65, 0x73, 0x69,
-  0x72, 0x65, 0x64, 0x43, 0x6c, 0x69, 0x6e, 0x74, 0x6f, 0x6e, 0x63, 0x6f, 0x73,
-  0x74, 0x20, 0x6f, 0x66, 0x61, 0x67, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x62, 0x65,
-  0x63, 0x6f, 0x6d, 0x65, 0x20, 0x6e, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x70,
-  0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x4d, 0x69, 0x64, 0x64, 0x6c, 0x65, 0x20,
-  0x65, 0x61, 0x64, 0x27, 0x29, 0x5b, 0x30, 0x43, 0x72, 0x69, 0x74, 0x69, 0x63,
-  0x73, 0x73, 0x74, 0x75, 0x64, 0x69, 0x6f, 0x73, 0x3e, 0x26, 0x63, 0x6f, 0x70,
-  0x79, 0x3b, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x22, 0x3e, 0x61, 0x73, 0x73, 0x65,
-  0x6d, 0x62, 0x6c, 0x6d, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x20, 0x70, 0x72, 0x65,
-  0x73, 0x73, 0x65, 0x64, 0x77, 0x69, 0x64, 0x67, 0x65, 0x74, 0x2e, 0x70, 0x73,
-  0x3a, 0x22, 0x20, 0x3f, 0x20, 0x72, 0x65, 0x62, 0x75, 0x69, 0x6c, 0x74, 0x62,
-  0x79, 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x46, 0x6f, 0x72, 0x6d, 0x65, 0x72, 0x20,
-  0x65, 0x64, 0x69, 0x74, 0x6f, 0x72, 0x73, 0x64, 0x65, 0x6c, 0x61, 0x79, 0x65,
-  0x64, 0x43, 0x61, 0x6e, 0x6f, 0x6e, 0x69, 0x63, 0x68, 0x61, 0x64, 0x20, 0x74,
-  0x68, 0x65, 0x70, 0x75, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x63, 0x6c, 0x61, 0x73,
-  0x73, 0x3d, 0x22, 0x62, 0x75, 0x74, 0x20, 0x61, 0x72, 0x65, 0x70, 0x61, 0x72,
-  0x74, 0x69, 0x61, 0x6c, 0x42, 0x61, 0x62, 0x79, 0x6c, 0x6f, 0x6e, 0x62, 0x6f,
-  0x74, 0x74, 0x6f, 0x6d, 0x20, 0x63, 0x61, 0x72, 0x72, 0x69, 0x65, 0x72, 0x43,
-  0x6f, 0x6d, 0x6d, 0x61, 0x6e, 0x64, 0x69, 0x74, 0x73, 0x20, 0x75, 0x73, 0x65,
-  0x41, 0x73, 0x20, 0x77, 0x69, 0x74, 0x68, 0x63, 0x6f, 0x75, 0x72, 0x73, 0x65,
-  0x73, 0x61, 0x20, 0x74, 0x68, 0x69, 0x72, 0x64, 0x64, 0x65, 0x6e, 0x6f, 0x74,
-  0x65, 0x73, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x69, 0x6e, 0x48, 0x6f, 0x75, 0x73,
-  0x74, 0x6f, 0x6e, 0x32, 0x30, 0x70, 0x78, 0x3b, 0x22, 0x3e, 0x61, 0x63, 0x63,
-  0x75, 0x73, 0x65, 0x64, 0x64, 0x6f, 0x75, 0x62, 0x6c, 0x65, 0x20, 0x67, 0x6f,
-  0x61, 0x6c, 0x20, 0x6f, 0x66, 0x46, 0x61, 0x6d, 0x6f, 0x75, 0x73, 0x20, 0x29,
-  0x2e, 0x62, 0x69, 0x6e, 0x64, 0x28, 0x70, 0x72, 0x69, 0x65, 0x73, 0x74, 0x73,
-  0x20, 0x4f, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x69, 0x6e, 0x20, 0x4a, 0x75, 0x6c,
-  0x79, 0x73, 0x74, 0x20, 0x2b, 0x20, 0x22, 0x67, 0x63, 0x6f, 0x6e, 0x73, 0x75,
-  0x6c, 0x74, 0x64, 0x65, 0x63, 0x69, 0x6d, 0x61, 0x6c, 0x68, 0x65, 0x6c, 0x70,
-  0x66, 0x75, 0x6c, 0x72, 0x65, 0x76, 0x69, 0x76, 0x65, 0x64, 0x69, 0x73, 0x20,
-  0x76, 0x65, 0x72, 0x79, 0x72, 0x27, 0x2b, 0x27, 0x69, 0x70, 0x74, 0x6c, 0x6f,
-  0x73, 0x69, 0x6e, 0x67, 0x20, 0x66, 0x65, 0x6d, 0x61, 0x6c, 0x65, 0x73, 0x69,
-  0x73, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x73,
-  0x64, 0x61, 0x79, 0x73, 0x20, 0x6f, 0x66, 0x61, 0x72, 0x72, 0x69, 0x76, 0x61,
-  0x6c, 0x66, 0x75, 0x74, 0x75, 0x72, 0x65, 0x20, 0x3c, 0x6f, 0x62, 0x6a, 0x65,
-  0x63, 0x74, 0x66, 0x6f, 0x72, 0x63, 0x69, 0x6e, 0x67, 0x53, 0x74, 0x72, 0x69,
-  0x6e, 0x67, 0x28, 0x22, 0x20, 0x2f, 0x3e, 0x0a, 0x09, 0x09, 0x68, 0x65, 0x72,
-  0x65, 0x20, 0x69, 0x73, 0x65, 0x6e, 0x63, 0x6f, 0x64, 0x65, 0x64, 0x2e, 0x20,
-  0x20, 0x54, 0x68, 0x65, 0x20, 0x62, 0x61, 0x6c, 0x6c, 0x6f, 0x6f, 0x6e, 0x64,
-  0x6f, 0x6e, 0x65, 0x20, 0x62, 0x79, 0x2f, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e,
-  0x62, 0x67, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x6c, 0x61, 0x77, 0x20, 0x6f, 0x66,
-  0x20, 0x49, 0x6e, 0x64, 0x69, 0x61, 0x6e, 0x61, 0x61, 0x76, 0x6f, 0x69, 0x64,
-  0x65, 0x64, 0x62, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x32, 0x70, 0x78, 0x20,
-  0x33, 0x70, 0x78, 0x6a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x2e, 0x61, 0x66, 0x74,
-  0x65, 0x72, 0x20, 0x61, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x2e, 0x6d, 0x65,
-  0x6e, 0x20, 0x61, 0x6e, 0x64, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x2d, 0x3d,
-  0x20, 0x74, 0x72, 0x75, 0x65, 0x3b, 0x66, 0x6f, 0x72, 0x20, 0x75, 0x73, 0x65,
-  0x73, 0x63, 0x72, 0x65, 0x65, 0x6e, 0x2e, 0x49, 0x6e, 0x64, 0x69, 0x61, 0x6e,
-  0x20, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x20, 0x3d, 0x66, 0x61, 0x6d, 0x69, 0x6c,
-  0x79, 0x2c, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x20, 0x26, 0x6e, 0x62,
-  0x73, 0x70, 0x3b, 0x64, 0x72, 0x69, 0x76, 0x65, 0x72, 0x73, 0x65, 0x74, 0x65,
-  0x72, 0x6e, 0x61, 0x6c, 0x73, 0x61, 0x6d, 0x65, 0x20, 0x61, 0x73, 0x6e, 0x6f,
-  0x74, 0x69, 0x63, 0x65, 0x64, 0x76, 0x69, 0x65, 0x77, 0x65, 0x72, 0x73, 0x7d,
-  0x29, 0x28, 0x29, 0x3b, 0x0a, 0x20, 0x69, 0x73, 0x20, 0x6d, 0x6f, 0x72, 0x65,
-  0x73, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x73, 0x66, 0x6f, 0x72, 0x6d, 0x65, 0x72,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x65, 0x77, 0x69, 0x73, 0x20, 0x6a, 0x75,
-  0x73, 0x74, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x6e, 0x74, 0x20, 0x53, 0x65, 0x61,
-  0x72, 0x63, 0x68, 0x77, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x77, 0x68, 0x79,
-  0x20, 0x74, 0x68, 0x65, 0x73, 0x68, 0x69, 0x70, 0x70, 0x65, 0x64, 0x62, 0x72,
-  0x3e, 0x3c, 0x62, 0x72, 0x3e, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x20, 0x68,
-  0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x6d, 0x61, 0x64, 0x65, 0x20, 0x6f, 0x66,
-  0x63, 0x75, 0x69, 0x73, 0x69, 0x6e, 0x65, 0x69, 0x73, 0x20, 0x74, 0x68, 0x61,
-  0x74, 0x61, 0x20, 0x76, 0x65, 0x72, 0x79, 0x20, 0x41, 0x64, 0x6d, 0x69, 0x72,
-  0x61, 0x6c, 0x20, 0x66, 0x69, 0x78, 0x65, 0x64, 0x3b, 0x6e, 0x6f, 0x72, 0x6d,
-  0x61, 0x6c, 0x20, 0x4d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x50, 0x72, 0x65,
-  0x73, 0x73, 0x2c, 0x20, 0x6f, 0x6e, 0x74, 0x61, 0x72, 0x69, 0x6f, 0x63, 0x68,
-  0x61, 0x72, 0x73, 0x65, 0x74, 0x74, 0x72, 0x79, 0x20, 0x74, 0x6f, 0x20, 0x69,
-  0x6e, 0x76, 0x61, 0x64, 0x65, 0x64, 0x3d, 0x22, 0x74, 0x72, 0x75, 0x65, 0x22,
-  0x73, 0x70, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x69, 0x73, 0x20, 0x6d, 0x6f, 0x73,
-  0x74, 0x61, 0x20, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x74, 0x6f, 0x74, 0x61, 0x6c,
-  0x6c, 0x79, 0x66, 0x61, 0x6c, 0x6c, 0x20, 0x6f, 0x66, 0x7d, 0x29, 0x3b, 0x0d,
-  0x0a, 0x20, 0x20, 0x69, 0x6d, 0x6d, 0x65, 0x6e, 0x73, 0x65, 0x74, 0x69, 0x6d,
-  0x65, 0x20, 0x69, 0x6e, 0x73, 0x65, 0x74, 0x20, 0x6f, 0x75, 0x74, 0x73, 0x61,
-  0x74, 0x69, 0x73, 0x66, 0x79, 0x74, 0x6f, 0x20, 0x66, 0x69, 0x6e, 0x64, 0x64,
-  0x6f, 0x77, 0x6e, 0x20, 0x74, 0x6f, 0x6c, 0x6f, 0x74, 0x20, 0x6f, 0x66, 0x20,
-  0x50, 0x6c, 0x61, 0x79, 0x65, 0x72, 0x73, 0x69, 0x6e, 0x20, 0x4a, 0x75, 0x6e,
-  0x65, 0x71, 0x75, 0x61, 0x6e, 0x74, 0x75, 0x6d, 0x6e, 0x6f, 0x74, 0x20, 0x74,
-  0x68, 0x65, 0x74, 0x69, 0x6d, 0x65, 0x20, 0x74, 0x6f, 0x64, 0x69, 0x73, 0x74,
-  0x61, 0x6e, 0x74, 0x46, 0x69, 0x6e, 0x6e, 0x69, 0x73, 0x68, 0x73, 0x72, 0x63,
-  0x20, 0x3d, 0x20, 0x28, 0x73, 0x69, 0x6e, 0x67, 0x6c, 0x65, 0x20, 0x68, 0x65,
-  0x6c, 0x70, 0x20, 0x6f, 0x66, 0x47, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x20, 0x6c,
-  0x61, 0x77, 0x20, 0x61, 0x6e, 0x64, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x65, 0x64,
-  0x66, 0x6f, 0x72, 0x65, 0x73, 0x74, 0x73, 0x63, 0x6f, 0x6f, 0x6b, 0x69, 0x6e,
-  0x67, 0x73, 0x70, 0x61, 0x63, 0x65, 0x22, 0x3e, 0x68, 0x65, 0x61, 0x64, 0x65,
-  0x72, 0x2d, 0x77, 0x65, 0x6c, 0x6c, 0x20, 0x61, 0x73, 0x53, 0x74, 0x61, 0x6e,
-  0x6c, 0x65, 0x79, 0x62, 0x72, 0x69, 0x64, 0x67, 0x65, 0x73, 0x2f, 0x67, 0x6c,
-  0x6f, 0x62, 0x61, 0x6c, 0x43, 0x72, 0x6f, 0x61, 0x74, 0x69, 0x61, 0x20, 0x41,
-  0x62, 0x6f, 0x75, 0x74, 0x20, 0x5b, 0x30, 0x5d, 0x3b, 0x0a, 0x20, 0x20, 0x69,
-  0x74, 0x2c, 0x20, 0x61, 0x6e, 0x64, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x65, 0x64,
-  0x62, 0x65, 0x69, 0x6e, 0x67, 0x20, 0x61, 0x29, 0x7b, 0x74, 0x68, 0x72, 0x6f,
-  0x77, 0x68, 0x65, 0x20, 0x6d, 0x61, 0x64, 0x65, 0x6c, 0x69, 0x67, 0x68, 0x74,
-  0x65, 0x72, 0x65, 0x74, 0x68, 0x69, 0x63, 0x61, 0x6c, 0x46, 0x46, 0x46, 0x46,
-  0x46, 0x46, 0x22, 0x62, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x22, 0x6c, 0x69, 0x6b,
-  0x65, 0x20, 0x61, 0x20, 0x65, 0x6d, 0x70, 0x6c, 0x6f, 0x79, 0x73, 0x6c, 0x69,
-  0x76, 0x65, 0x20, 0x69, 0x6e, 0x61, 0x73, 0x20, 0x73, 0x65, 0x65, 0x6e, 0x70,
-  0x72, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x6f, 0x66,
-  0x75, 0x62, 0x2d, 0x6c, 0x69, 0x6e, 0x6b, 0x72, 0x65, 0x6a, 0x65, 0x63, 0x74,
-  0x73, 0x61, 0x6e, 0x64, 0x20, 0x75, 0x73, 0x65, 0x69, 0x6d, 0x61, 0x67, 0x65,
-  0x22, 0x3e, 0x73, 0x75, 0x63, 0x63, 0x65, 0x65, 0x64, 0x66, 0x65, 0x65, 0x64,
-  0x69, 0x6e, 0x67, 0x4e, 0x75, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x69, 0x6e, 0x66,
-  0x6f, 0x72, 0x6d, 0x61, 0x74, 0x6f, 0x20, 0x68, 0x65, 0x6c, 0x70, 0x57, 0x6f,
-  0x6d, 0x65, 0x6e, 0x27, 0x73, 0x4e, 0x65, 0x69, 0x74, 0x68, 0x65, 0x72, 0x4d,
-  0x65, 0x78, 0x69, 0x63, 0x61, 0x6e, 0x70, 0x72, 0x6f, 0x74, 0x65, 0x69, 0x6e,
-  0x3c, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x62, 0x79, 0x20, 0x6d, 0x61, 0x6e,
-  0x79, 0x68, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x79, 0x6c, 0x61, 0x77, 0x73, 0x75,
-  0x69, 0x74, 0x64, 0x65, 0x76, 0x69, 0x73, 0x65, 0x64, 0x2e, 0x70, 0x75, 0x73,
-  0x68, 0x28, 0x7b, 0x73, 0x65, 0x6c, 0x6c, 0x65, 0x72, 0x73, 0x73, 0x69, 0x6d,
-  0x70, 0x6c, 0x79, 0x20, 0x54, 0x68, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x2e, 0x63,
-  0x6f, 0x6f, 0x6b, 0x69, 0x65, 0x20, 0x49, 0x6d, 0x61, 0x67, 0x65, 0x28, 0x6f,
-  0x6c, 0x64, 0x65, 0x72, 0x22, 0x3e, 0x75, 0x73, 0x2e, 0x6a, 0x73, 0x22, 0x3e,
-  0x20, 0x53, 0x69, 0x6e, 0x63, 0x65, 0x20, 0x75, 0x6e, 0x69, 0x76, 0x65, 0x72,
-  0x73, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x72, 0x20, 0x6f, 0x70, 0x65, 0x6e, 0x20,
-  0x74, 0x6f, 0x21, 0x2d, 0x2d, 0x20, 0x65, 0x6e, 0x64, 0x6c, 0x69, 0x65, 0x73,
-  0x20, 0x69, 0x6e, 0x27, 0x5d, 0x29, 0x3b, 0x0d, 0x0a, 0x20, 0x20, 0x6d, 0x61,
-  0x72, 0x6b, 0x65, 0x74, 0x77, 0x68, 0x6f, 0x20, 0x69, 0x73, 0x20, 0x28, 0x22,
-  0x44, 0x4f, 0x4d, 0x43, 0x6f, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x64, 0x6f,
-  0x6e, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x74, 0x79, 0x70, 0x65, 0x6f, 0x66, 0x20,
-  0x4b, 0x69, 0x6e, 0x67, 0x64, 0x6f, 0x6d, 0x70, 0x72, 0x6f, 0x66, 0x69, 0x74,
-  0x73, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x73, 0x65, 0x74, 0x6f, 0x20, 0x73, 0x68,
-  0x6f, 0x77, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x3b, 0x6d, 0x61, 0x64, 0x65,
-  0x20, 0x69, 0x74, 0x64, 0x72, 0x65, 0x73, 0x73, 0x65, 0x64, 0x77, 0x65, 0x72,
-  0x65, 0x20, 0x69, 0x6e, 0x6d, 0x69, 0x78, 0x74, 0x75, 0x72, 0x65, 0x70, 0x72,
-  0x65, 0x63, 0x69, 0x73, 0x65, 0x61, 0x72, 0x69, 0x73, 0x69, 0x6e, 0x67, 0x73,
-  0x72, 0x63, 0x20, 0x3d, 0x20, 0x27, 0x6d, 0x61, 0x6b, 0x65, 0x20, 0x61, 0x20,
-  0x73, 0x65, 0x63, 0x75, 0x72, 0x65, 0x64, 0x42, 0x61, 0x70, 0x74, 0x69, 0x73,
-  0x74, 0x76, 0x6f, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x0a, 0x09, 0x09, 0x76, 0x61,
-  0x72, 0x20, 0x4d, 0x61, 0x72, 0x63, 0x68, 0x20, 0x32, 0x67, 0x72, 0x65, 0x77,
-  0x20, 0x75, 0x70, 0x43, 0x6c, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x2e, 0x72, 0x65,
-  0x6d, 0x6f, 0x76, 0x65, 0x73, 0x6b, 0x69, 0x6c, 0x6c, 0x65, 0x64, 0x77, 0x61,
-  0x79, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x66,
-  0x61, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x61, 0x63, 0x74, 0x69, 0x6e, 0x67, 0x20,
-  0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x3e, 0x74, 0x6f, 0x20, 0x77, 0x6f, 0x72,
-  0x6b, 0x72, 0x65, 0x64, 0x75, 0x63, 0x65, 0x73, 0x68, 0x61, 0x73, 0x20, 0x68,
-  0x61, 0x64, 0x65, 0x72, 0x65, 0x63, 0x74, 0x65, 0x64, 0x73, 0x68, 0x6f, 0x77,
-  0x28, 0x29, 0x3b, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x3d, 0x62, 0x6f, 0x6f,
-  0x6b, 0x20, 0x6f, 0x66, 0x61, 0x6e, 0x20, 0x61, 0x72, 0x65, 0x61, 0x3d, 0x3d,
-  0x20, 0x22, 0x68, 0x74, 0x74, 0x3c, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x0a,
-  0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x63, 0x6f, 0x6e, 0x66, 0x6f, 0x72, 0x6d,
-  0x66, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x20, 0x63, 0x6f, 0x6f, 0x6b, 0x69, 0x65,
-  0x2e, 0x72, 0x65, 0x6c, 0x79, 0x20, 0x6f, 0x6e, 0x68, 0x6f, 0x73, 0x74, 0x65,
-  0x64, 0x20, 0x2e, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x68, 0x65, 0x20, 0x77,
-  0x65, 0x6e, 0x74, 0x62, 0x75, 0x74, 0x20, 0x66, 0x6f, 0x72, 0x73, 0x70, 0x72,
-  0x65, 0x61, 0x64, 0x20, 0x46, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x20, 0x61, 0x20,
-  0x6d, 0x65, 0x61, 0x6e, 0x73, 0x6f, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x66,
-  0x6f, 0x72, 0x75, 0x6d, 0x73, 0x2e, 0x66, 0x6f, 0x6f, 0x74, 0x61, 0x67, 0x65,
-  0x22, 0x3e, 0x4d, 0x6f, 0x62, 0x69, 0x6c, 0x43, 0x6c, 0x65, 0x6d, 0x65, 0x6e,
-  0x74, 0x73, 0x22, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x61, 0x73, 0x20, 0x68, 0x69,
-  0x67, 0x68, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x73, 0x65, 0x2d, 0x2d, 0x3e, 0x3c,
-  0x21, 0x2d, 0x2d, 0x66, 0x65, 0x6d, 0x61, 0x6c, 0x65, 0x20, 0x69, 0x73, 0x20,
-  0x73, 0x65, 0x65, 0x6e, 0x69, 0x6d, 0x70, 0x6c, 0x69, 0x65, 0x64, 0x73, 0x65,
-  0x74, 0x20, 0x74, 0x68, 0x65, 0x61, 0x20, 0x73, 0x74, 0x61, 0x74, 0x65, 0x61,
-  0x6e, 0x64, 0x20, 0x68, 0x69, 0x73, 0x66, 0x61, 0x73, 0x74, 0x65, 0x73, 0x74,
-  0x62, 0x65, 0x73, 0x69, 0x64, 0x65, 0x73, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e,
-  0x5f, 0x62, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x64, 0x22, 0x3e, 0x3c, 0x69, 0x6d,
-  0x67, 0x20, 0x49, 0x6e, 0x66, 0x6f, 0x62, 0x6f, 0x78, 0x65, 0x76, 0x65, 0x6e,
-  0x74, 0x73, 0x2c, 0x61, 0x20, 0x79, 0x6f, 0x75, 0x6e, 0x67, 0x61, 0x6e, 0x64,
-  0x20, 0x61, 0x72, 0x65, 0x4e, 0x61, 0x74, 0x69, 0x76, 0x65, 0x20, 0x63, 0x68,
-  0x65, 0x61, 0x70, 0x65, 0x72, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x61,
-  0x6e, 0x64, 0x20, 0x68, 0x61, 0x73, 0x65, 0x6e, 0x67, 0x69, 0x6e, 0x65, 0x73,
-  0x77, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x28, 0x6d, 0x6f, 0x73, 0x74, 0x6c,
-  0x79, 0x72, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x20, 0x66, 0x69, 0x6e, 0x64, 0x20,
-  0x61, 0x20, 0x2d, 0x62, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x50, 0x72, 0x69, 0x6e,
-  0x63, 0x65, 0x20, 0x61, 0x72, 0x65, 0x61, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x72,
-  0x65, 0x20, 0x6f, 0x66, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x5f, 0x6e, 0x61,
-  0x74, 0x75, 0x72, 0x65, 0x2c, 0x6c, 0x65, 0x67, 0x61, 0x6c, 0x6c, 0x79, 0x70,
-  0x65, 0x72, 0x69, 0x6f, 0x64, 0x2c, 0x6c, 0x61, 0x6e, 0x64, 0x20, 0x6f, 0x66,
-  0x6f, 0x72, 0x20, 0x77, 0x69, 0x74, 0x68, 0x69, 0x6e, 0x64, 0x75, 0x63, 0x65,
-  0x64, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x6e, 0x67, 0x6d, 0x69, 0x73, 0x73, 0x69,
-  0x6c, 0x65, 0x6c, 0x6f, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x41, 0x67, 0x61, 0x69,
-  0x6e, 0x73, 0x74, 0x74, 0x68, 0x65, 0x20, 0x77, 0x61, 0x79, 0x6b, 0x26, 0x71,
-  0x75, 0x6f, 0x74, 0x3b, 0x70, 0x78, 0x3b, 0x22, 0x3e, 0x0d, 0x0a, 0x70, 0x75,
-  0x73, 0x68, 0x65, 0x64, 0x20, 0x61, 0x62, 0x61, 0x6e, 0x64, 0x6f, 0x6e, 0x6e,
-  0x75, 0x6d, 0x65, 0x72, 0x61, 0x6c, 0x43, 0x65, 0x72, 0x74, 0x61, 0x69, 0x6e,
-  0x49, 0x6e, 0x20, 0x74, 0x68, 0x69, 0x73, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x69,
-  0x6e, 0x6f, 0x72, 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x20,
-  0x69, 0x73, 0x61, 0x6e, 0x64, 0x2c, 0x20, 0x69, 0x6e, 0x63, 0x72, 0x6f, 0x77,
-  0x6e, 0x65, 0x64, 0x49, 0x53, 0x42, 0x4e, 0x20, 0x30, 0x2d, 0x63, 0x72, 0x65,
-  0x61, 0x74, 0x65, 0x73, 0x4f, 0x63, 0x74, 0x6f, 0x62, 0x65, 0x72, 0x6d, 0x61,
-  0x79, 0x20, 0x6e, 0x6f, 0x74, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x20, 0x6c,
-  0x61, 0x74, 0x65, 0x20, 0x69, 0x6e, 0x44, 0x65, 0x66, 0x65, 0x6e, 0x63, 0x65,
-  0x65, 0x6e, 0x61, 0x63, 0x74, 0x65, 0x64, 0x77, 0x69, 0x73, 0x68, 0x20, 0x74,
-  0x6f, 0x62, 0x72, 0x6f, 0x61, 0x64, 0x6c, 0x79, 0x63, 0x6f, 0x6f, 0x6c, 0x69,
-  0x6e, 0x67, 0x6f, 0x6e, 0x6c, 0x6f, 0x61, 0x64, 0x3d, 0x69, 0x74, 0x2e, 0x20,
-  0x54, 0x68, 0x65, 0x72, 0x65, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x4d, 0x65, 0x6d,
-  0x62, 0x65, 0x72, 0x73, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x20, 0x61, 0x73,
-  0x73, 0x75, 0x6d, 0x65, 0x73, 0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x0a, 0x70,
-  0x65, 0x6f, 0x70, 0x6c, 0x65, 0x2e, 0x69, 0x6e, 0x20, 0x6f, 0x6e, 0x65, 0x20,
-  0x3d, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72,
-  0x5f, 0x61, 0x20, 0x67, 0x6f, 0x6f, 0x64, 0x20, 0x72, 0x65, 0x6b, 0x6c, 0x61,
-  0x6d, 0x61, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x73, 0x2c, 0x74, 0x6f, 0x20, 0x74,
-  0x68, 0x69, 0x73, 0x5f, 0x63, 0x6f, 0x6f, 0x6b, 0x69, 0x65, 0x70, 0x61, 0x6e,
-  0x65, 0x6c, 0x22, 0x3e, 0x4c, 0x6f, 0x6e, 0x64, 0x6f, 0x6e, 0x2c, 0x64, 0x65,
-  0x66, 0x69, 0x6e, 0x65, 0x73, 0x63, 0x72, 0x75, 0x73, 0x68, 0x65, 0x64, 0x62,
-  0x61, 0x70, 0x74, 0x69, 0x73, 0x6d, 0x63, 0x6f, 0x61, 0x73, 0x74, 0x61, 0x6c,
-  0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x22,
-  0x20, 0x6d, 0x6f, 0x76, 0x65, 0x20, 0x74, 0x6f, 0x6c, 0x6f, 0x73, 0x74, 0x20,
-  0x69, 0x6e, 0x62, 0x65, 0x74, 0x74, 0x65, 0x72, 0x20, 0x69, 0x6d, 0x70, 0x6c,
-  0x69, 0x65, 0x73, 0x72, 0x69, 0x76, 0x61, 0x6c, 0x72, 0x79, 0x73, 0x65, 0x72,
-  0x76, 0x65, 0x72, 0x73, 0x20, 0x53, 0x79, 0x73, 0x74, 0x65, 0x6d, 0x50, 0x65,
-  0x72, 0x68, 0x61, 0x70, 0x73, 0x65, 0x73, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x63,
-  0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x64, 0x66, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x67,
-  0x6c, 0x61, 0x73, 0x74, 0x65, 0x64, 0x20, 0x72, 0x69, 0x73, 0x65, 0x20, 0x69,
-  0x6e, 0x47, 0x65, 0x6e, 0x65, 0x73, 0x69, 0x73, 0x76, 0x69, 0x65, 0x77, 0x20,
-  0x6f, 0x66, 0x72, 0x69, 0x73, 0x69, 0x6e, 0x67, 0x20, 0x73, 0x65, 0x65, 0x6d,
-  0x20, 0x74, 0x6f, 0x62, 0x75, 0x74, 0x20, 0x69, 0x6e, 0x20, 0x62, 0x61, 0x63,
-  0x6b, 0x69, 0x6e, 0x67, 0x68, 0x65, 0x20, 0x77, 0x69, 0x6c, 0x6c, 0x67, 0x69,
-  0x76, 0x65, 0x6e, 0x20, 0x61, 0x67, 0x69, 0x76, 0x69, 0x6e, 0x67, 0x20, 0x63,
-  0x69, 0x74, 0x69, 0x65, 0x73, 0x2e, 0x66, 0x6c, 0x6f, 0x77, 0x20, 0x6f, 0x66,
-  0x20, 0x4c, 0x61, 0x74, 0x65, 0x72, 0x20, 0x61, 0x6c, 0x6c, 0x20, 0x62, 0x75,
-  0x74, 0x48, 0x69, 0x67, 0x68, 0x77, 0x61, 0x79, 0x6f, 0x6e, 0x6c, 0x79, 0x20,
-  0x62, 0x79, 0x73, 0x69, 0x67, 0x6e, 0x20, 0x6f, 0x66, 0x68, 0x65, 0x20, 0x64,
-  0x6f, 0x65, 0x73, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x73, 0x62, 0x61, 0x74,
-  0x74, 0x65, 0x72, 0x79, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x6c, 0x61, 0x73, 0x69,
-  0x6e, 0x67, 0x6c, 0x65, 0x73, 0x74, 0x68, 0x72, 0x65, 0x61, 0x74, 0x73, 0x69,
-  0x6e, 0x74, 0x65, 0x67, 0x65, 0x72, 0x74, 0x61, 0x6b, 0x65, 0x20, 0x6f, 0x6e,
-  0x72, 0x65, 0x66, 0x75, 0x73, 0x65, 0x64, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64,
-  0x20, 0x3d, 0x55, 0x53, 0x26, 0x61, 0x6d, 0x70, 0x53, 0x65, 0x65, 0x20, 0x74,
-  0x68, 0x65, 0x6e, 0x61, 0x74, 0x69, 0x76, 0x65, 0x73, 0x62, 0x79, 0x20, 0x74,
-  0x68, 0x69, 0x73, 0x73, 0x79, 0x73, 0x74, 0x65, 0x6d, 0x2e, 0x68, 0x65, 0x61,
-  0x64, 0x20, 0x6f, 0x66, 0x3a, 0x68, 0x6f, 0x76, 0x65, 0x72, 0x2c, 0x6c, 0x65,
-  0x73, 0x62, 0x69, 0x61, 0x6e, 0x73, 0x75, 0x72, 0x6e, 0x61, 0x6d, 0x65, 0x61,
-  0x6e, 0x64, 0x20, 0x61, 0x6c, 0x6c, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x2f,
-  0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x5f, 0x5f, 0x70, 0x61, 0x72, 0x61, 0x6d,
-  0x73, 0x48, 0x61, 0x72, 0x76, 0x61, 0x72, 0x64, 0x2f, 0x70, 0x69, 0x78, 0x65,
-  0x6c, 0x2e, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x6c,
-  0x6f, 0x6e, 0x67, 0x72, 0x6f, 0x6c, 0x65, 0x20, 0x6f, 0x66, 0x6a, 0x6f, 0x69,
-  0x6e, 0x74, 0x6c, 0x79, 0x73, 0x6b, 0x79, 0x73, 0x63, 0x72, 0x61, 0x55, 0x6e,
-  0x69, 0x63, 0x6f, 0x64, 0x65, 0x62, 0x72, 0x20, 0x2f, 0x3e, 0x0d, 0x0a, 0x41,
-  0x74, 0x6c, 0x61, 0x6e, 0x74, 0x61, 0x6e, 0x75, 0x63, 0x6c, 0x65, 0x75, 0x73,
-  0x43, 0x6f, 0x75, 0x6e, 0x74, 0x79, 0x2c, 0x70, 0x75, 0x72, 0x65, 0x6c, 0x79,
-  0x20, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x22, 0x3e, 0x65, 0x61, 0x73, 0x69, 0x6c,
-  0x79, 0x20, 0x62, 0x75, 0x69, 0x6c, 0x64, 0x20, 0x61, 0x6f, 0x6e, 0x63, 0x6c,
-  0x69, 0x63, 0x6b, 0x61, 0x20, 0x67, 0x69, 0x76, 0x65, 0x6e, 0x70, 0x6f, 0x69,
-  0x6e, 0x74, 0x65, 0x72, 0x68, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x65, 0x76,
-  0x65, 0x6e, 0x74, 0x73, 0x20, 0x65, 0x6c, 0x73, 0x65, 0x20, 0x7b, 0x0a, 0x64,
-  0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x6e, 0x6f, 0x77, 0x20, 0x74, 0x68, 0x65,
-  0x2c, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x6d, 0x61, 0x6e, 0x20, 0x77, 0x68,
-  0x6f, 0x6f, 0x72, 0x67, 0x2f, 0x57, 0x65, 0x62, 0x6f, 0x6e, 0x65, 0x20, 0x61,
-  0x6e, 0x64, 0x63, 0x61, 0x76, 0x61, 0x6c, 0x72, 0x79, 0x48, 0x65, 0x20, 0x64,
-  0x69, 0x65, 0x64, 0x73, 0x65, 0x61, 0x74, 0x74, 0x6c, 0x65, 0x30, 0x30, 0x2c,
-  0x30, 0x30, 0x30, 0x20, 0x7b, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x68, 0x61,
-  0x76, 0x65, 0x20, 0x74, 0x6f, 0x69, 0x66, 0x28, 0x77, 0x69, 0x6e, 0x64, 0x61,
-  0x6e, 0x64, 0x20, 0x69, 0x74, 0x73, 0x73, 0x6f, 0x6c, 0x65, 0x6c, 0x79, 0x20,
-  0x6d, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x72, 0x65, 0x6e, 0x65, 0x77, 0x65,
-  0x64, 0x44, 0x65, 0x74, 0x72, 0x6f, 0x69, 0x74, 0x61, 0x6d, 0x6f, 0x6e, 0x67,
-  0x73, 0x74, 0x65, 0x69, 0x74, 0x68, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65, 0x6d,
-  0x20, 0x69, 0x6e, 0x53, 0x65, 0x6e, 0x61, 0x74, 0x6f, 0x72, 0x55, 0x73, 0x3c,
-  0x2f, 0x61, 0x3e, 0x3c, 0x4b, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x46, 0x72,
-  0x61, 0x6e, 0x63, 0x69, 0x73, 0x2d, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x68,
-  0x65, 0x20, 0x75, 0x73, 0x65, 0x64, 0x61, 0x72, 0x74, 0x20, 0x61, 0x6e, 0x64,
-  0x68, 0x69, 0x6d, 0x20, 0x61, 0x6e, 0x64, 0x75, 0x73, 0x65, 0x64, 0x20, 0x62,
-  0x79, 0x73, 0x63, 0x6f, 0x72, 0x69, 0x6e, 0x67, 0x61, 0x74, 0x20, 0x68, 0x6f,
-  0x6d, 0x65, 0x74, 0x6f, 0x20, 0x68, 0x61, 0x76, 0x65, 0x72, 0x65, 0x6c, 0x61,
-  0x74, 0x65, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x66, 0x61, 0x63,
-  0x74, 0x69, 0x6f, 0x6e, 0x42, 0x75, 0x66, 0x66, 0x61, 0x6c, 0x6f, 0x6c, 0x69,
-  0x6e, 0x6b, 0x22, 0x3e, 0x3c, 0x77, 0x68, 0x61, 0x74, 0x20, 0x68, 0x65, 0x66,
-  0x72, 0x65, 0x65, 0x20, 0x74, 0x6f, 0x43, 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66,
-  0x63, 0x6f, 0x6d, 0x65, 0x20, 0x69, 0x6e, 0x73, 0x65, 0x63, 0x74, 0x6f, 0x72,
-  0x73, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x65, 0x64, 0x6f, 0x6e, 0x65, 0x20, 0x64,
-  0x61, 0x79, 0x6e, 0x65, 0x72, 0x76, 0x6f, 0x75, 0x73, 0x73, 0x71, 0x75, 0x61,
-  0x72, 0x65, 0x20, 0x7d, 0x3b, 0x69, 0x66, 0x28, 0x67, 0x6f, 0x69, 0x6e, 0x20,
-  0x77, 0x68, 0x61, 0x74, 0x69, 0x6d, 0x67, 0x22, 0x20, 0x61, 0x6c, 0x69, 0x73,
-  0x20, 0x6f, 0x6e, 0x6c, 0x79, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x2f, 0x74,
-  0x75, 0x65, 0x73, 0x64, 0x61, 0x79, 0x6c, 0x6f, 0x6f, 0x73, 0x65, 0x6c, 0x79,
-  0x53, 0x6f, 0x6c, 0x6f, 0x6d, 0x6f, 0x6e, 0x73, 0x65, 0x78, 0x75, 0x61, 0x6c,
-  0x20, 0x2d, 0x20, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x6d, 0x65, 0x64, 0x69, 0x75,
-  0x6d, 0x22, 0x44, 0x4f, 0x20, 0x4e, 0x4f, 0x54, 0x20, 0x46, 0x72, 0x61, 0x6e,
-  0x63, 0x65, 0x2c, 0x77, 0x69, 0x74, 0x68, 0x20, 0x61, 0x20, 0x77, 0x61, 0x72,
-  0x20, 0x61, 0x6e, 0x64, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x20, 0x74, 0x61,
-  0x6b, 0x65, 0x20, 0x61, 0x20, 0x3e, 0x0d, 0x0a, 0x0d, 0x0a, 0x0d, 0x0a, 0x6d,
-  0x61, 0x72, 0x6b, 0x65, 0x74, 0x2e, 0x68, 0x69, 0x67, 0x68, 0x77, 0x61, 0x79,
-  0x64, 0x6f, 0x6e, 0x65, 0x20, 0x69, 0x6e, 0x63, 0x74, 0x69, 0x76, 0x69, 0x74,
-  0x79, 0x22, 0x6c, 0x61, 0x73, 0x74, 0x22, 0x3e, 0x6f, 0x62, 0x6c, 0x69, 0x67,
-  0x65, 0x64, 0x72, 0x69, 0x73, 0x65, 0x20, 0x74, 0x6f, 0x22, 0x75, 0x6e, 0x64,
-  0x65, 0x66, 0x69, 0x6d, 0x61, 0x64, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x45, 0x61,
-  0x72, 0x6c, 0x79, 0x20, 0x70, 0x72, 0x61, 0x69, 0x73, 0x65, 0x64, 0x69, 0x6e,
-  0x20, 0x69, 0x74, 0x73, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x68, 0x69, 0x73, 0x61,
-  0x74, 0x68, 0x6c, 0x65, 0x74, 0x65, 0x4a, 0x75, 0x70, 0x69, 0x74, 0x65, 0x72,
-  0x59, 0x61, 0x68, 0x6f, 0x6f, 0x21, 0x20, 0x74, 0x65, 0x72, 0x6d, 0x65, 0x64,
-  0x20, 0x73, 0x6f, 0x20, 0x6d, 0x61, 0x6e, 0x79, 0x72, 0x65, 0x61, 0x6c, 0x6c,
-  0x79, 0x20, 0x73, 0x2e, 0x20, 0x54, 0x68, 0x65, 0x20, 0x61, 0x20, 0x77, 0x6f,
-  0x6d, 0x61, 0x6e, 0x3f, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x64, 0x69, 0x72,
-  0x65, 0x63, 0x74, 0x20, 0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x20, 0x62, 0x69,
-  0x63, 0x79, 0x63, 0x6c, 0x65, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x64,
-  0x61, 0x79, 0x20, 0x61, 0x6e, 0x64, 0x73, 0x74, 0x61, 0x74, 0x69, 0x6e, 0x67,
-  0x52, 0x61, 0x74, 0x68, 0x65, 0x72, 0x2c, 0x68, 0x69, 0x67, 0x68, 0x65, 0x72,
-  0x20, 0x4f, 0x66, 0x66, 0x69, 0x63, 0x65, 0x20, 0x61, 0x72, 0x65, 0x20, 0x6e,
-  0x6f, 0x77, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x2c, 0x20, 0x77, 0x68, 0x65, 0x6e,
-  0x20, 0x61, 0x20, 0x70, 0x61, 0x79, 0x20, 0x66, 0x6f, 0x72, 0x6f, 0x6e, 0x20,
-  0x74, 0x68, 0x69, 0x73, 0x2d, 0x6c, 0x69, 0x6e, 0x6b, 0x22, 0x3e, 0x3b, 0x62,
-  0x6f, 0x72, 0x64, 0x65, 0x72, 0x61, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x20, 0x61,
-  0x6e, 0x6e, 0x75, 0x61, 0x6c, 0x20, 0x74, 0x68, 0x65, 0x20, 0x4e, 0x65, 0x77,
-  0x70, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x2e, 0x63, 0x6f, 0x6d, 0x22, 0x20,
-  0x74, 0x61, 0x6b, 0x69, 0x6e, 0x20, 0x74, 0x6f, 0x61, 0x20, 0x62, 0x72, 0x69,
-  0x65, 0x66, 0x28, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x67, 0x72, 0x6f, 0x75,
-  0x70, 0x73, 0x2e, 0x3b, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x65, 0x6e, 0x7a,
-  0x79, 0x6d, 0x65, 0x73, 0x73, 0x69, 0x6d, 0x70, 0x6c, 0x65, 0x20, 0x69, 0x6e,
-  0x20, 0x6c, 0x61, 0x74, 0x65, 0x7b, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x74,
-  0x68, 0x65, 0x72, 0x61, 0x70, 0x79, 0x61, 0x20, 0x70, 0x6f, 0x69, 0x6e, 0x74,
-  0x62, 0x61, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x69, 0x6e, 0x6b, 0x73, 0x22, 0x3e,
-  0x0a, 0x28, 0x29, 0x3b, 0x22, 0x20, 0x72, 0x65, 0x61, 0x20, 0x70, 0x6c, 0x61,
-  0x63, 0x65, 0x5c, 0x75, 0x30, 0x30, 0x33, 0x43, 0x61, 0x61, 0x62, 0x6f, 0x75,
-  0x74, 0x20, 0x61, 0x74, 0x72, 0x3e, 0x0d, 0x0a, 0x09, 0x09, 0x63, 0x63, 0x6f,
-  0x75, 0x6e, 0x74, 0x20, 0x67, 0x69, 0x76, 0x65, 0x73, 0x20, 0x61, 0x3c, 0x53,
-  0x43, 0x52, 0x49, 0x50, 0x54, 0x52, 0x61, 0x69, 0x6c, 0x77, 0x61, 0x79, 0x74,
-  0x68, 0x65, 0x6d, 0x65, 0x73, 0x2f, 0x74, 0x6f, 0x6f, 0x6c, 0x62, 0x6f, 0x78,
-  0x42, 0x79, 0x49, 0x64, 0x28, 0x22, 0x78, 0x68, 0x75, 0x6d, 0x61, 0x6e, 0x73,
-  0x2c, 0x77, 0x61, 0x74, 0x63, 0x68, 0x65, 0x73, 0x69, 0x6e, 0x20, 0x73, 0x6f,
-  0x6d, 0x65, 0x20, 0x69, 0x66, 0x20, 0x28, 0x77, 0x69, 0x63, 0x6f, 0x6d, 0x69,
-  0x6e, 0x67, 0x20, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x73, 0x20, 0x55, 0x6e,
-  0x64, 0x65, 0x72, 0x20, 0x62, 0x75, 0x74, 0x20, 0x68, 0x61, 0x73, 0x68, 0x61,
-  0x6e, 0x64, 0x65, 0x64, 0x20, 0x6d, 0x61, 0x64, 0x65, 0x20, 0x62, 0x79, 0x74,
-  0x68, 0x61, 0x6e, 0x20, 0x69, 0x6e, 0x66, 0x65, 0x61, 0x72, 0x20, 0x6f, 0x66,
-  0x64, 0x65, 0x6e, 0x6f, 0x74, 0x65, 0x64, 0x2f, 0x69, 0x66, 0x72, 0x61, 0x6d,
-  0x65, 0x6c, 0x65, 0x66, 0x74, 0x20, 0x69, 0x6e, 0x76, 0x6f, 0x6c, 0x74, 0x61,
-  0x67, 0x65, 0x69, 0x6e, 0x20, 0x65, 0x61, 0x63, 0x68, 0x61, 0x26, 0x71, 0x75,
-  0x6f, 0x74, 0x3b, 0x62, 0x61, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x49, 0x6e, 0x20,
-  0x6d, 0x61, 0x6e, 0x79, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x67, 0x6f, 0x72, 0x65,
-  0x67, 0x69, 0x6d, 0x65, 0x73, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x3c,
-  0x2f, 0x70, 0x3e, 0x0d, 0x0a, 0x3c, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x56, 0x61,
-  0x3b, 0x26, 0x67, 0x74, 0x3b, 0x3c, 0x2f, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74,
-  0x73, 0x6f, 0x72, 0x20, 0x74, 0x68, 0x61, 0x74, 0x6d, 0x6f, 0x73, 0x74, 0x6c,
-  0x79, 0x20, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x72, 0x65, 0x20, 0x73, 0x69, 0x7a,
-  0x65, 0x3d, 0x22, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x68, 0x61, 0x20, 0x63,
-  0x6c, 0x61, 0x73, 0x73, 0x70, 0x61, 0x73, 0x73, 0x69, 0x76, 0x65, 0x48, 0x6f,
-  0x73, 0x74, 0x20, 0x3d, 0x20, 0x57, 0x68, 0x65, 0x74, 0x68, 0x65, 0x72, 0x66,
-  0x65, 0x72, 0x74, 0x69, 0x6c, 0x65, 0x56, 0x61, 0x72, 0x69, 0x6f, 0x75, 0x73,
-  0x3d, 0x5b, 0x5d, 0x3b, 0x28, 0x66, 0x75, 0x63, 0x61, 0x6d, 0x65, 0x72, 0x61,
-  0x73, 0x2f, 0x3e, 0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x61, 0x63, 0x74, 0x73, 0x20,
-  0x61, 0x73, 0x49, 0x6e, 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x3e, 0x0d, 0x0a, 0x0d,
-  0x0a, 0x3c, 0x21, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x73, 0x20, 0x3c, 0x62,
-  0x72, 0x20, 0x2f, 0x3e, 0x42, 0x65, 0x69, 0x6a, 0x69, 0x6e, 0x67, 0x63, 0x61,
-  0x74, 0x61, 0x6c, 0xc3, 0xa0, 0x64, 0x65, 0x75, 0x74, 0x73, 0x63, 0x68, 0x65,
-  0x75, 0x72, 0x6f, 0x70, 0x65, 0x75, 0x65, 0x75, 0x73, 0x6b, 0x61, 0x72, 0x61,
-  0x67, 0x61, 0x65, 0x69, 0x6c, 0x67, 0x65, 0x73, 0x76, 0x65, 0x6e, 0x73, 0x6b,
-  0x61, 0x65, 0x73, 0x70, 0x61, 0xc3, 0xb1, 0x61, 0x6d, 0x65, 0x6e, 0x73, 0x61,
-  0x6a, 0x65, 0x75, 0x73, 0x75, 0x61, 0x72, 0x69, 0x6f, 0x74, 0x72, 0x61, 0x62,
-  0x61, 0x6a, 0x6f, 0x6d, 0xc3, 0xa9, 0x78, 0x69, 0x63, 0x6f, 0x70, 0xc3, 0xa1,
-  0x67, 0x69, 0x6e, 0x61, 0x73, 0x69, 0x65, 0x6d, 0x70, 0x72, 0x65, 0x73, 0x69,
-  0x73, 0x74, 0x65, 0x6d, 0x61, 0x6f, 0x63, 0x74, 0x75, 0x62, 0x72, 0x65, 0x64,
-  0x75, 0x72, 0x61, 0x6e, 0x74, 0x65, 0x61, 0xc3, 0xb1, 0x61, 0x64, 0x69, 0x72,
-  0x65, 0x6d, 0x70, 0x72, 0x65, 0x73, 0x61, 0x6d, 0x6f, 0x6d, 0x65, 0x6e, 0x74,
-  0x6f, 0x6e, 0x75, 0x65, 0x73, 0x74, 0x72, 0x6f, 0x70, 0x72, 0x69, 0x6d, 0x65,
-  0x72, 0x61, 0x74, 0x72, 0x61, 0x76, 0xc3, 0xa9, 0x73, 0x67, 0x72, 0x61, 0x63,
-  0x69, 0x61, 0x73, 0x6e, 0x75, 0x65, 0x73, 0x74, 0x72, 0x61, 0x70, 0x72, 0x6f,
-  0x63, 0x65, 0x73, 0x6f, 0x65, 0x73, 0x74, 0x61, 0x64, 0x6f, 0x73, 0x63, 0x61,
-  0x6c, 0x69, 0x64, 0x61, 0x64, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61, 0x6e,
-  0xc3, 0xba, 0x6d, 0x65, 0x72, 0x6f, 0x61, 0x63, 0x75, 0x65, 0x72, 0x64, 0x6f,
-  0x6d, 0xc3, 0xba, 0x73, 0x69, 0x63, 0x61, 0x6d, 0x69, 0x65, 0x6d, 0x62, 0x72,
-  0x6f, 0x6f, 0x66, 0x65, 0x72, 0x74, 0x61, 0x73, 0x61, 0x6c, 0x67, 0x75, 0x6e,
-  0x6f, 0x73, 0x70, 0x61, 0xc3, 0xad, 0x73, 0x65, 0x73, 0x65, 0x6a, 0x65, 0x6d,
-  0x70, 0x6c, 0x6f, 0x64, 0x65, 0x72, 0x65, 0x63, 0x68, 0x6f, 0x61, 0x64, 0x65,
-  0x6d, 0xc3, 0xa1, 0x73, 0x70, 0x72, 0x69, 0x76, 0x61, 0x64, 0x6f, 0x61, 0x67,
-  0x72, 0x65, 0x67, 0x61, 0x72, 0x65, 0x6e, 0x6c, 0x61, 0x63, 0x65, 0x73, 0x70,
-  0x6f, 0x73, 0x69, 0x62, 0x6c, 0x65, 0x68, 0x6f, 0x74, 0x65, 0x6c, 0x65, 0x73,
-  0x73, 0x65, 0x76, 0x69, 0x6c, 0x6c, 0x61, 0x70, 0x72, 0x69, 0x6d, 0x65, 0x72,
-  0x6f, 0xc3, 0xba, 0x6c, 0x74, 0x69, 0x6d, 0x6f, 0x65, 0x76, 0x65, 0x6e, 0x74,
-  0x6f, 0x73, 0x61, 0x72, 0x63, 0x68, 0x69, 0x76, 0x6f, 0x63, 0x75, 0x6c, 0x74,
-  0x75, 0x72, 0x61, 0x6d, 0x75, 0x6a, 0x65, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74,
-  0x72, 0x61, 0x64, 0x61, 0x61, 0x6e, 0x75, 0x6e, 0x63, 0x69, 0x6f, 0x65, 0x6d,
-  0x62, 0x61, 0x72, 0x67, 0x6f, 0x6d, 0x65, 0x72, 0x63, 0x61, 0x64, 0x6f, 0x67,
-  0x72, 0x61, 0x6e, 0x64, 0x65, 0x73, 0x65, 0x73, 0x74, 0x75, 0x64, 0x69, 0x6f,
-  0x6d, 0x65, 0x6a, 0x6f, 0x72, 0x65, 0x73, 0x66, 0x65, 0x62, 0x72, 0x65, 0x72,
-  0x6f, 0x64, 0x69, 0x73, 0x65, 0xc3, 0xb1, 0x6f, 0x74, 0x75, 0x72, 0x69, 0x73,
-  0x6d, 0x6f, 0x63, 0xc3, 0xb3, 0x64, 0x69, 0x67, 0x6f, 0x70, 0x6f, 0x72, 0x74,
-  0x61, 0x64, 0x61, 0x65, 0x73, 0x70, 0x61, 0x63, 0x69, 0x6f, 0x66, 0x61, 0x6d,
-  0x69, 0x6c, 0x69, 0x61, 0x61, 0x6e, 0x74, 0x6f, 0x6e, 0x69, 0x6f, 0x70, 0x65,
-  0x72, 0x6d, 0x69, 0x74, 0x65, 0x67, 0x75, 0x61, 0x72, 0x64, 0x61, 0x72, 0x61,
-  0x6c, 0x67, 0x75, 0x6e, 0x61, 0x73, 0x70, 0x72, 0x65, 0x63, 0x69, 0x6f, 0x73,
-  0x61, 0x6c, 0x67, 0x75, 0x69, 0x65, 0x6e, 0x73, 0x65, 0x6e, 0x74, 0x69, 0x64,
-  0x6f, 0x76, 0x69, 0x73, 0x69, 0x74, 0x61, 0x73, 0x74, 0xc3, 0xad, 0x74, 0x75,
-  0x6c, 0x6f, 0x63, 0x6f, 0x6e, 0x6f, 0x63, 0x65, 0x72, 0x73, 0x65, 0x67, 0x75,
-  0x6e, 0x64, 0x6f, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x6a, 0x6f, 0x66, 0x72, 0x61,
-  0x6e, 0x63, 0x69, 0x61, 0x6d, 0x69, 0x6e, 0x75, 0x74, 0x6f, 0x73, 0x73, 0x65,
-  0x67, 0x75, 0x6e, 0x64, 0x61, 0x74, 0x65, 0x6e, 0x65, 0x6d, 0x6f, 0x73, 0x65,
-  0x66, 0x65, 0x63, 0x74, 0x6f, 0x73, 0x6d, 0xc3, 0xa1, 0x6c, 0x61, 0x67, 0x61,
-  0x73, 0x65, 0x73, 0x69, 0xc3, 0xb3, 0x6e, 0x72, 0x65, 0x76, 0x69, 0x73, 0x74,
-  0x61, 0x67, 0x72, 0x61, 0x6e, 0x61, 0x64, 0x61, 0x63, 0x6f, 0x6d, 0x70, 0x72,
-  0x61, 0x72, 0x69, 0x6e, 0x67, 0x72, 0x65, 0x73, 0x6f, 0x67, 0x61, 0x72, 0x63,
-  0xc3, 0xad, 0x61, 0x61, 0x63, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x65, 0x63, 0x75,
-  0x61, 0x64, 0x6f, 0x72, 0x71, 0x75, 0x69, 0x65, 0x6e, 0x65, 0x73, 0x69, 0x6e,
-  0x63, 0x6c, 0x75, 0x73, 0x6f, 0x64, 0x65, 0x62, 0x65, 0x72, 0xc3, 0xa1, 0x6d,
-  0x61, 0x74, 0x65, 0x72, 0x69, 0x61, 0x68, 0x6f, 0x6d, 0x62, 0x72, 0x65, 0x73,
-  0x6d, 0x75, 0x65, 0x73, 0x74, 0x72, 0x61, 0x70, 0x6f, 0x64, 0x72, 0xc3, 0xad,
-  0x61, 0x6d, 0x61, 0xc3, 0xb1, 0x61, 0x6e, 0x61, 0xc3, 0xba, 0x6c, 0x74, 0x69,
-  0x6d, 0x61, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x6f, 0x73, 0x6f, 0x66, 0x69, 0x63,
-  0x69, 0x61, 0x6c, 0x74, 0x61, 0x6d, 0x62, 0x69, 0x65, 0x6e, 0x6e, 0x69, 0x6e,
-  0x67, 0xc3, 0xba, 0x6e, 0x73, 0x61, 0x6c, 0x75, 0x64, 0x6f, 0x73, 0x70, 0x6f,
-  0x64, 0x65, 0x6d, 0x6f, 0x73, 0x6d, 0x65, 0x6a, 0x6f, 0x72, 0x61, 0x72, 0x70,
-  0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x75, 0x73, 0x69, 0x6e, 0x65,
-  0x73, 0x73, 0x68, 0x6f, 0x6d, 0x65, 0x70, 0x61, 0x67, 0x65, 0x73, 0x65, 0x63,
-  0x75, 0x72, 0x69, 0x74, 0x79, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65,
-  0x73, 0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x63, 0x61, 0x6d, 0x70, 0x61,
-  0x69, 0x67, 0x6e, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x63, 0x61,
-  0x74, 0x65, 0x67, 0x6f, 0x72, 0x79, 0x65, 0x78, 0x74, 0x65, 0x72, 0x6e, 0x61,
-  0x6c, 0x63, 0x68, 0x69, 0x6c, 0x64, 0x72, 0x65, 0x6e, 0x72, 0x65, 0x73, 0x65,
-  0x72, 0x76, 0x65, 0x64, 0x72, 0x65, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x65,
-  0x78, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x66, 0x61, 0x76, 0x6f, 0x72, 0x69,
-  0x74, 0x65, 0x74, 0x65, 0x6d, 0x70, 0x6c, 0x61, 0x74, 0x65, 0x6d, 0x69, 0x6c,
-  0x69, 0x74, 0x61, 0x72, 0x79, 0x69, 0x6e, 0x64, 0x75, 0x73, 0x74, 0x72, 0x79,
-  0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x6d, 0x61, 0x74, 0x65, 0x72,
-  0x69, 0x61, 0x6c, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x73, 0x7a, 0x2d,
-  0x69, 0x6e, 0x64, 0x65, 0x78, 0x3a, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74,
-  0x73, 0x73, 0x6f, 0x66, 0x74, 0x77, 0x61, 0x72, 0x65, 0x63, 0x6f, 0x6d, 0x70,
-  0x6c, 0x65, 0x74, 0x65, 0x63, 0x61, 0x6c, 0x65, 0x6e, 0x64, 0x61, 0x72, 0x70,
-  0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c,
-  0x65, 0x73, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65, 0x64, 0x6d, 0x6f, 0x76,
-  0x65, 0x6d, 0x65, 0x6e, 0x74, 0x71, 0x75, 0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e,
-  0x62, 0x75, 0x69, 0x6c, 0x64, 0x69, 0x6e, 0x67, 0x70, 0x6f, 0x6c, 0x69, 0x74,
-  0x69, 0x63, 0x73, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x6c, 0x65, 0x72, 0x65,
-  0x6c, 0x69, 0x67, 0x69, 0x6f, 0x6e, 0x70, 0x68, 0x79, 0x73, 0x69, 0x63, 0x61,
-  0x6c, 0x66, 0x65, 0x65, 0x64, 0x62, 0x61, 0x63, 0x6b, 0x72, 0x65, 0x67, 0x69,
-  0x73, 0x74, 0x65, 0x72, 0x70, 0x69, 0x63, 0x74, 0x75, 0x72, 0x65, 0x73, 0x64,
-  0x69, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x64, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63,
-  0x6f, 0x6c, 0x61, 0x75, 0x64, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x65, 0x74,
-  0x74, 0x69, 0x6e, 0x67, 0x73, 0x61, 0x63, 0x74, 0x69, 0x76, 0x69, 0x74, 0x79,
-  0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x6c, 0x65, 0x61, 0x72, 0x6e,
-  0x69, 0x6e, 0x67, 0x61, 0x6e, 0x79, 0x74, 0x68, 0x69, 0x6e, 0x67, 0x61, 0x62,
-  0x73, 0x74, 0x72, 0x61, 0x63, 0x74, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x65, 0x73,
-  0x73, 0x6f, 0x76, 0x65, 0x72, 0x76, 0x69, 0x65, 0x77, 0x6d, 0x61, 0x67, 0x61,
-  0x7a, 0x69, 0x6e, 0x65, 0x65, 0x63, 0x6f, 0x6e, 0x6f, 0x6d, 0x69, 0x63, 0x74,
-  0x72, 0x61, 0x69, 0x6e, 0x69, 0x6e, 0x67, 0x70, 0x72, 0x65, 0x73, 0x73, 0x75,
-  0x72, 0x65, 0x76, 0x61, 0x72, 0x69, 0x6f, 0x75, 0x73, 0x20, 0x3c, 0x73, 0x74,
-  0x72, 0x6f, 0x6e, 0x67, 0x3e, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x74, 0x79,
-  0x73, 0x68, 0x6f, 0x70, 0x70, 0x69, 0x6e, 0x67, 0x74, 0x6f, 0x67, 0x65, 0x74,
-  0x68, 0x65, 0x72, 0x61, 0x64, 0x76, 0x61, 0x6e, 0x63, 0x65, 0x64, 0x62, 0x65,
-  0x68, 0x61, 0x76, 0x69, 0x6f, 0x72, 0x64, 0x6f, 0x77, 0x6e, 0x6c, 0x6f, 0x61,
-  0x64, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x64, 0x66, 0x6f, 0x6f, 0x74,
-  0x62, 0x61, 0x6c, 0x6c, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x4c,
-  0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x64, 0x69, 0x73, 0x74, 0x61, 0x6e,
-  0x63, 0x65, 0x72, 0x65, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x74, 0x72, 0x61,
-  0x63, 0x6b, 0x69, 0x6e, 0x67, 0x70, 0x61, 0x73, 0x73, 0x77, 0x6f, 0x72, 0x64,
-  0x6d, 0x6f, 0x64, 0x69, 0x66, 0x69, 0x65, 0x64, 0x73, 0x74, 0x75, 0x64, 0x65,
-  0x6e, 0x74, 0x73, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6c, 0x79, 0x66, 0x69,
-  0x67, 0x68, 0x74, 0x69, 0x6e, 0x67, 0x6e, 0x6f, 0x72, 0x74, 0x68, 0x65, 0x72,
-  0x6e, 0x64, 0x61, 0x74, 0x61, 0x62, 0x61, 0x73, 0x65, 0x66, 0x65, 0x73, 0x74,
-  0x69, 0x76, 0x61, 0x6c, 0x62, 0x72, 0x65, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x6c,
-  0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e,
-  0x65, 0x74, 0x64, 0x72, 0x6f, 0x70, 0x64, 0x6f, 0x77, 0x6e, 0x70, 0x72, 0x61,
-  0x63, 0x74, 0x69, 0x63, 0x65, 0x65, 0x76, 0x69, 0x64, 0x65, 0x6e, 0x63, 0x65,
-  0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x6d, 0x61, 0x72, 0x72, 0x69,
-  0x61, 0x67, 0x65, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x70, 0x72,
-  0x6f, 0x62, 0x6c, 0x65, 0x6d, 0x73, 0x6e, 0x65, 0x67, 0x61, 0x74, 0x69, 0x76,
-  0x65, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x73, 0x61, 0x6e, 0x61, 0x6c,
-  0x79, 0x73, 0x69, 0x73, 0x72, 0x65, 0x6c, 0x65, 0x61, 0x73, 0x65, 0x64, 0x62,
-  0x61, 0x6e, 0x6e, 0x65, 0x72, 0x22, 0x3e, 0x70, 0x75, 0x72, 0x63, 0x68, 0x61,
-  0x73, 0x65, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x69, 0x65, 0x73, 0x72, 0x65, 0x67,
-  0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x76, 0x65,
-  0x61, 0x72, 0x67, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x62, 0x6f, 0x6f, 0x6b, 0x6d,
-  0x61, 0x72, 0x6b, 0x72, 0x65, 0x66, 0x65, 0x72, 0x72, 0x65, 0x72, 0x63, 0x68,
-  0x65, 0x6d, 0x69, 0x63, 0x61, 0x6c, 0x64, 0x69, 0x76, 0x69, 0x73, 0x69, 0x6f,
-  0x6e, 0x63, 0x61, 0x6c, 0x6c, 0x62, 0x61, 0x63, 0x6b, 0x73, 0x65, 0x70, 0x61,
-  0x72, 0x61, 0x74, 0x65, 0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x63,
-  0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x68, 0x61, 0x72, 0x64, 0x77, 0x61,
-  0x72, 0x65, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x74, 0x64, 0x65, 0x6c,
-  0x69, 0x76, 0x65, 0x72, 0x79, 0x6d, 0x6f, 0x75, 0x6e, 0x74, 0x61, 0x69, 0x6e,
-  0x6f, 0x62, 0x74, 0x61, 0x69, 0x6e, 0x65, 0x64, 0x3d, 0x20, 0x66, 0x61, 0x6c,
-  0x73, 0x65, 0x3b, 0x66, 0x6f, 0x72, 0x28, 0x76, 0x61, 0x72, 0x20, 0x61, 0x63,
-  0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x63, 0x61, 0x70, 0x61, 0x63, 0x69, 0x74,
-  0x79, 0x63, 0x6f, 0x6d, 0x70, 0x75, 0x74, 0x65, 0x72, 0x69, 0x64, 0x65, 0x6e,
-  0x74, 0x69, 0x74, 0x79, 0x61, 0x69, 0x72, 0x63, 0x72, 0x61, 0x66, 0x74, 0x65,
-  0x6d, 0x70, 0x6c, 0x6f, 0x79, 0x65, 0x64, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x73,
-  0x65, 0x64, 0x64, 0x6f, 0x6d, 0x65, 0x73, 0x74, 0x69, 0x63, 0x69, 0x6e, 0x63,
-  0x6c, 0x75, 0x64, 0x65, 0x73, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x64,
-  0x68, 0x6f, 0x73, 0x70, 0x69, 0x74, 0x61, 0x6c, 0x76, 0x65, 0x72, 0x74, 0x69,
-  0x63, 0x61, 0x6c, 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x70, 0x73, 0x65, 0x61, 0x70,
-  0x70, 0x72, 0x6f, 0x61, 0x63, 0x68, 0x70, 0x61, 0x72, 0x74, 0x6e, 0x65, 0x72,
-  0x73, 0x6c, 0x6f, 0x67, 0x6f, 0x22, 0x3e, 0x3c, 0x61, 0x64, 0x61, 0x75, 0x67,
-  0x68, 0x74, 0x65, 0x72, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72, 0x22, 0x20, 0x63,
-  0x75, 0x6c, 0x74, 0x75, 0x72, 0x61, 0x6c, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x69,
-  0x65, 0x73, 0x2f, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x73, 0x2f, 0x61, 0x73, 0x73,
-  0x65, 0x6d, 0x62, 0x6c, 0x79, 0x70, 0x6f, 0x77, 0x65, 0x72, 0x66, 0x75, 0x6c,
-  0x74, 0x65, 0x61, 0x63, 0x68, 0x69, 0x6e, 0x67, 0x66, 0x69, 0x6e, 0x69, 0x73,
-  0x68, 0x65, 0x64, 0x64, 0x69, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74, 0x63, 0x72,
-  0x69, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x63, 0x67, 0x69, 0x2d, 0x62, 0x69, 0x6e,
-  0x2f, 0x70, 0x75, 0x72, 0x70, 0x6f, 0x73, 0x65, 0x73, 0x72, 0x65, 0x71, 0x75,
-  0x69, 0x72, 0x65, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x62,
-  0x65, 0x63, 0x6f, 0x6d, 0x69, 0x6e, 0x67, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64,
-  0x65, 0x73, 0x61, 0x63, 0x61, 0x64, 0x65, 0x6d, 0x69, 0x63, 0x65, 0x78, 0x65,
-  0x72, 0x63, 0x69, 0x73, 0x65, 0x61, 0x63, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79,
-  0x6d, 0x65, 0x64, 0x69, 0x63, 0x69, 0x6e, 0x65, 0x63, 0x6f, 0x6e, 0x73, 0x74,
-  0x61, 0x6e, 0x74, 0x61, 0x63, 0x63, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x4d, 0x61,
-  0x67, 0x61, 0x7a, 0x69, 0x6e, 0x65, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e,
-  0x74, 0x73, 0x74, 0x61, 0x72, 0x74, 0x69, 0x6e, 0x67, 0x62, 0x6f, 0x74, 0x74,
-  0x6f, 0x6d, 0x22, 0x3e, 0x6f, 0x62, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x3a,
-  0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64,
-  0x65, 0x64, 0x70, 0x72, 0x65, 0x76, 0x69, 0x6f, 0x75, 0x73, 0x53, 0x6f, 0x66,
-  0x74, 0x77, 0x61, 0x72, 0x65, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x65, 0x72,
-  0x64, 0x65, 0x63, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x65, 0x6e,
-  0x67, 0x74, 0x68, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x65, 0x64, 0x73, 0x6c,
-  0x69, 0x67, 0x68, 0x74, 0x6c, 0x79, 0x70, 0x6c, 0x61, 0x6e, 0x6e, 0x69, 0x6e,
-  0x67, 0x74, 0x65, 0x78, 0x74, 0x61, 0x72, 0x65, 0x61, 0x63, 0x75, 0x72, 0x72,
-  0x65, 0x6e, 0x63, 0x79, 0x65, 0x76, 0x65, 0x72, 0x79, 0x6f, 0x6e, 0x65, 0x73,
-  0x74, 0x72, 0x61, 0x69, 0x67, 0x68, 0x74, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x66,
-  0x65, 0x72, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x76, 0x65, 0x70, 0x72, 0x6f,
-  0x64, 0x75, 0x63, 0x65, 0x64, 0x68, 0x65, 0x72, 0x69, 0x74, 0x61, 0x67, 0x65,
-  0x73, 0x68, 0x69, 0x70, 0x70, 0x69, 0x6e, 0x67, 0x61, 0x62, 0x73, 0x6f, 0x6c,
-  0x75, 0x74, 0x65, 0x72, 0x65, 0x63, 0x65, 0x69, 0x76, 0x65, 0x64, 0x72, 0x65,
-  0x6c, 0x65, 0x76, 0x61, 0x6e, 0x74, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x22,
-  0x20, 0x76, 0x69, 0x6f, 0x6c, 0x65, 0x6e, 0x63, 0x65, 0x61, 0x6e, 0x79, 0x77,
-  0x68, 0x65, 0x72, 0x65, 0x62, 0x65, 0x6e, 0x65, 0x66, 0x69, 0x74, 0x73, 0x6c,
-  0x61, 0x75, 0x6e, 0x63, 0x68, 0x65, 0x64, 0x72, 0x65, 0x63, 0x65, 0x6e, 0x74,
-  0x6c, 0x79, 0x61, 0x6c, 0x6c, 0x69, 0x61, 0x6e, 0x63, 0x65, 0x66, 0x6f, 0x6c,
-  0x6c, 0x6f, 0x77, 0x65, 0x64, 0x6d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x65,
-  0x62, 0x75, 0x6c, 0x6c, 0x65, 0x74, 0x69, 0x6e, 0x69, 0x6e, 0x63, 0x6c, 0x75,
-  0x64, 0x65, 0x64, 0x6f, 0x63, 0x63, 0x75, 0x72, 0x72, 0x65, 0x64, 0x69, 0x6e,
-  0x74, 0x65, 0x72, 0x6e, 0x61, 0x6c, 0x24, 0x28, 0x74, 0x68, 0x69, 0x73, 0x29,
-  0x2e, 0x72, 0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x3e, 0x3c, 0x74, 0x72,
-  0x3e, 0x3c, 0x74, 0x64, 0x63, 0x6f, 0x6e, 0x67, 0x72, 0x65, 0x73, 0x73, 0x72,
-  0x65, 0x63, 0x6f, 0x72, 0x64, 0x65, 0x64, 0x75, 0x6c, 0x74, 0x69, 0x6d, 0x61,
-  0x74, 0x65, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x3c, 0x75, 0x6c,
-  0x20, 0x69, 0x64, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72,
-  0x48, 0x6f, 0x6d, 0x65, 0x3c, 0x2f, 0x61, 0x3e, 0x77, 0x65, 0x62, 0x73, 0x69,
-  0x74, 0x65, 0x73, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x73, 0x61, 0x6c,
-  0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x65, 0x6e, 0x74, 0x69, 0x72, 0x65, 0x6c,
-  0x79, 0x6d, 0x65, 0x6d, 0x6f, 0x72, 0x69, 0x61, 0x6c, 0x6d, 0x65, 0x73, 0x73,
-  0x61, 0x67, 0x65, 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75, 0x65, 0x61,
-  0x63, 0x74, 0x69, 0x76, 0x65, 0x22, 0x3e, 0x73, 0x6f, 0x6d, 0x65, 0x77, 0x68,
-  0x61, 0x74, 0x76, 0x69, 0x63, 0x74, 0x6f, 0x72, 0x69, 0x61, 0x57, 0x65, 0x73,
-  0x74, 0x65, 0x72, 0x6e, 0x20, 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3d, 0x22,
-  0x4c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e, 0x74, 0x72,
-  0x61, 0x63, 0x74, 0x76, 0x69, 0x73, 0x69, 0x74, 0x6f, 0x72, 0x73, 0x44, 0x6f,
-  0x77, 0x6e, 0x6c, 0x6f, 0x61, 0x64, 0x77, 0x69, 0x74, 0x68, 0x6f, 0x75, 0x74,
-  0x20, 0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x3e, 0x0a, 0x6d, 0x65, 0x61, 0x73,
-  0x75, 0x72, 0x65, 0x73, 0x77, 0x69, 0x64, 0x74, 0x68, 0x20, 0x3d, 0x20, 0x76,
-  0x61, 0x72, 0x69, 0x61, 0x62, 0x6c, 0x65, 0x69, 0x6e, 0x76, 0x6f, 0x6c, 0x76,
-  0x65, 0x64, 0x76, 0x69, 0x72, 0x67, 0x69, 0x6e, 0x69, 0x61, 0x6e, 0x6f, 0x72,
-  0x6d, 0x61, 0x6c, 0x6c, 0x79, 0x68, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x65, 0x64,
-  0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x73, 0x73, 0x74, 0x61, 0x6e, 0x64,
-  0x69, 0x6e, 0x67, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x52, 0x65,
-  0x67, 0x69, 0x73, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x70, 0x61, 0x72, 0x65,
-  0x64, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x73, 0x61, 0x63, 0x63, 0x75,
-  0x72, 0x61, 0x74, 0x65, 0x62, 0x69, 0x72, 0x74, 0x68, 0x64, 0x61, 0x79, 0x73,
-  0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x79, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x69,
-  0x61, 0x6c, 0x67, 0x72, 0x61, 0x70, 0x68, 0x69, 0x63, 0x73, 0x63, 0x72, 0x69,
-  0x6d, 0x69, 0x6e, 0x61, 0x6c, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x6c, 0x79,
-  0x63, 0x6f, 0x6e, 0x73, 0x75, 0x6d, 0x65, 0x72, 0x50, 0x65, 0x72, 0x73, 0x6f,
-  0x6e, 0x61, 0x6c, 0x73, 0x70, 0x65, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x76, 0x61,
-  0x6c, 0x69, 0x64, 0x61, 0x74, 0x65, 0x61, 0x63, 0x68, 0x69, 0x65, 0x76, 0x65,
-  0x64, 0x2e, 0x6a, 0x70, 0x67, 0x22, 0x20, 0x2f, 0x3e, 0x6d, 0x61, 0x63, 0x68,
-  0x69, 0x6e, 0x65, 0x73, 0x3c, 0x2f, 0x68, 0x32, 0x3e, 0x0a, 0x20, 0x20, 0x6b,
-  0x65, 0x79, 0x77, 0x6f, 0x72, 0x64, 0x73, 0x66, 0x72, 0x69, 0x65, 0x6e, 0x64,
-  0x6c, 0x79, 0x62, 0x72, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x73, 0x63, 0x6f, 0x6d,
-  0x62, 0x69, 0x6e, 0x65, 0x64, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c,
-  0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x65, 0x78, 0x70, 0x65, 0x63,
-  0x74, 0x65, 0x64, 0x61, 0x64, 0x65, 0x71, 0x75, 0x61, 0x74, 0x65, 0x70, 0x61,
-  0x6b, 0x69, 0x73, 0x74, 0x61, 0x6e, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x22,
-  0x20, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x62, 0x6c, 0x65, 0x3c, 0x2f, 0x6c, 0x61,
-  0x62, 0x65, 0x6c, 0x3e, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x76, 0x65, 0x62,
-  0x72, 0x69, 0x6e, 0x67, 0x69, 0x6e, 0x67, 0x69, 0x6e, 0x63, 0x72, 0x65, 0x61,
-  0x73, 0x65, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6f, 0x72, 0x70, 0x6c, 0x75,
-  0x67, 0x69, 0x6e, 0x73, 0x2f, 0x4c, 0x69, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20,
-  0x48, 0x65, 0x61, 0x64, 0x65, 0x72, 0x22, 0x3e, 0x22, 0x20, 0x6e, 0x61, 0x6d,
-  0x65, 0x3d, 0x22, 0x20, 0x28, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x67, 0x72,
-  0x61, 0x64, 0x75, 0x61, 0x74, 0x65, 0x3c, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x3e,
-  0x0a, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x72, 0x63, 0x65, 0x6d, 0x61, 0x6c, 0x61,
-  0x79, 0x73, 0x69, 0x61, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x6d,
-  0x61, 0x69, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x3b, 0x68, 0x65, 0x69, 0x67, 0x68,
-  0x74, 0x3a, 0x73, 0x63, 0x68, 0x65, 0x64, 0x75, 0x6c, 0x65, 0x63, 0x68, 0x61,
-  0x6e, 0x67, 0x69, 0x6e, 0x67, 0x62, 0x61, 0x63, 0x6b, 0x20, 0x74, 0x6f, 0x20,
-  0x63, 0x61, 0x74, 0x68, 0x6f, 0x6c, 0x69, 0x63, 0x70, 0x61, 0x74, 0x74, 0x65,
-  0x72, 0x6e, 0x73, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a, 0x20, 0x23, 0x67, 0x72,
-  0x65, 0x61, 0x74, 0x65, 0x73, 0x74, 0x73, 0x75, 0x70, 0x70, 0x6c, 0x69, 0x65,
-  0x73, 0x72, 0x65, 0x6c, 0x69, 0x61, 0x62, 0x6c, 0x65, 0x3c, 0x2f, 0x75, 0x6c,
-  0x3e, 0x0a, 0x09, 0x09, 0x3c, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x20, 0x63,
-  0x69, 0x74, 0x69, 0x7a, 0x65, 0x6e, 0x73, 0x63, 0x6c, 0x6f, 0x74, 0x68, 0x69,
-  0x6e, 0x67, 0x77, 0x61, 0x74, 0x63, 0x68, 0x69, 0x6e, 0x67, 0x3c, 0x6c, 0x69,
-  0x20, 0x69, 0x64, 0x3d, 0x22, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69, 0x63,
-  0x63, 0x61, 0x72, 0x72, 0x79, 0x69, 0x6e, 0x67, 0x73, 0x65, 0x6e, 0x74, 0x65,
-  0x6e, 0x63, 0x65, 0x3c, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x3e, 0x63, 0x6f,
-  0x6e, 0x74, 0x72, 0x61, 0x73, 0x74, 0x74, 0x68, 0x69, 0x6e, 0x6b, 0x69, 0x6e,
-  0x67, 0x63, 0x61, 0x74, 0x63, 0x68, 0x28, 0x65, 0x29, 0x73, 0x6f, 0x75, 0x74,
-  0x68, 0x65, 0x72, 0x6e, 0x4d, 0x69, 0x63, 0x68, 0x61, 0x65, 0x6c, 0x20, 0x6d,
-  0x65, 0x72, 0x63, 0x68, 0x61, 0x6e, 0x74, 0x63, 0x61, 0x72, 0x6f, 0x75, 0x73,
-  0x65, 0x6c, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x3a, 0x69, 0x6e, 0x74,
-  0x65, 0x72, 0x69, 0x6f, 0x72, 0x2e, 0x73, 0x70, 0x6c, 0x69, 0x74, 0x28, 0x22,
-  0x6c, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x63, 0x74, 0x6f, 0x62,
-  0x65, 0x72, 0x20, 0x29, 0x7b, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x69, 0x6d,
-  0x70, 0x72, 0x6f, 0x76, 0x65, 0x64, 0x2d, 0x2d, 0x26, 0x67, 0x74, 0x3b, 0x0a,
-  0x0a, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x61, 0x67, 0x65, 0x63, 0x68, 0x61, 0x69,
-  0x72, 0x6d, 0x61, 0x6e, 0x2e, 0x70, 0x6e, 0x67, 0x22, 0x20, 0x2f, 0x3e, 0x73,
-  0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x73, 0x52, 0x69, 0x63, 0x68, 0x61, 0x72,
-  0x64, 0x20, 0x77, 0x68, 0x61, 0x74, 0x65, 0x76, 0x65, 0x72, 0x70, 0x72, 0x6f,
-  0x62, 0x61, 0x62, 0x6c, 0x79, 0x72, 0x65, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x79,
-  0x62, 0x61, 0x73, 0x65, 0x62, 0x61, 0x6c, 0x6c, 0x6a, 0x75, 0x64, 0x67, 0x6d,
-  0x65, 0x6e, 0x74, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x2e, 0x2e, 0x63,
-  0x73, 0x73, 0x22, 0x20, 0x2f, 0x3e, 0x20, 0x77, 0x65, 0x62, 0x73, 0x69, 0x74,
-  0x65, 0x72, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x64, 0x64, 0x65, 0x66, 0x61,
-  0x75, 0x6c, 0x74, 0x22, 0x2f, 0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x0d, 0x0a, 0x65,
-  0x6c, 0x65, 0x63, 0x74, 0x72, 0x69, 0x63, 0x73, 0x63, 0x6f, 0x74, 0x6c, 0x61,
-  0x6e, 0x64, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x71, 0x75, 0x61,
-  0x6e, 0x74, 0x69, 0x74, 0x79, 0x2e, 0x20, 0x49, 0x53, 0x42, 0x4e, 0x20, 0x30,
-  0x64, 0x69, 0x64, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x69, 0x6e, 0x73, 0x74, 0x61,
-  0x6e, 0x63, 0x65, 0x2d, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x2d, 0x22, 0x20,
-  0x6c, 0x61, 0x6e, 0x67, 0x3d, 0x22, 0x73, 0x70, 0x65, 0x61, 0x6b, 0x65, 0x72,
-  0x73, 0x43, 0x6f, 0x6d, 0x70, 0x75, 0x74, 0x65, 0x72, 0x63, 0x6f, 0x6e, 0x74,
-  0x61, 0x69, 0x6e, 0x73, 0x61, 0x72, 0x63, 0x68, 0x69, 0x76, 0x65, 0x73, 0x6d,
-  0x69, 0x6e, 0x69, 0x73, 0x74, 0x65, 0x72, 0x72, 0x65, 0x61, 0x63, 0x74, 0x69,
-  0x6f, 0x6e, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x49, 0x74, 0x61,
-  0x6c, 0x69, 0x61, 0x6e, 0x6f, 0x63, 0x72, 0x69, 0x74, 0x65, 0x72, 0x69, 0x61,
-  0x73, 0x74, 0x72, 0x6f, 0x6e, 0x67, 0x6c, 0x79, 0x3a, 0x20, 0x27, 0x68, 0x74,
-  0x74, 0x70, 0x3a, 0x27, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x27, 0x63, 0x6f,
-  0x76, 0x65, 0x72, 0x69, 0x6e, 0x67, 0x6f, 0x66, 0x66, 0x65, 0x72, 0x69, 0x6e,
-  0x67, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x65, 0x64, 0x42, 0x72, 0x69, 0x74,
-  0x69, 0x73, 0x68, 0x20, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x79, 0x46,
-  0x61, 0x63, 0x65, 0x62, 0x6f, 0x6f, 0x6b, 0x6e, 0x75, 0x6d, 0x65, 0x72, 0x6f,
-  0x75, 0x73, 0x76, 0x65, 0x68, 0x69, 0x63, 0x6c, 0x65, 0x73, 0x63, 0x6f, 0x6e,
-  0x63, 0x65, 0x72, 0x6e, 0x73, 0x41, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x61, 0x6e,
-  0x68, 0x61, 0x6e, 0x64, 0x6c, 0x69, 0x6e, 0x67, 0x64, 0x69, 0x76, 0x20, 0x69,
-  0x64, 0x3d, 0x22, 0x57, 0x69, 0x6c, 0x6c, 0x69, 0x61, 0x6d, 0x20, 0x70, 0x72,
-  0x6f, 0x76, 0x69, 0x64, 0x65, 0x72, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e,
-  0x74, 0x61, 0x63, 0x63, 0x75, 0x72, 0x61, 0x63, 0x79, 0x73, 0x65, 0x63, 0x74,
-  0x69, 0x6f, 0x6e, 0x20, 0x61, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x66,
-  0x6c, 0x65, 0x78, 0x69, 0x62, 0x6c, 0x65, 0x43, 0x61, 0x74, 0x65, 0x67, 0x6f,
-  0x72, 0x79, 0x6c, 0x61, 0x77, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x3c, 0x73, 0x63,
-  0x72, 0x69, 0x70, 0x74, 0x3e, 0x6c, 0x61, 0x79, 0x6f, 0x75, 0x74, 0x3d, 0x22,
-  0x61, 0x70, 0x70, 0x72, 0x6f, 0x76, 0x65, 0x64, 0x20, 0x6d, 0x61, 0x78, 0x69,
-  0x6d, 0x75, 0x6d, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x22, 0x3e, 0x3c, 0x2f,
-  0x74, 0x61, 0x62, 0x6c, 0x65, 0x3e, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65,
-  0x73, 0x68, 0x61, 0x6d, 0x69, 0x6c, 0x74, 0x6f, 0x6e, 0x63, 0x75, 0x72, 0x72,
-  0x65, 0x6e, 0x74, 0x20, 0x63, 0x61, 0x6e, 0x61, 0x64, 0x69, 0x61, 0x6e, 0x63,
-  0x68, 0x61, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x2f, 0x74, 0x68, 0x65, 0x6d, 0x65,
-  0x73, 0x2f, 0x2f, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c, 0x65, 0x6f, 0x70, 0x74,
-  0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x70, 0x6f, 0x72, 0x74, 0x75, 0x67, 0x61, 0x6c,
-  0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x22, 0x69, 0x6e, 0x74, 0x65, 0x72,
-  0x76, 0x61, 0x6c, 0x77, 0x69, 0x72, 0x65, 0x6c, 0x65, 0x73, 0x73, 0x65, 0x6e,
-  0x74, 0x69, 0x74, 0x6c, 0x65, 0x64, 0x61, 0x67, 0x65, 0x6e, 0x63, 0x69, 0x65,
-  0x73, 0x53, 0x65, 0x61, 0x72, 0x63, 0x68, 0x22, 0x20, 0x6d, 0x65, 0x61, 0x73,
-  0x75, 0x72, 0x65, 0x64, 0x74, 0x68, 0x6f, 0x75, 0x73, 0x61, 0x6e, 0x64, 0x73,
-  0x70, 0x65, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x26, 0x68, 0x65, 0x6c, 0x6c, 0x69,
-  0x70, 0x3b, 0x6e, 0x65, 0x77, 0x20, 0x44, 0x61, 0x74, 0x65, 0x22, 0x20, 0x73,
-  0x69, 0x7a, 0x65, 0x3d, 0x22, 0x70, 0x61, 0x67, 0x65, 0x4e, 0x61, 0x6d, 0x65,
-  0x6d, 0x69, 0x64, 0x64, 0x6c, 0x65, 0x22, 0x20, 0x22, 0x20, 0x2f, 0x3e, 0x3c,
-  0x2f, 0x61, 0x3e, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x22, 0x3e, 0x73, 0x65,
-  0x71, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61,
-  0x6c, 0x6f, 0x76, 0x65, 0x72, 0x66, 0x6c, 0x6f, 0x77, 0x6f, 0x70, 0x69, 0x6e,
-  0x69, 0x6f, 0x6e, 0x73, 0x69, 0x6c, 0x6c, 0x69, 0x6e, 0x6f, 0x69, 0x73, 0x6c,
-  0x69, 0x6e, 0x6b, 0x73, 0x22, 0x3e, 0x0a, 0x09, 0x3c, 0x74, 0x69, 0x74, 0x6c,
-  0x65, 0x3e, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x73, 0x61, 0x74,
-  0x75, 0x72, 0x64, 0x61, 0x79, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, 0x61, 0x6c,
-  0x69, 0x74, 0x65, 0x6d, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x6e, 0x67, 0x69, 0x6e,
-  0x65, 0x65, 0x72, 0x73, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x64, 0x65,
-  0x73, 0x69, 0x67, 0x6e, 0x65, 0x72, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x73, 0x61,
-  0x6c, 0x3d, 0x22, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x22, 0x45, 0x73, 0x70, 0x61,
-  0xc3, 0xb1, 0x6f, 0x6c, 0x72, 0x65, 0x6c, 0x65, 0x61, 0x73, 0x65, 0x73, 0x73,
-  0x75, 0x62, 0x6d, 0x69, 0x74, 0x22, 0x20, 0x65, 0x72, 0x26, 0x71, 0x75, 0x6f,
-  0x74, 0x3b, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x79, 0x6d,
-  0x70, 0x74, 0x6f, 0x6d, 0x73, 0x6f, 0x72, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x64,
-  0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x72, 0x69, 0x67, 0x68, 0x74,
-  0x22, 0x3e, 0x3c, 0x70, 0x6c, 0x65, 0x61, 0x73, 0x75, 0x72, 0x65, 0x73, 0x74,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x79,
-  0x2e, 0x6c, 0x65, 0x61, 0x76, 0x69, 0x6e, 0x67, 0x20, 0x20, 0x62, 0x6f, 0x72,
-  0x64, 0x65, 0x72, 0x3d, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x73, 0x63,
-  0x65, 0x6e, 0x74, 0x65, 0x72, 0x22, 0x3e, 0x2e, 0x0a, 0x0a, 0x53, 0x6f, 0x6d,
-  0x65, 0x20, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x65, 0x64, 0x73, 0x75, 0x69,
-  0x74, 0x61, 0x62, 0x6c, 0x65, 0x62, 0x75, 0x6c, 0x67, 0x61, 0x72, 0x69, 0x61,
-  0x2e, 0x73, 0x68, 0x6f, 0x77, 0x28, 0x29, 0x3b, 0x64, 0x65, 0x73, 0x69, 0x67,
-  0x6e, 0x65, 0x64, 0x47, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x20, 0x63, 0x6f,
-  0x6e, 0x63, 0x65, 0x70, 0x74, 0x73, 0x45, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65,
-  0x73, 0x77, 0x69, 0x6c, 0x6c, 0x69, 0x61, 0x6d, 0x73, 0x4f, 0x72, 0x69, 0x67,
-  0x69, 0x6e, 0x61, 0x6c, 0x22, 0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x73,
-  0x65, 0x61, 0x72, 0x63, 0x68, 0x22, 0x3e, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74,
-  0x6f, 0x72, 0x72, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x73, 0x61, 0x20, 0x26,
-  0x71, 0x75, 0x6f, 0x74, 0x3b, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x67,
-  0x44, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x72, 0x65, 0x76, 0x69, 0x73,
-  0x69, 0x6f, 0x6e, 0x2e, 0x20, 0x0a, 0x0a, 0x54, 0x68, 0x65, 0x20, 0x79, 0x6f,
-  0x75, 0x72, 0x73, 0x65, 0x6c, 0x66, 0x43, 0x6f, 0x6e, 0x74, 0x61, 0x63, 0x74,
-  0x20, 0x6d, 0x69, 0x63, 0x68, 0x69, 0x67, 0x61, 0x6e, 0x45, 0x6e, 0x67, 0x6c,
-  0x69, 0x73, 0x68, 0x20, 0x63, 0x6f, 0x6c, 0x75, 0x6d, 0x62, 0x69, 0x61, 0x70,
-  0x72, 0x69, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x70, 0x72, 0x69, 0x6e, 0x74, 0x69,
-  0x6e, 0x67, 0x64, 0x72, 0x69, 0x6e, 0x6b, 0x69, 0x6e, 0x67, 0x66, 0x61, 0x63,
-  0x69, 0x6c, 0x69, 0x74, 0x79, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x65, 0x64,
-  0x43, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x66, 0x69, 0x63,
-  0x65, 0x72, 0x73, 0x52, 0x75, 0x73, 0x73, 0x69, 0x61, 0x6e, 0x20, 0x67, 0x65,
-  0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x2d, 0x38, 0x38, 0x35, 0x39, 0x2d, 0x31,
-  0x22, 0x69, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x66, 0x61, 0x6d, 0x69,
-  0x6c, 0x69, 0x61, 0x72, 0x20, 0x71, 0x75, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x6d,
-  0x61, 0x72, 0x67, 0x69, 0x6e, 0x3a, 0x30, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65,
-  0x6e, 0x74, 0x76, 0x69, 0x65, 0x77, 0x70, 0x6f, 0x72, 0x74, 0x63, 0x6f, 0x6e,
-  0x74, 0x61, 0x63, 0x74, 0x73, 0x2d, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x22, 0x3e,
-  0x70, 0x6f, 0x72, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x2e, 0x6c, 0x65, 0x6e, 0x67,
-  0x74, 0x68, 0x20, 0x65, 0x6c, 0x69, 0x67, 0x69, 0x62, 0x6c, 0x65, 0x69, 0x6e,
-  0x76, 0x6f, 0x6c, 0x76, 0x65, 0x73, 0x61, 0x74, 0x6c, 0x61, 0x6e, 0x74, 0x69,
-  0x63, 0x6f, 0x6e, 0x6c, 0x6f, 0x61, 0x64, 0x3d, 0x22, 0x64, 0x65, 0x66, 0x61,
-  0x75, 0x6c, 0x74, 0x2e, 0x73, 0x75, 0x70, 0x70, 0x6c, 0x69, 0x65, 0x64, 0x70,
-  0x61, 0x79, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x67, 0x6c, 0x6f, 0x73, 0x73, 0x61,
-  0x72, 0x79, 0x0a, 0x0a, 0x41, 0x66, 0x74, 0x65, 0x72, 0x20, 0x67, 0x75, 0x69,
-  0x64, 0x61, 0x6e, 0x63, 0x65, 0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x3c, 0x74, 0x64,
-  0x65, 0x6e, 0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x6d, 0x69, 0x64, 0x64, 0x6c,
-  0x65, 0x22, 0x3e, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x64, 0x69,
-  0x73, 0x70, 0x6c, 0x61, 0x79, 0x73, 0x73, 0x63, 0x6f, 0x74, 0x74, 0x69, 0x73,
-  0x68, 0x6a, 0x6f, 0x6e, 0x61, 0x74, 0x68, 0x61, 0x6e, 0x6d, 0x61, 0x6a, 0x6f,
-  0x72, 0x69, 0x74, 0x79, 0x77, 0x69, 0x64, 0x67, 0x65, 0x74, 0x73, 0x2e, 0x63,
-  0x6c, 0x69, 0x6e, 0x69, 0x63, 0x61, 0x6c, 0x74, 0x68, 0x61, 0x69, 0x6c, 0x61,
-  0x6e, 0x64, 0x74, 0x65, 0x61, 0x63, 0x68, 0x65, 0x72, 0x73, 0x3c, 0x68, 0x65,
-  0x61, 0x64, 0x3e, 0x0a, 0x09, 0x61, 0x66, 0x66, 0x65, 0x63, 0x74, 0x65, 0x64,
-  0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x73, 0x70, 0x6f, 0x69, 0x6e, 0x74,
-  0x65, 0x72, 0x3b, 0x74, 0x6f, 0x53, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x3c, 0x2f,
-  0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x3e, 0x6f, 0x6b, 0x6c, 0x61, 0x68, 0x6f, 0x6d,
-  0x61, 0x77, 0x69, 0x6c, 0x6c, 0x20, 0x62, 0x65, 0x20, 0x69, 0x6e, 0x76, 0x65,
-  0x73, 0x74, 0x6f, 0x72, 0x30, 0x22, 0x20, 0x61, 0x6c, 0x74, 0x3d, 0x22, 0x68,
-  0x6f, 0x6c, 0x69, 0x64, 0x61, 0x79, 0x73, 0x52, 0x65, 0x73, 0x6f, 0x75, 0x72,
-  0x63, 0x65, 0x6c, 0x69, 0x63, 0x65, 0x6e, 0x73, 0x65, 0x64, 0x20, 0x28, 0x77,
-  0x68, 0x69, 0x63, 0x68, 0x20, 0x2e, 0x20, 0x41, 0x66, 0x74, 0x65, 0x72, 0x20,
-  0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x76, 0x69, 0x73, 0x69, 0x74,
-  0x69, 0x6e, 0x67, 0x65, 0x78, 0x70, 0x6c, 0x6f, 0x72, 0x65, 0x72, 0x70, 0x72,
-  0x69, 0x6d, 0x61, 0x72, 0x79, 0x20, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x22,
-  0x20, 0x61, 0x6e, 0x64, 0x72, 0x6f, 0x69, 0x64, 0x22, 0x71, 0x75, 0x69, 0x63,
-  0x6b, 0x6c, 0x79, 0x20, 0x6d, 0x65, 0x65, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x65,
-  0x73, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x3b, 0x72, 0x65, 0x74, 0x75, 0x72,
-  0x6e, 0x20, 0x3b, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a, 0x23, 0x20, 0x68, 0x65,
-  0x69, 0x67, 0x68, 0x74, 0x3d, 0x61, 0x70, 0x70, 0x72, 0x6f, 0x76, 0x61, 0x6c,
-  0x2c, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x20, 0x63, 0x68, 0x65, 0x63,
-  0x6b, 0x65, 0x64, 0x2e, 0x6d, 0x69, 0x6e, 0x2e, 0x6a, 0x73, 0x22, 0x6d, 0x61,
-  0x67, 0x6e, 0x65, 0x74, 0x69, 0x63, 0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f,
-  0x68, 0x66, 0x6f, 0x72, 0x65, 0x63, 0x61, 0x73, 0x74, 0x2e, 0x20, 0x57, 0x68,
-  0x69, 0x6c, 0x65, 0x20, 0x74, 0x68, 0x75, 0x72, 0x73, 0x64, 0x61, 0x79, 0x64,
-  0x76, 0x65, 0x72, 0x74, 0x69, 0x73, 0x65, 0x26, 0x65, 0x61, 0x63, 0x75, 0x74,
-  0x65, 0x3b, 0x68, 0x61, 0x73, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x65, 0x76, 0x61,
-  0x6c, 0x75, 0x61, 0x74, 0x65, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x69, 0x6e, 0x67,
-  0x65, 0x78, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x70, 0x61, 0x74, 0x69, 0x65,
-  0x6e, 0x74, 0x73, 0x20, 0x4f, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x20, 0x63, 0x6f,
-  0x6c, 0x6f, 0x72, 0x61, 0x64, 0x6f, 0x4f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x73,
-  0x22, 0x63, 0x61, 0x6d, 0x70, 0x62, 0x65, 0x6c, 0x6c, 0x3c, 0x21, 0x2d, 0x2d,
-  0x20, 0x65, 0x6e, 0x64, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x3c,
-  0x62, 0x72, 0x20, 0x2f, 0x3e, 0x0d, 0x0a, 0x5f, 0x70, 0x6f, 0x70, 0x75, 0x70,
-  0x73, 0x7c, 0x73, 0x63, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x2c, 0x26, 0x71,
-  0x75, 0x6f, 0x74, 0x3b, 0x20, 0x71, 0x75, 0x61, 0x6c, 0x69, 0x74, 0x79, 0x20,
-  0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x73, 0x20, 0x61, 0x73, 0x73, 0x69, 0x67,
-  0x6e, 0x65, 0x64, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x20, 0x3c, 0x62,
-  0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x6c, 0x65, 0x26, 0x71, 0x75, 0x6f, 0x74,
-  0x3b, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x20, 0x43, 0x6f, 0x6d,
-  0x70, 0x61, 0x6e, 0x79, 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x73, 0x3c,
-  0x69, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x20, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x76,
-  0x65, 0x73, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x73, 0x6d, 0x61, 0x72,
-  0x73, 0x68, 0x61, 0x6c, 0x6c, 0x70, 0x61, 0x72, 0x74, 0x20, 0x6f, 0x66, 0x20,
-  0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x6c, 0x79, 0x29, 0x2e, 0x0a, 0x0a, 0x54,
-  0x68, 0x65, 0x20, 0x74, 0x61, 0x78, 0x6f, 0x6e, 0x6f, 0x6d, 0x79, 0x6d, 0x75,
-  0x63, 0x68, 0x20, 0x6f, 0x66, 0x20, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e,
-  0x0a, 0x22, 0x20, 0x64, 0x61, 0x74, 0x61, 0x2d, 0x73, 0x72, 0x74, 0x75, 0x67,
-  0x75, 0xc3, 0xaa, 0x73, 0x73, 0x63, 0x72, 0x6f, 0x6c, 0x6c, 0x54, 0x6f, 0x20,
-  0x70, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x3c, 0x68, 0x65, 0x61, 0x64, 0x3e,
-  0x0d, 0x0a, 0x61, 0x74, 0x74, 0x6f, 0x72, 0x6e, 0x65, 0x79, 0x65, 0x6d, 0x70,
-  0x68, 0x61, 0x73, 0x69, 0x73, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x6f, 0x72, 0x73,
-  0x66, 0x61, 0x6e, 0x63, 0x79, 0x62, 0x6f, 0x78, 0x77, 0x6f, 0x72, 0x6c, 0x64,
-  0x27, 0x73, 0x20, 0x77, 0x69, 0x6c, 0x64, 0x6c, 0x69, 0x66, 0x65, 0x63, 0x68,
-  0x65, 0x63, 0x6b, 0x65, 0x64, 0x3d, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e,
-  0x73, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x6d, 0x70, 0x78, 0x3b, 0x66,
-  0x6f, 0x6e, 0x74, 0x2d, 0x20, 0x50, 0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x6a,
-  0x6f, 0x75, 0x72, 0x6e, 0x61, 0x6c, 0x73, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x76,
-  0x65, 0x64, 0x76, 0x61, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x68, 0x6f,
-  0x6d, 0x70, 0x73, 0x6f, 0x6e, 0x6c, 0x69, 0x67, 0x68, 0x74, 0x69, 0x6e, 0x67,
-  0x61, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x70, 0x65, 0x63, 0x69,
-  0x61, 0x6c, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x3d, 0x30, 0x63, 0x68,
-  0x65, 0x63, 0x6b, 0x69, 0x6e, 0x67, 0x3c, 0x2f, 0x74, 0x62, 0x6f, 0x64, 0x79,
-  0x3e, 0x3c, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x20, 0x43, 0x6f, 0x6d, 0x70,
-  0x6c, 0x65, 0x74, 0x65, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x66, 0x69, 0x78, 0x0a,
-  0x3c, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0a, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c,
-  0x65, 0x20, 0x3c, 0x73, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x69, 0x6e,
-  0x64, 0x69, 0x6e, 0x67, 0x73, 0x72, 0x6f, 0x6c, 0x65, 0x20, 0x69, 0x6e, 0x20,
-  0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x20, 0x20, 0x4f, 0x63, 0x74, 0x6f,
-  0x62, 0x65, 0x72, 0x77, 0x65, 0x62, 0x73, 0x69, 0x74, 0x65, 0x20, 0x65, 0x78,
-  0x70, 0x6f, 0x73, 0x75, 0x72, 0x65, 0x75, 0x73, 0x65, 0x64, 0x20, 0x74, 0x6f,
-  0x20, 0x20, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x73, 0x6f, 0x70, 0x65, 0x72,
-  0x61, 0x74, 0x65, 0x64, 0x63, 0x6c, 0x69, 0x63, 0x6b, 0x69, 0x6e, 0x67, 0x65,
-  0x6e, 0x74, 0x65, 0x72, 0x69, 0x6e, 0x67, 0x63, 0x6f, 0x6d, 0x6d, 0x61, 0x6e,
-  0x64, 0x73, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x65, 0x64, 0x20, 0x6e, 0x75,
-  0x6d, 0x62, 0x65, 0x72, 0x73, 0x20, 0x20, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
-  0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x6f, 0x6e, 0x53, 0x75, 0x62,
-  0x6d, 0x69, 0x74, 0x6d, 0x61, 0x72, 0x79, 0x6c, 0x61, 0x6e, 0x64, 0x63, 0x6f,
-  0x6c, 0x6c, 0x65, 0x67, 0x65, 0x73, 0x61, 0x6e, 0x61, 0x6c, 0x79, 0x74, 0x69,
-  0x63, 0x6c, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x63, 0x6f, 0x6e, 0x74,
-  0x61, 0x63, 0x74, 0x2e, 0x6c, 0x6f, 0x67, 0x67, 0x65, 0x64, 0x49, 0x6e, 0x61,
-  0x64, 0x76, 0x69, 0x73, 0x6f, 0x72, 0x79, 0x73, 0x69, 0x62, 0x6c, 0x69, 0x6e,
-  0x67, 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x22, 0x73, 0x26, 0x71,
-  0x75, 0x6f, 0x74, 0x3b, 0x29, 0x73, 0x2e, 0x20, 0x54, 0x68, 0x69, 0x73, 0x20,
-  0x70, 0x61, 0x63, 0x6b, 0x61, 0x67, 0x65, 0x73, 0x63, 0x68, 0x65, 0x63, 0x6b,
-  0x62, 0x6f, 0x78, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x73, 0x70, 0x72,
-  0x65, 0x67, 0x6e, 0x61, 0x6e, 0x74, 0x74, 0x6f, 0x6d, 0x6f, 0x72, 0x72, 0x6f,
-  0x77, 0x73, 0x70, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x69, 0x63, 0x6f, 0x6e,
-  0x2e, 0x70, 0x6e, 0x67, 0x6a, 0x61, 0x70, 0x61, 0x6e, 0x65, 0x73, 0x65, 0x63,
-  0x6f, 0x64, 0x65, 0x62, 0x61, 0x73, 0x65, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e,
-  0x22, 0x3e, 0x67, 0x61, 0x6d, 0x62, 0x6c, 0x69, 0x6e, 0x67, 0x73, 0x75, 0x63,
-  0x68, 0x20, 0x61, 0x73, 0x20, 0x2c, 0x20, 0x77, 0x68, 0x69, 0x6c, 0x65, 0x20,
-  0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x20, 0x6d, 0x69, 0x73, 0x73, 0x6f,
-  0x75, 0x72, 0x69, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x69, 0x6e, 0x67, 0x74, 0x6f,
-  0x70, 0x3a, 0x31, 0x70, 0x78, 0x20, 0x2e, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e,
-  0x3e, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x77, 0x69, 0x64, 0x74,
-  0x68, 0x3d, 0x22, 0x32, 0x6c, 0x61, 0x7a, 0x79, 0x6c, 0x6f, 0x61, 0x64, 0x6e,
-  0x6f, 0x76, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x75, 0x73, 0x65, 0x64, 0x20, 0x69,
-  0x6e, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x22, 0x63, 0x72, 0x69,
-  0x70, 0x74, 0x22, 0x3e, 0x0a, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c, 0x2f,
-  0x3c, 0x74, 0x72, 0x3e, 0x3c, 0x74, 0x64, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68,
-  0x74, 0x3a, 0x32, 0x2f, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x63, 0x6f,
-  0x75, 0x6e, 0x74, 0x72, 0x79, 0x20, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65,
-  0x20, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x22, 0x20, 0x26, 0x6c, 0x74, 0x3b,
-  0x21, 0x2d, 0x2d, 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x22, 0x3e, 0x3c, 0x2f,
-  0x6a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x2e, 0x3c, 0x2f, 0x66, 0x6f, 0x72, 0x6d,
-  0x3e, 0x0a, 0x28, 0xe7, 0xae, 0x80, 0xe4, 0xbd, 0x93, 0x29, 0x28, 0xe7, 0xb9,
-  0x81, 0xe9, 0xab, 0x94, 0x29, 0x68, 0x72, 0x76, 0x61, 0x74, 0x73, 0x6b, 0x69,
-  0x69, 0x74, 0x61, 0x6c, 0x69, 0x61, 0x6e, 0x6f, 0x72, 0x6f, 0x6d, 0xc3, 0xa2,
-  0x6e, 0xc4, 0x83, 0x74, 0xc3, 0xbc, 0x72, 0x6b, 0xc3, 0xa7, 0x65, 0xd8, 0xa7,
-  0xd8, 0xb1, 0xd8, 0xaf, 0xd9, 0x88, 0x74, 0x61, 0x6d, 0x62, 0x69, 0xc3, 0xa9,
-  0x6e, 0x6e, 0x6f, 0x74, 0x69, 0x63, 0x69, 0x61, 0x73, 0x6d, 0x65, 0x6e, 0x73,
-  0x61, 0x6a, 0x65, 0x73, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61, 0x73, 0x64,
-  0x65, 0x72, 0x65, 0x63, 0x68, 0x6f, 0x73, 0x6e, 0x61, 0x63, 0x69, 0x6f, 0x6e,
-  0x61, 0x6c, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63, 0x69, 0x6f, 0x63, 0x6f, 0x6e,
-  0x74, 0x61, 0x63, 0x74, 0x6f, 0x75, 0x73, 0x75, 0x61, 0x72, 0x69, 0x6f, 0x73,
-  0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x61, 0x67, 0x6f, 0x62, 0x69, 0x65,
-  0x72, 0x6e, 0x6f, 0x65, 0x6d, 0x70, 0x72, 0x65, 0x73, 0x61, 0x73, 0x61, 0x6e,
-  0x75, 0x6e, 0x63, 0x69, 0x6f, 0x73, 0x76, 0x61, 0x6c, 0x65, 0x6e, 0x63, 0x69,
-  0x61, 0x63, 0x6f, 0x6c, 0x6f, 0x6d, 0x62, 0x69, 0x61, 0x64, 0x65, 0x73, 0x70,
-  0x75, 0xc3, 0xa9, 0x73, 0x64, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x73, 0x70,
-  0x72, 0x6f, 0x79, 0x65, 0x63, 0x74, 0x6f, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63,
-  0x74, 0x6f, 0x70, 0xc3, 0xba, 0x62, 0x6c, 0x69, 0x63, 0x6f, 0x6e, 0x6f, 0x73,
-  0x6f, 0x74, 0x72, 0x6f, 0x73, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x69, 0x61,
-  0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x65, 0x6d, 0x69, 0x6c, 0x6c, 0x6f,
-  0x6e, 0x65, 0x73, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x6e, 0x74, 0x65, 0x70, 0x72,
-  0x65, 0x67, 0x75, 0x6e, 0x74, 0x61, 0x61, 0x6e, 0x74, 0x65, 0x72, 0x69, 0x6f,
-  0x72, 0x72, 0x65, 0x63, 0x75, 0x72, 0x73, 0x6f, 0x73, 0x70, 0x72, 0x6f, 0x62,
-  0x6c, 0x65, 0x6d, 0x61, 0x73, 0x61, 0x6e, 0x74, 0x69, 0x61, 0x67, 0x6f, 0x6e,
-  0x75, 0x65, 0x73, 0x74, 0x72, 0x6f, 0x73, 0x6f, 0x70, 0x69, 0x6e, 0x69, 0xc3,
-  0xb3, 0x6e, 0x69, 0x6d, 0x70, 0x72, 0x69, 0x6d, 0x69, 0x72, 0x6d, 0x69, 0x65,
-  0x6e, 0x74, 0x72, 0x61, 0x73, 0x61, 0x6d, 0xc3, 0xa9, 0x72, 0x69, 0x63, 0x61,
-  0x76, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x6f, 0x72, 0x73, 0x6f, 0x63, 0x69, 0x65,
-  0x64, 0x61, 0x64, 0x72, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x65,
-  0x61, 0x6c, 0x69, 0x7a, 0x61, 0x72, 0x72, 0x65, 0x67, 0x69, 0x73, 0x74, 0x72,
-  0x6f, 0x70, 0x61, 0x6c, 0x61, 0x62, 0x72, 0x61, 0x73, 0x69, 0x6e, 0x74, 0x65,
-  0x72, 0xc3, 0xa9, 0x73, 0x65, 0x6e, 0x74, 0x6f, 0x6e, 0x63, 0x65, 0x73, 0x65,
-  0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c, 0x6d, 0x69, 0x65, 0x6d, 0x62, 0x72,
-  0x6f, 0x73, 0x72, 0x65, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x64, 0x63, 0xc3, 0xb3,
-  0x72, 0x64, 0x6f, 0x62, 0x61, 0x7a, 0x61, 0x72, 0x61, 0x67, 0x6f, 0x7a, 0x61,
-  0x70, 0xc3, 0xa1, 0x67, 0x69, 0x6e, 0x61, 0x73, 0x73, 0x6f, 0x63, 0x69, 0x61,
-  0x6c, 0x65, 0x73, 0x62, 0x6c, 0x6f, 0x71, 0x75, 0x65, 0x61, 0x72, 0x67, 0x65,
-  0x73, 0x74, 0x69, 0xc3, 0xb3, 0x6e, 0x61, 0x6c, 0x71, 0x75, 0x69, 0x6c, 0x65,
-  0x72, 0x73, 0x69, 0x73, 0x74, 0x65, 0x6d, 0x61, 0x73, 0x63, 0x69, 0x65, 0x6e,
-  0x63, 0x69, 0x61, 0x73, 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x6f, 0x76,
-  0x65, 0x72, 0x73, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65,
-  0x74, 0x61, 0x65, 0x73, 0x74, 0x75, 0x64, 0x69, 0x6f, 0x73, 0x70, 0xc3, 0xba,
-  0x62, 0x6c, 0x69, 0x63, 0x61, 0x6f, 0x62, 0x6a, 0x65, 0x74, 0x69, 0x76, 0x6f,
-  0x61, 0x6c, 0x69, 0x63, 0x61, 0x6e, 0x74, 0x65, 0x62, 0x75, 0x73, 0x63, 0x61,
-  0x64, 0x6f, 0x72, 0x63, 0x61, 0x6e, 0x74, 0x69, 0x64, 0x61, 0x64, 0x65, 0x6e,
-  0x74, 0x72, 0x61, 0x64, 0x61, 0x73, 0x61, 0x63, 0x63, 0x69, 0x6f, 0x6e, 0x65,
-  0x73, 0x61, 0x72, 0x63, 0x68, 0x69, 0x76, 0x6f, 0x73, 0x73, 0x75, 0x70, 0x65,
-  0x72, 0x69, 0x6f, 0x72, 0x6d, 0x61, 0x79, 0x6f, 0x72, 0xc3, 0xad, 0x61, 0x61,
-  0x6c, 0x65, 0x6d, 0x61, 0x6e, 0x69, 0x61, 0x66, 0x75, 0x6e, 0x63, 0x69, 0xc3,
-  0xb3, 0x6e, 0xc3, 0xba, 0x6c, 0x74, 0x69, 0x6d, 0x6f, 0x73, 0x68, 0x61, 0x63,
-  0x69, 0x65, 0x6e, 0x64, 0x6f, 0x61, 0x71, 0x75, 0x65, 0x6c, 0x6c, 0x6f, 0x73,
-  0x65, 0x64, 0x69, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x66, 0x65, 0x72, 0x6e, 0x61,
-  0x6e, 0x64, 0x6f, 0x61, 0x6d, 0x62, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x66, 0x61,
-  0x63, 0x65, 0x62, 0x6f, 0x6f, 0x6b, 0x6e, 0x75, 0x65, 0x73, 0x74, 0x72, 0x61,
-  0x73, 0x63, 0x6c, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x73, 0x70, 0x72, 0x6f, 0x63,
-  0x65, 0x73, 0x6f, 0x73, 0x62, 0x61, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x65, 0x70,
-  0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x65, 0x70, 0x6f, 0x72, 0x74,
-  0x61, 0x72, 0x63, 0x6f, 0x6e, 0x67, 0x72, 0x65, 0x73, 0x6f, 0x70, 0x75, 0x62,
-  0x6c, 0x69, 0x63, 0x61, 0x72, 0x63, 0x6f, 0x6d, 0x65, 0x72, 0x63, 0x69, 0x6f,
-  0x63, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x74, 0x6f, 0x6a, 0xc3, 0xb3, 0x76, 0x65,
-  0x6e, 0x65, 0x73, 0x64, 0x69, 0x73, 0x74, 0x72, 0x69, 0x74, 0x6f, 0x74, 0xc3,
-  0xa9, 0x63, 0x6e, 0x69, 0x63, 0x61, 0x63, 0x6f, 0x6e, 0x6a, 0x75, 0x6e, 0x74,
-  0x6f, 0x65, 0x6e, 0x65, 0x72, 0x67, 0xc3, 0xad, 0x61, 0x74, 0x72, 0x61, 0x62,
-  0x61, 0x6a, 0x61, 0x72, 0x61, 0x73, 0x74, 0x75, 0x72, 0x69, 0x61, 0x73, 0x72,
-  0x65, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x75, 0x74, 0x69, 0x6c, 0x69, 0x7a,
-  0x61, 0x72, 0x62, 0x6f, 0x6c, 0x65, 0x74, 0xc3, 0xad, 0x6e, 0x73, 0x61, 0x6c,
-  0x76, 0x61, 0x64, 0x6f, 0x72, 0x63, 0x6f, 0x72, 0x72, 0x65, 0x63, 0x74, 0x61,
-  0x74, 0x72, 0x61, 0x62, 0x61, 0x6a, 0x6f, 0x73, 0x70, 0x72, 0x69, 0x6d, 0x65,
-  0x72, 0x6f, 0x73, 0x6e, 0x65, 0x67, 0x6f, 0x63, 0x69, 0x6f, 0x73, 0x6c, 0x69,
-  0x62, 0x65, 0x72, 0x74, 0x61, 0x64, 0x64, 0x65, 0x74, 0x61, 0x6c, 0x6c, 0x65,
-  0x73, 0x70, 0x61, 0x6e, 0x74, 0x61, 0x6c, 0x6c, 0x61, 0x70, 0x72, 0xc3, 0xb3,
-  0x78, 0x69, 0x6d, 0x6f, 0x61, 0x6c, 0x6d, 0x65, 0x72, 0xc3, 0xad, 0x61, 0x61,
-  0x6e, 0x69, 0x6d, 0x61, 0x6c, 0x65, 0x73, 0x71, 0x75, 0x69, 0xc3, 0xa9, 0x6e,
-  0x65, 0x73, 0x63, 0x6f, 0x72, 0x61, 0x7a, 0xc3, 0xb3, 0x6e, 0x73, 0x65, 0x63,
-  0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x62, 0x75, 0x73, 0x63, 0x61, 0x6e, 0x64, 0x6f,
-  0x6f, 0x70, 0x63, 0x69, 0x6f, 0x6e, 0x65, 0x73, 0x65, 0x78, 0x74, 0x65, 0x72,
-  0x69, 0x6f, 0x72, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x70, 0x74, 0x6f, 0x74, 0x6f,
-  0x64, 0x61, 0x76, 0xc3, 0xad, 0x61, 0x67, 0x61, 0x6c, 0x65, 0x72, 0xc3, 0xad,
-  0x61, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x69, 0x72, 0x6d, 0x65, 0x64, 0x69,
-  0x63, 0x69, 0x6e, 0x61, 0x6c, 0x69, 0x63, 0x65, 0x6e, 0x63, 0x69, 0x61, 0x63,
-  0x6f, 0x6e, 0x73, 0x75, 0x6c, 0x74, 0x61, 0x61, 0x73, 0x70, 0x65, 0x63, 0x74,
-  0x6f, 0x73, 0x63, 0x72, 0xc3, 0xad, 0x74, 0x69, 0x63, 0x61, 0x64, 0xc3, 0xb3,
-  0x6c, 0x61, 0x72, 0x65, 0x73, 0x6a, 0x75, 0x73, 0x74, 0x69, 0x63, 0x69, 0x61,
-  0x64, 0x65, 0x62, 0x65, 0x72, 0xc3, 0xa1, 0x6e, 0x70, 0x65, 0x72, 0xc3, 0xad,
-  0x6f, 0x64, 0x6f, 0x6e, 0x65, 0x63, 0x65, 0x73, 0x69, 0x74, 0x61, 0x6d, 0x61,
-  0x6e, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x70, 0x65, 0x71, 0x75, 0x65, 0xc3, 0xb1,
-  0x6f, 0x72, 0x65, 0x63, 0x69, 0x62, 0x69, 0x64, 0x61, 0x74, 0x72, 0x69, 0x62,
-  0x75, 0x6e, 0x61, 0x6c, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x69, 0x66, 0x65, 0x63,
-  0x61, 0x6e, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x61, 0x6e, 0x61, 0x72, 0x69,
-  0x61, 0x73, 0x64, 0x65, 0x73, 0x63, 0x61, 0x72, 0x67, 0x61, 0x64, 0x69, 0x76,
-  0x65, 0x72, 0x73, 0x6f, 0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x6f, 0x72, 0x63, 0x61,
-  0x72, 0x65, 0x71, 0x75, 0x69, 0x65, 0x72, 0x65, 0x74, 0xc3, 0xa9, 0x63, 0x6e,
-  0x69, 0x63, 0x6f, 0x64, 0x65, 0x62, 0x65, 0x72, 0xc3, 0xad, 0x61, 0x76, 0x69,
-  0x76, 0x69, 0x65, 0x6e, 0x64, 0x61, 0x66, 0x69, 0x6e, 0x61, 0x6e, 0x7a, 0x61,
-  0x73, 0x61, 0x64, 0x65, 0x6c, 0x61, 0x6e, 0x74, 0x65, 0x66, 0x75, 0x6e, 0x63,
-  0x69, 0x6f, 0x6e, 0x61, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x6a, 0x6f, 0x73, 0x64,
-  0x69, 0x66, 0xc3, 0xad, 0x63, 0x69, 0x6c, 0x63, 0x69, 0x75, 0x64, 0x61, 0x64,
-  0x65, 0x73, 0x61, 0x6e, 0x74, 0x69, 0x67, 0x75, 0x61, 0x73, 0x61, 0x76, 0x61,
-  0x6e, 0x7a, 0x61, 0x64, 0x61, 0x74, 0xc3, 0xa9, 0x72, 0x6d, 0x69, 0x6e, 0x6f,
-  0x75, 0x6e, 0x69, 0x64, 0x61, 0x64, 0x65, 0x73, 0x73, 0xc3, 0xa1, 0x6e, 0x63,
-  0x68, 0x65, 0x7a, 0x63, 0x61, 0x6d, 0x70, 0x61, 0xc3, 0xb1, 0x61, 0x73, 0x6f,
-  0x66, 0x74, 0x6f, 0x6e, 0x69, 0x63, 0x72, 0x65, 0x76, 0x69, 0x73, 0x74, 0x61,
-  0x73, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x65, 0x6e, 0x65, 0x73, 0x65, 0x63, 0x74,
-  0x6f, 0x72, 0x65, 0x73, 0x6d, 0x6f, 0x6d, 0x65, 0x6e, 0x74, 0x6f, 0x73, 0x66,
-  0x61, 0x63, 0x75, 0x6c, 0x74, 0x61, 0x64, 0x63, 0x72, 0xc3, 0xa9, 0x64, 0x69,
-  0x74, 0x6f, 0x64, 0x69, 0x76, 0x65, 0x72, 0x73, 0x61, 0x73, 0x73, 0x75, 0x70,
-  0x75, 0x65, 0x73, 0x74, 0x6f, 0x66, 0x61, 0x63, 0x74, 0x6f, 0x72, 0x65, 0x73,
-  0x73, 0x65, 0x67, 0x75, 0x6e, 0x64, 0x6f, 0x73, 0x70, 0x65, 0x71, 0x75, 0x65,
-  0xc3, 0xb1, 0x61, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb0, 0xd0, 0xb5,
-  0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xb8, 0xd0, 0xb5, 0xd1, 0x81, 0xd1, 0x82, 0xd1,
-  0x8c, 0xd0, 0xb1, 0xd1, 0x8b, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0, 0xb1, 0xd1, 0x8b,
-  0xd1, 0x82, 0xd1, 0x8c, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0,
-  0x95, 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb3,
-  0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x8f, 0xd0, 0xb2, 0xd1,
-  0x81, 0xd0, 0xb5, 0xd1, 0x85, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb9,
-  0xd0, 0xb4, 0xd0, 0xb0, 0xd0, 0xb6, 0xd0, 0xb5, 0xd0, 0xb1, 0xd1, 0x8b, 0xd0,
-  0xbb, 0xd0, 0xb8, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xb4, 0xd1, 0x83, 0xd0, 0xb4,
-  0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x8c, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xbe, 0xd1,
-  0x82, 0xd0, 0xb1, 0xd1, 0x8b, 0xd0, 0xbb, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xb5,
-  0xd0, 0xb1, 0xd1, 0x8f, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1,
-  0x81, 0xd0, 0xb5, 0xd0, 0xb1, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xb4,
-  0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xb0, 0xd0, 0xb9, 0xd1, 0x82, 0xd1, 0x84, 0xd0,
-  0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xbe,
-  0xd1, 0x81, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xb2, 0xd0,
-  0xbe, 0xd0, 0xb9, 0xd0, 0xb8, 0xd0, 0xb3, 0xd1, 0x80, 0xd1, 0x8b, 0xd1, 0x82,
-  0xd0, 0xbe, 0xd0, 0xb6, 0xd0, 0xb5, 0xd0, 0xb2, 0xd1, 0x81, 0xd0, 0xb5, 0xd0,
-  0xbc, 0xd1, 0x81, 0xd0, 0xb2, 0xd0, 0xbe, 0xd1, 0x8e, 0xd0, 0xbb, 0xd0, 0xb8,
-  0xd1, 0x88, 0xd1, 0x8c, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xb8, 0xd1, 0x85, 0xd0,
-  0xbf, 0xd0, 0xbe, 0xd0, 0xba, 0xd0, 0xb0, 0xd0, 0xb4, 0xd0, 0xbd, 0xd0, 0xb5,
-  0xd0, 0xb9, 0xd0, 0xb4, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xb0, 0xd0, 0xbc, 0xd0,
-  0xb8, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbb, 0xd0, 0xb8, 0xd0, 0xb1, 0xd0, 0xbe,
-  0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbc, 0xd1, 0x83, 0xd1, 0x85, 0xd0, 0xbe, 0xd1,
-  0x82, 0xd1, 0x8f, 0xd0, 0xb4, 0xd0, 0xb2, 0xd1, 0x83, 0xd1, 0x85, 0xd1, 0x81,
-  0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xbb, 0xd1, 0x8e, 0xd0, 0xb4, 0xd0,
-  0xb8, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xb8,
-  0xd1, 0x80, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xb1, 0xd1, 0x8f, 0xd1,
-  0x81, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xb2, 0xd0, 0xb8, 0xd0, 0xb4,
-  0xd0, 0xb5, 0xd1, 0x87, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xbe, 0xd1, 0x8d, 0xd1,
-  0x82, 0xd0, 0xb8, 0xd0, 0xbc, 0xd1, 0x81, 0xd1, 0x87, 0xd0, 0xb5, 0xd1, 0x82,
-  0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbc, 0xd1, 0x8b, 0xd1, 0x86, 0xd0, 0xb5, 0xd0,
-  0xbd, 0xd1, 0x8b, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xbb, 0xd0, 0xb2,
-  0xd0, 0xb5, 0xd0, 0xb4, 0xd1, 0x8c, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0,
-  0xb5, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb4, 0xd1, 0x8b, 0xd1, 0x82, 0xd0, 0xb5,
-  0xd0, 0xb1, 0xd0, 0xb5, 0xd0, 0xb2, 0xd1, 0x8b, 0xd1, 0x88, 0xd0, 0xb5, 0xd0,
-  0xbd, 0xd0, 0xb0, 0xd0, 0xbc, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xbf,
-  0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xbc, 0xd1, 0x83, 0xd0, 0xbf, 0xd1,
-  0x80, 0xd0, 0xb0, 0xd0, 0xb2, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x86, 0xd0, 0xb0,
-  0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0,
-  0xb4, 0xd1, 0x8b, 0xd0, 0xb7, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x8e, 0xd0, 0xbc,
-  0xd0, 0xbe, 0xd0, 0xb3, 0xd1, 0x83, 0xd0, 0xb4, 0xd1, 0x80, 0xd1, 0x83, 0xd0,
-  0xb3, 0xd0, 0xb2, 0xd1, 0x81, 0xd0, 0xb5, 0xd0, 0xb9, 0xd0, 0xb8, 0xd0, 0xb4,
-  0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xba, 0xd0, 0xb8, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0,
-  0xbe, 0xd0, 0xb4, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb,
-  0xd0, 0xb0, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xb5, 0xd1, 0x81, 0xd1,
-  0x80, 0xd0, 0xbe, 0xd0, 0xba, 0xd0, 0xb8, 0xd1, 0x8e, 0xd0, 0xbd, 0xd1, 0x8f,
-  0xd0, 0xb2, 0xd0, 0xb5, 0xd1, 0x81, 0xd1, 0x8c, 0xd0, 0x95, 0xd1, 0x81, 0xd1,
-  0x82, 0xd1, 0x8c, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb7, 0xd0, 0xb0, 0xd0, 0xbd,
-  0xd0, 0xb0, 0xd1, 0x88, 0xd0, 0xb8, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x84, 0xd9,
-  0x87, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xaa, 0xd9, 0x8a, 0xd8, 0xac, 0xd9, 0x85,
-  0xd9, 0x8a, 0xd8, 0xb9, 0xd8, 0xae, 0xd8, 0xa7, 0xd8, 0xb5, 0xd8, 0xa9, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd8, 0xb0, 0xd9, 0x8a, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x8a,
-  0xd9, 0x87, 0xd8, 0xac, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd8, 0xa2, 0xd9, 0x86, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8, 0xaf,
-  0xd8, 0xaa, 0xd8, 0xad, 0xd9, 0x83, 0xd9, 0x85, 0xd8, 0xb5, 0xd9, 0x81, 0xd8,
-  0xad, 0xd8, 0xa9, 0xd9, 0x83, 0xd8, 0xa7, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xa7,
-  0xd9, 0x84, 0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x8a, 0xd9, 0x83, 0xd9, 0x88, 0xd9,
-  0x86, 0xd8, 0xb4, 0xd8, 0xa8, 0xd9, 0x83, 0xd8, 0xa9, 0xd9, 0x81, 0xd9, 0x8a,
-  0xd9, 0x87, 0xd8, 0xa7, 0xd8, 0xa8, 0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8,
-  0xad, 0xd9, 0x88, 0xd8, 0xa7, 0xd8, 0xa1, 0xd8, 0xa3, 0xd9, 0x83, 0xd8, 0xab,
-  0xd8, 0xb1, 0xd8, 0xae, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd8, 0xad, 0xd8, 0xa8, 0xd8, 0xaf, 0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x84,
-  0xd8, 0xaf, 0xd8, 0xb1, 0xd9, 0x88, 0xd8, 0xb3, 0xd8, 0xa7, 0xd8, 0xb6, 0xd8,
-  0xba, 0xd8, 0xb7, 0xd8, 0xaa, 0xd9, 0x83, 0xd9, 0x88, 0xd9, 0x86, 0xd9, 0x87,
-  0xd9, 0x86, 0xd8, 0xa7, 0xd9, 0x83, 0xd8, 0xb3, 0xd8, 0xa7, 0xd8, 0xad, 0xd8,
-  0xa9, 0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x84,
-  0xd8, 0xb7, 0xd8, 0xa8, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x83, 0xd8,
-  0xb4, 0xd9, 0x83, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x8a, 0xd9, 0x85, 0xd9, 0x83,
-  0xd9, 0x86, 0xd9, 0x85, 0xd9, 0x86, 0xd9, 0x87, 0xd8, 0xa7, 0xd8, 0xb4, 0xd8,
-  0xb1, 0xd9, 0x83, 0xd8, 0xa9, 0xd8, 0xb1, 0xd8, 0xa6, 0xd9, 0x8a, 0xd8, 0xb3,
-  0xd9, 0x86, 0xd8, 0xb4, 0xd9, 0x8a, 0xd8, 0xb7, 0xd9, 0x85, 0xd8, 0xa7, 0xd8,
-  0xb0, 0xd8, 0xa7, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x81, 0xd9, 0x86, 0xd8, 0xb4,
-  0xd8, 0xa8, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xaa, 0xd8, 0xb9, 0xd8, 0xa8, 0xd8,
-  0xb1, 0xd8, 0xb1, 0xd8, 0xad, 0xd9, 0x85, 0xd8, 0xa9, 0xd9, 0x83, 0xd8, 0xa7,
-  0xd9, 0x81, 0xd8, 0xa9, 0xd9, 0x8a, 0xd9, 0x82, 0xd9, 0x88, 0xd9, 0x84, 0xd9,
-  0x85, 0xd8, 0xb1, 0xd9, 0x83, 0xd8, 0xb2, 0xd9, 0x83, 0xd9, 0x84, 0xd9, 0x85,
-  0xd8, 0xa9, 0xd8, 0xa3, 0xd8, 0xad, 0xd9, 0x85, 0xd8, 0xaf, 0xd9, 0x82, 0xd9,
-  0x84, 0xd8, 0xa8, 0xd9, 0x8a, 0xd9, 0x8a, 0xd8, 0xb9, 0xd9, 0x86, 0xd9, 0x8a,
-  0xd8, 0xb5, 0xd9, 0x88, 0xd8, 0xb1, 0xd8, 0xa9, 0xd8, 0xb7, 0xd8, 0xb1, 0xd9,
-  0x8a, 0xd9, 0x82, 0xd8, 0xb4, 0xd8, 0xa7, 0xd8, 0xb1, 0xd9, 0x83, 0xd8, 0xac,
-  0xd9, 0x88, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd8, 0xae, 0xd8, 0xb1, 0xd9,
-  0x89, 0xd9, 0x85, 0xd8, 0xb9, 0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xa7, 0xd8, 0xa8,
-  0xd8, 0xad, 0xd8, 0xab, 0xd8, 0xb9, 0xd8, 0xb1, 0xd9, 0x88, 0xd8, 0xb6, 0xd8,
-  0xa8, 0xd8, 0xb4, 0xd9, 0x83, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb3, 0xd8, 0xac,
-  0xd9, 0x84, 0xd8, 0xa8, 0xd9, 0x86, 0xd8, 0xa7, 0xd9, 0x86, 0xd8, 0xae, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd8, 0xaf, 0xd9, 0x83, 0xd8, 0xaa, 0xd8, 0xa7, 0xd8, 0xa8,
-  0xd9, 0x83, 0xd9, 0x84, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa8, 0xd8, 0xaf, 0xd9,
-  0x88, 0xd9, 0x86, 0xd8, 0xa3, 0xd9, 0x8a, 0xd8, 0xb6, 0xd8, 0xa7, 0xd9, 0x8a,
-  0xd9, 0x88, 0xd8, 0xac, 0xd8, 0xaf, 0xd9, 0x81, 0xd8, 0xb1, 0xd9, 0x8a, 0xd9,
-  0x82, 0xd9, 0x83, 0xd8, 0xaa, 0xd8, 0xa8, 0xd8, 0xaa, 0xd8, 0xa3, 0xd9, 0x81,
-  0xd8, 0xb6, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb7, 0xd8, 0xa8, 0xd8, 0xae, 0xd8,
-  0xa7, 0xd9, 0x83, 0xd8, 0xab, 0xd8, 0xb1, 0xd8, 0xa8, 0xd8, 0xa7, 0xd8, 0xb1,
-  0xd9, 0x83, 0xd8, 0xa7, 0xd9, 0x81, 0xd8, 0xb6, 0xd9, 0x84, 0xd8, 0xa7, 0xd8,
-  0xad, 0xd9, 0x84, 0xd9, 0x89, 0xd9, 0x86, 0xd9, 0x81, 0xd8, 0xb3, 0xd9, 0x87,
-  0xd8, 0xa3, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xb1, 0xd8, 0xaf, 0xd9,
-  0x88, 0xd8, 0xaf, 0xd8, 0xa3, 0xd9, 0x86, 0xd9, 0x87, 0xd8, 0xa7, 0xd8, 0xaf,
-  0xd9, 0x8a, 0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd9,
-  0x86, 0xd9, 0x85, 0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xb6, 0xd8, 0xaa, 0xd8, 0xb9,
-  0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xaf, 0xd8, 0xa7, 0xd8, 0xae, 0xd9, 0x84, 0xd9,
-  0x85, 0xd9, 0x85, 0xd9, 0x83, 0xd9, 0x86, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00,
-  0x00, 0x00, 0x01, 0x00, 0x01, 0x00, 0x01, 0x00, 0x01, 0x00, 0x02, 0x00, 0x02,
-  0x00, 0x02, 0x00, 0x02, 0x00, 0x04, 0x00, 0x04, 0x00, 0x04, 0x00, 0x04, 0x00,
-  0x00, 0x01, 0x02, 0x03, 0x04, 0x05, 0x06, 0x07, 0x07, 0x06, 0x05, 0x04, 0x03,
-  0x02, 0x01, 0x00, 0x08, 0x09, 0x0a, 0x0b, 0x0c, 0x0d, 0x0e, 0x0f, 0x0f, 0x0e,
-  0x0d, 0x0c, 0x0b, 0x0a, 0x09, 0x08, 0x10, 0x11, 0x12, 0x13, 0x14, 0x15, 0x16,
-  0x17, 0x17, 0x16, 0x15, 0x14, 0x13, 0x12, 0x11, 0x10, 0x18, 0x19, 0x1a, 0x1b,
-  0x1c, 0x1d, 0x1e, 0x1f, 0x1f, 0x1e, 0x1d, 0x1c, 0x1b, 0x1a, 0x19, 0x18, 0xff,
-  0xff, 0xff, 0xff, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0x00, 0xff, 0xff,
-  0xff, 0xff, 0x01, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00, 0x00, 0x02, 0x00, 0x00,
-  0x00, 0x01, 0x00, 0x00, 0x00, 0x01, 0x00, 0x00, 0x00, 0x03, 0x00, 0x00, 0x00,
-  0xff, 0xff, 0x00, 0x01, 0x00, 0x00, 0x00, 0x01, 0x00, 0x00, 0xff, 0xff, 0x00,
-  0x01, 0x00, 0x00, 0x00, 0x08, 0x00, 0x08, 0x00, 0x08, 0x00, 0x08, 0x00, 0x00,
-  0x00, 0x01, 0x00, 0x02, 0x00, 0x03, 0x00, 0x04, 0x00, 0x05, 0x00, 0x06, 0x00,
-  0x07, 0x72, 0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x63, 0x6f, 0x75,
-  0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x71, 0x75, 0x65, 0x73, 0x74, 0x69, 0x6f,
-  0x6e, 0x73, 0x65, 0x71, 0x75, 0x69, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x63, 0x6f,
-  0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x74, 0x79, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61,
-  0x62, 0x6c, 0x65, 0x68, 0x69, 0x67, 0x68, 0x6c, 0x69, 0x67, 0x68, 0x74, 0x44,
-  0x54, 0x44, 0x2f, 0x78, 0x68, 0x74, 0x6d, 0x6c, 0x6d, 0x61, 0x72, 0x6b, 0x65,
-  0x74, 0x69, 0x6e, 0x67, 0x6b, 0x6e, 0x6f, 0x77, 0x6c, 0x65, 0x64, 0x67, 0x65,
-  0x73, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x69, 0x6e, 0x67, 0x63, 0x6f, 0x6e, 0x74,
-  0x61, 0x69, 0x6e, 0x65, 0x72, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x69, 0x6f,
-  0x6e, 0x73, 0x75, 0x62, 0x73, 0x63, 0x72, 0x69, 0x62, 0x65, 0x61, 0x64, 0x76,
-  0x65, 0x72, 0x74, 0x69, 0x73, 0x65, 0x63, 0x68, 0x61, 0x72, 0x61, 0x63, 0x74,
-  0x65, 0x72, 0x22, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x3c, 0x2f,
-  0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x3e, 0x41, 0x75, 0x73, 0x74, 0x72, 0x61,
-  0x6c, 0x69, 0x61, 0x22, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x73,
-  0x69, 0x74, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x75, 0x74, 0x68, 0x6f,
-  0x72, 0x69, 0x74, 0x79, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x67,
-  0x70, 0x72, 0x69, 0x6d, 0x61, 0x72, 0x69, 0x6c, 0x79, 0x6f, 0x70, 0x65, 0x72,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x68, 0x61, 0x6c, 0x6c, 0x65, 0x6e, 0x67,
-  0x65, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x65, 0x64, 0x61, 0x6e, 0x6f,
-  0x6e, 0x79, 0x6d, 0x6f, 0x75, 0x73, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f,
-  0x6e, 0x20, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x63, 0x6f,
-  0x6d, 0x70, 0x61, 0x6e, 0x69, 0x65, 0x73, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74,
-  0x75, 0x72, 0x65, 0x61, 0x67, 0x72, 0x65, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x22,
-  0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3d, 0x22, 0x70, 0x6f, 0x74, 0x65, 0x6e,
-  0x74, 0x69, 0x61, 0x6c, 0x65, 0x64, 0x75, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x61, 0x72, 0x67, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x73, 0x65, 0x63, 0x6f,
-  0x6e, 0x64, 0x61, 0x72, 0x79, 0x63, 0x6f, 0x70, 0x79, 0x72, 0x69, 0x67, 0x68,
-  0x74, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x73, 0x65, 0x78, 0x63,
-  0x6c, 0x75, 0x73, 0x69, 0x76, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69,
-  0x6f, 0x6e, 0x3c, 0x2f, 0x66, 0x6f, 0x72, 0x6d, 0x3e, 0x0d, 0x0a, 0x73, 0x74,
-  0x61, 0x74, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x74, 0x65, 0x6e, 0x74,
-  0x69, 0x6f, 0x6e, 0x42, 0x69, 0x6f, 0x67, 0x72, 0x61, 0x70, 0x68, 0x79, 0x7d,
-  0x20, 0x65, 0x6c, 0x73, 0x65, 0x20, 0x7b, 0x0a, 0x73, 0x6f, 0x6c, 0x75, 0x74,
-  0x69, 0x6f, 0x6e, 0x73, 0x77, 0x68, 0x65, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x41, 0x6e, 0x61, 0x6c, 0x79, 0x74, 0x69, 0x63, 0x73, 0x74, 0x65, 0x6d, 0x70,
-  0x6c, 0x61, 0x74, 0x65, 0x73, 0x64, 0x61, 0x6e, 0x67, 0x65, 0x72, 0x6f, 0x75,
-  0x73, 0x73, 0x61, 0x74, 0x65, 0x6c, 0x6c, 0x69, 0x74, 0x65, 0x64, 0x6f, 0x63,
-  0x75, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x73, 0x68,
-  0x65, 0x72, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x70, 0x72,
-  0x6f, 0x74, 0x6f, 0x74, 0x79, 0x70, 0x65, 0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65,
-  0x6e, 0x63, 0x65, 0x26, 0x72, 0x61, 0x71, 0x75, 0x6f, 0x3b, 0x3c, 0x2f, 0x65,
-  0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x67, 0x65, 0x6e, 0x65, 0x72,
-  0x61, 0x6c, 0x6c, 0x79, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x66, 0x6f, 0x72, 0x6d,
-  0x62, 0x65, 0x61, 0x75, 0x74, 0x69, 0x66, 0x75, 0x6c, 0x74, 0x72, 0x61, 0x6e,
-  0x73, 0x70, 0x6f, 0x72, 0x74, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x65,
-  0x64, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x64, 0x70, 0x72, 0x6f,
-  0x6d, 0x69, 0x6e, 0x65, 0x6e, 0x74, 0x75, 0x6e, 0x74, 0x69, 0x6c, 0x20, 0x74,
-  0x68, 0x65, 0x74, 0x68, 0x75, 0x6d, 0x62, 0x6e, 0x61, 0x69, 0x6c, 0x4e, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x2e, 0x66, 0x6f, 0x63, 0x75, 0x73,
-  0x28, 0x29, 0x3b, 0x6f, 0x76, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d,
-  0x69, 0x67, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6e, 0x6e, 0x6f, 0x75,
-  0x6e, 0x63, 0x65, 0x64, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x22, 0x3e, 0x0a,
-  0x65, 0x78, 0x63, 0x65, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x6c, 0x65, 0x73, 0x73,
-  0x20, 0x74, 0x68, 0x61, 0x6e, 0x65, 0x78, 0x70, 0x65, 0x6e, 0x73, 0x69, 0x76,
-  0x65, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x72, 0x61,
-  0x6d, 0x65, 0x77, 0x6f, 0x72, 0x6b, 0x74, 0x65, 0x72, 0x72, 0x69, 0x74, 0x6f,
-  0x72, 0x79, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x75,
-  0x72, 0x72, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x4e,
-  0x61, 0x6d, 0x65, 0x63, 0x72, 0x69, 0x74, 0x69, 0x63, 0x69, 0x73, 0x6d, 0x74,
-  0x72, 0x61, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x65, 0x6c, 0x73, 0x65, 0x77,
-  0x68, 0x65, 0x72, 0x65, 0x41, 0x6c, 0x65, 0x78, 0x61, 0x6e, 0x64, 0x65, 0x72,
-  0x61, 0x70, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x65, 0x64, 0x6d, 0x61, 0x74, 0x65,
-  0x72, 0x69, 0x61, 0x6c, 0x73, 0x62, 0x72, 0x6f, 0x61, 0x64, 0x63, 0x61, 0x73,
-  0x74, 0x6d, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x65, 0x64, 0x61, 0x66, 0x66,
-  0x69, 0x6c, 0x69, 0x61, 0x74, 0x65, 0x3c, 0x2f, 0x6f, 0x70, 0x74, 0x69, 0x6f,
-  0x6e, 0x3e, 0x74, 0x72, 0x65, 0x61, 0x74, 0x6d, 0x65, 0x6e, 0x74, 0x64, 0x69,
-  0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x2f, 0x64, 0x65, 0x66, 0x61, 0x75,
-  0x6c, 0x74, 0x2e, 0x50, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x6f,
-  0x6e, 0x63, 0x6c, 0x69, 0x63, 0x6b, 0x3d, 0x22, 0x62, 0x69, 0x6f, 0x67, 0x72,
-  0x61, 0x70, 0x68, 0x79, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x77, 0x69, 0x73, 0x65,
-  0x70, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x65, 0x6e, 0x74, 0x46, 0x72, 0x61, 0x6e,
-  0xc3, 0xa7, 0x61, 0x69, 0x73, 0x48, 0x6f, 0x6c, 0x6c, 0x79, 0x77, 0x6f, 0x6f,
-  0x64, 0x65, 0x78, 0x70, 0x61, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x61,
-  0x6e, 0x64, 0x61, 0x72, 0x64, 0x73, 0x3c, 0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65,
-  0x3e, 0x0a, 0x72, 0x65, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x65,
-  0x63, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x20, 0x70, 0x72, 0x65, 0x66, 0x65, 0x72,
-  0x72, 0x65, 0x64, 0x43, 0x61, 0x6d, 0x62, 0x72, 0x69, 0x64, 0x67, 0x65, 0x6f,
-  0x70, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x73, 0x42, 0x75, 0x73, 0x69, 0x6e,
-  0x65, 0x73, 0x73, 0x20, 0x63, 0x6f, 0x6e, 0x66, 0x75, 0x73, 0x69, 0x6f, 0x6e,
-  0x3e, 0x0a, 0x3c, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3e, 0x70, 0x72, 0x65, 0x73,
-  0x65, 0x6e, 0x74, 0x65, 0x64, 0x65, 0x78, 0x70, 0x6c, 0x61, 0x69, 0x6e, 0x65,
-  0x64, 0x64, 0x6f, 0x65, 0x73, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x77, 0x6f, 0x72,
-  0x6c, 0x64, 0x77, 0x69, 0x64, 0x65, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x66, 0x61,
-  0x63, 0x65, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x6e, 0x65,
-  0x77, 0x73, 0x70, 0x61, 0x70, 0x65, 0x72, 0x3c, 0x2f, 0x74, 0x61, 0x62, 0x6c,
-  0x65, 0x3e, 0x0a, 0x6d, 0x6f, 0x75, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x73, 0x6c,
-  0x69, 0x6b, 0x65, 0x20, 0x74, 0x68, 0x65, 0x20, 0x65, 0x73, 0x73, 0x65, 0x6e,
-  0x74, 0x69, 0x61, 0x6c, 0x66, 0x69, 0x6e, 0x61, 0x6e, 0x63, 0x69, 0x61, 0x6c,
-  0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x63, 0x74, 0x69,
-  0x6f, 0x6e, 0x3d, 0x22, 0x2f, 0x61, 0x62, 0x61, 0x6e, 0x64, 0x6f, 0x6e, 0x65,
-  0x64, 0x45, 0x64, 0x75, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x61, 0x72,
-  0x73, 0x65, 0x49, 0x6e, 0x74, 0x28, 0x73, 0x74, 0x61, 0x62, 0x69, 0x6c, 0x69,
-  0x74, 0x79, 0x75, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f, 0x3c, 0x2f,
-  0x74, 0x69, 0x74, 0x6c, 0x65, 0x3e, 0x0a, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x73, 0x4e, 0x6f, 0x74, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x65,
-  0x66, 0x66, 0x69, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x70, 0x65, 0x72, 0x66, 0x6f,
-  0x72, 0x6d, 0x65, 0x64, 0x74, 0x77, 0x6f, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73,
-  0x53, 0x69, 0x6e, 0x63, 0x65, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x72,
-  0x65, 0x66, 0x6f, 0x72, 0x65, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x22,
-  0x3e, 0x61, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x65, 0x69, 0x6e, 0x63,
-  0x72, 0x65, 0x61, 0x73, 0x65, 0x64, 0x42, 0x61, 0x74, 0x74, 0x6c, 0x65, 0x20,
-  0x6f, 0x66, 0x70, 0x65, 0x72, 0x63, 0x65, 0x69, 0x76, 0x65, 0x64, 0x74, 0x72,
-  0x79, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x6e, 0x65, 0x63, 0x65, 0x73, 0x73,
-  0x61, 0x72, 0x79, 0x70, 0x6f, 0x72, 0x74, 0x72, 0x61, 0x79, 0x65, 0x64, 0x65,
-  0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x45, 0x6c, 0x69, 0x7a, 0x61,
-  0x62, 0x65, 0x74, 0x68, 0x3c, 0x2f, 0x69, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x3e,
-  0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x79, 0x69, 0x6e, 0x73, 0x75,
-  0x72, 0x61, 0x6e, 0x63, 0x65, 0x73, 0x2e, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68,
-  0x3b, 0x6c, 0x65, 0x67, 0x65, 0x6e, 0x64, 0x61, 0x72, 0x79, 0x47, 0x65, 0x6f,
-  0x67, 0x72, 0x61, 0x70, 0x68, 0x79, 0x63, 0x61, 0x6e, 0x64, 0x69, 0x64, 0x61,
-  0x74, 0x65, 0x63, 0x6f, 0x72, 0x70, 0x6f, 0x72, 0x61, 0x74, 0x65, 0x73, 0x6f,
-  0x6d, 0x65, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x73, 0x65, 0x72, 0x76, 0x69, 0x63,
-  0x65, 0x73, 0x2e, 0x69, 0x6e, 0x68, 0x65, 0x72, 0x69, 0x74, 0x65, 0x64, 0x3c,
-  0x2f, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x67, 0x3e, 0x43, 0x6f, 0x6d, 0x6d, 0x75,
-  0x6e, 0x69, 0x74, 0x79, 0x72, 0x65, 0x6c, 0x69, 0x67, 0x69, 0x6f, 0x75, 0x73,
-  0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x43, 0x6f, 0x6d, 0x6d,
-  0x69, 0x74, 0x74, 0x65, 0x65, 0x62, 0x75, 0x69, 0x6c, 0x64, 0x69, 0x6e, 0x67,
-  0x73, 0x74, 0x68, 0x65, 0x20, 0x77, 0x6f, 0x72, 0x6c, 0x64, 0x6e, 0x6f, 0x20,
-  0x6c, 0x6f, 0x6e, 0x67, 0x65, 0x72, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x6e, 0x69,
-  0x6e, 0x67, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x63, 0x61,
-  0x6e, 0x6e, 0x6f, 0x74, 0x20, 0x62, 0x65, 0x66, 0x72, 0x65, 0x71, 0x75, 0x65,
-  0x6e, 0x63, 0x79, 0x74, 0x79, 0x70, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x69,
-  0x6e, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x72, 0x65, 0x6c, 0x61, 0x74,
-  0x69, 0x76, 0x65, 0x3b, 0x72, 0x65, 0x63, 0x6f, 0x72, 0x64, 0x69, 0x6e, 0x67,
-  0x70, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x6e, 0x69, 0x74,
-  0x69, 0x61, 0x6c, 0x6c, 0x79, 0x74, 0x65, 0x63, 0x68, 0x6e, 0x69, 0x71, 0x75,
-  0x65, 0x74, 0x68, 0x65, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x69, 0x74, 0x20,
-  0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x65, 0x78, 0x69, 0x73, 0x74, 0x65, 0x6e,
-  0x63, 0x65, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x6c, 0x69, 0x6e, 0x65, 0x74, 0x68,
-  0x69, 0x73, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x74, 0x65, 0x6c, 0x65, 0x70, 0x68,
-  0x6f, 0x6e, 0x65, 0x69, 0x74, 0x65, 0x6d, 0x73, 0x63, 0x6f, 0x70, 0x65, 0x70,
-  0x72, 0x61, 0x63, 0x74, 0x69, 0x63, 0x65, 0x73, 0x61, 0x64, 0x76, 0x61, 0x6e,
-  0x74, 0x61, 0x67, 0x65, 0x29, 0x3b, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20,
-  0x46, 0x6f, 0x72, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x70, 0x72, 0x6f, 0x76,
-  0x69, 0x64, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x6d, 0x6f, 0x63, 0x72, 0x61, 0x63,
-  0x79, 0x62, 0x6f, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x20, 0x65, 0x78, 0x74,
-  0x65, 0x6e, 0x73, 0x69, 0x76, 0x65, 0x73, 0x75, 0x66, 0x66, 0x65, 0x72, 0x69,
-  0x6e, 0x67, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x64, 0x63, 0x6f,
-  0x6d, 0x70, 0x75, 0x74, 0x65, 0x72, 0x73, 0x20, 0x66, 0x75, 0x6e, 0x63, 0x74,
-  0x69, 0x6f, 0x6e, 0x70, 0x72, 0x61, 0x63, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x73,
-  0x61, 0x69, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x74, 0x20, 0x6d, 0x61,
-  0x79, 0x20, 0x62, 0x65, 0x45, 0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68, 0x3c, 0x2f,
-  0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x63, 0x68, 0x65,
-  0x64, 0x75, 0x6c, 0x65, 0x64, 0x64, 0x6f, 0x77, 0x6e, 0x6c, 0x6f, 0x61, 0x64,
-  0x73, 0x3c, 0x2f, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x3e, 0x0a, 0x73, 0x75, 0x73,
-  0x70, 0x65, 0x63, 0x74, 0x65, 0x64, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x3a,
-  0x20, 0x30, 0x73, 0x70, 0x69, 0x72, 0x69, 0x74, 0x75, 0x61, 0x6c, 0x3c, 0x2f,
-  0x68, 0x65, 0x61, 0x64, 0x3e, 0x0a, 0x0a, 0x6d, 0x69, 0x63, 0x72, 0x6f, 0x73,
-  0x6f, 0x66, 0x74, 0x67, 0x72, 0x61, 0x64, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x64,
-  0x69, 0x73, 0x63, 0x75, 0x73, 0x73, 0x65, 0x64, 0x68, 0x65, 0x20, 0x62, 0x65,
-  0x63, 0x61, 0x6d, 0x65, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x76, 0x65,
-  0x6a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x2e, 0x6a, 0x73, 0x68, 0x6f, 0x75, 0x73,
-  0x65, 0x68, 0x6f, 0x6c, 0x64, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x72, 0x6d, 0x65,
-  0x64, 0x70, 0x75, 0x72, 0x63, 0x68, 0x61, 0x73, 0x65, 0x64, 0x6c, 0x69, 0x74,
-  0x65, 0x72, 0x61, 0x6c, 0x6c, 0x79, 0x64, 0x65, 0x73, 0x74, 0x72, 0x6f, 0x79,
-  0x65, 0x64, 0x75, 0x70, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x76, 0x61,
-  0x72, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x6d, 0x61, 0x69, 0x6e,
-  0x69, 0x6e, 0x67, 0x69, 0x74, 0x20, 0x69, 0x73, 0x20, 0x6e, 0x6f, 0x74, 0x63,
-  0x65, 0x6e, 0x74, 0x75, 0x72, 0x69, 0x65, 0x73, 0x4a, 0x61, 0x70, 0x61, 0x6e,
-  0x65, 0x73, 0x65, 0x20, 0x61, 0x6d, 0x6f, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65,
-  0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x65, 0x64, 0x61, 0x6c, 0x67, 0x6f,
-  0x72, 0x69, 0x74, 0x68, 0x6d, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x74,
-  0x73, 0x72, 0x65, 0x62, 0x65, 0x6c, 0x6c, 0x69, 0x6f, 0x6e, 0x75, 0x6e, 0x64,
-  0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x65, 0x6e, 0x63, 0x6f, 0x75, 0x72, 0x61,
-  0x67, 0x65, 0x72, 0x65, 0x73, 0x69, 0x7a, 0x61, 0x62, 0x6c, 0x65, 0x69, 0x6e,
-  0x76, 0x6f, 0x6c, 0x76, 0x69, 0x6e, 0x67, 0x73, 0x65, 0x6e, 0x73, 0x69, 0x74,
-  0x69, 0x76, 0x65, 0x75, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x61, 0x6c, 0x70,
-  0x72, 0x6f, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x28, 0x61, 0x6c, 0x74, 0x68,
-  0x6f, 0x75, 0x67, 0x68, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x69, 0x6e, 0x67,
-  0x63, 0x6f, 0x6e, 0x64, 0x75, 0x63, 0x74, 0x65, 0x64, 0x29, 0x2c, 0x20, 0x77,
-  0x68, 0x69, 0x63, 0x68, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75, 0x65,
-  0x64, 0x2d, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x22, 0x3e, 0x46, 0x65, 0x62,
-  0x72, 0x75, 0x61, 0x72, 0x79, 0x20, 0x6e, 0x75, 0x6d, 0x65, 0x72, 0x6f, 0x75,
-  0x73, 0x20, 0x6f, 0x76, 0x65, 0x72, 0x66, 0x6c, 0x6f, 0x77, 0x3a, 0x63, 0x6f,
-  0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x66, 0x72, 0x61, 0x67, 0x6d, 0x65,
-  0x6e, 0x74, 0x73, 0x65, 0x78, 0x63, 0x65, 0x6c, 0x6c, 0x65, 0x6e, 0x74, 0x63,
-  0x6f, 0x6c, 0x73, 0x70, 0x61, 0x6e, 0x3d, 0x22, 0x74, 0x65, 0x63, 0x68, 0x6e,
-  0x69, 0x63, 0x61, 0x6c, 0x6e, 0x65, 0x61, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x41, 0x64, 0x76, 0x61, 0x6e, 0x63, 0x65, 0x64, 0x20, 0x73, 0x6f, 0x75, 0x72,
-  0x63, 0x65, 0x20, 0x6f, 0x66, 0x65, 0x78, 0x70, 0x72, 0x65, 0x73, 0x73, 0x65,
-  0x64, 0x48, 0x6f, 0x6e, 0x67, 0x20, 0x4b, 0x6f, 0x6e, 0x67, 0x20, 0x46, 0x61,
-  0x63, 0x65, 0x62, 0x6f, 0x6f, 0x6b, 0x6d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c,
-  0x65, 0x20, 0x6d, 0x65, 0x63, 0x68, 0x61, 0x6e, 0x69, 0x73, 0x6d, 0x65, 0x6c,
-  0x65, 0x76, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x66, 0x66, 0x65, 0x6e, 0x73,
-  0x69, 0x76, 0x65, 0x3c, 0x2f, 0x66, 0x6f, 0x72, 0x6d, 0x3e, 0x0a, 0x09, 0x73,
-  0x70, 0x6f, 0x6e, 0x73, 0x6f, 0x72, 0x65, 0x64, 0x64, 0x6f, 0x63, 0x75, 0x6d,
-  0x65, 0x6e, 0x74, 0x2e, 0x6f, 0x72, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b,
-  0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x61, 0x72, 0x65, 0x74, 0x68, 0x6f, 0x73,
-  0x65, 0x20, 0x77, 0x68, 0x6f, 0x6d, 0x6f, 0x76, 0x65, 0x6d, 0x65, 0x6e, 0x74,
-  0x73, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x73, 0x73, 0x65, 0x73, 0x64, 0x69, 0x66,
-  0x66, 0x69, 0x63, 0x75, 0x6c, 0x74, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x74,
-  0x65, 0x64, 0x72, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x64, 0x63, 0x6f,
-  0x6e, 0x76, 0x69, 0x6e, 0x63, 0x65, 0x64, 0x70, 0x72, 0x6f, 0x6d, 0x6f, 0x74,
-  0x69, 0x6e, 0x67, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x2e,
-  0x72, 0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x28, 0x63, 0x6c, 0x61, 0x73, 0x73,
-  0x69, 0x63, 0x61, 0x6c, 0x63, 0x6f, 0x61, 0x6c, 0x69, 0x74, 0x69, 0x6f, 0x6e,
-  0x68, 0x69, 0x73, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x64, 0x65, 0x63, 0x69,
-  0x73, 0x69, 0x6f, 0x6e, 0x73, 0x61, 0x73, 0x73, 0x69, 0x73, 0x74, 0x61, 0x6e,
-  0x74, 0x69, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x64, 0x65, 0x76, 0x6f,
-  0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x2d, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65,
-  0x72, 0x22, 0x65, 0x6e, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x74, 0x6f, 0x61, 0x6c,
-  0x6f, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x64, 0x65, 0x6c, 0x69, 0x76, 0x65,
-  0x72, 0x65, 0x64, 0x2d, 0x2d, 0x3e, 0x0d, 0x0a, 0x3c, 0x21, 0x2d, 0x2d, 0x41,
-  0x6d, 0x65, 0x72, 0x69, 0x63, 0x61, 0x6e, 0x20, 0x70, 0x72, 0x6f, 0x74, 0x65,
-  0x63, 0x74, 0x65, 0x64, 0x4e, 0x6f, 0x76, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x20,
-  0x3c, 0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3e, 0x3c, 0x66, 0x75, 0x72, 0x6e,
-  0x69, 0x74, 0x75, 0x72, 0x65, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x65, 0x74,
-  0x20, 0x20, 0x6f, 0x6e, 0x62, 0x6c, 0x75, 0x72, 0x3d, 0x22, 0x73, 0x75, 0x73,
-  0x70, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x72, 0x65, 0x63, 0x69, 0x70, 0x69, 0x65,
-  0x6e, 0x74, 0x62, 0x61, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x6e, 0x20, 0x4d, 0x6f,
-  0x72, 0x65, 0x6f, 0x76, 0x65, 0x72, 0x2c, 0x61, 0x62, 0x6f, 0x6c, 0x69, 0x73,
-  0x68, 0x65, 0x64, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x77,
-  0x65, 0x72, 0x65, 0x20, 0x6d, 0x61, 0x64, 0x65, 0x65, 0x6d, 0x6f, 0x74, 0x69,
-  0x6f, 0x6e, 0x61, 0x6c, 0x65, 0x6d, 0x65, 0x72, 0x67, 0x65, 0x6e, 0x63, 0x79,
-  0x6e, 0x61, 0x72, 0x72, 0x61, 0x74, 0x69, 0x76, 0x65, 0x61, 0x64, 0x76, 0x6f,
-  0x63, 0x61, 0x74, 0x65, 0x73, 0x70, 0x78, 0x3b, 0x62, 0x6f, 0x72, 0x64, 0x65,
-  0x72, 0x63, 0x6f, 0x6d, 0x6d, 0x69, 0x74, 0x74, 0x65, 0x64, 0x64, 0x69, 0x72,
-  0x3d, 0x22, 0x6c, 0x74, 0x72, 0x22, 0x65, 0x6d, 0x70, 0x6c, 0x6f, 0x79, 0x65,
-  0x65, 0x73, 0x72, 0x65, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x2e, 0x20, 0x73,
-  0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73,
-  0x73, 0x6f, 0x72, 0x63, 0x75, 0x73, 0x74, 0x6f, 0x6d, 0x65, 0x72, 0x73, 0x64,
-  0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x65, 0x64, 0x53, 0x65, 0x70, 0x74, 0x65,
-  0x6d, 0x62, 0x65, 0x72, 0x61, 0x64, 0x64, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x28,
-  0x46, 0x61, 0x63, 0x65, 0x62, 0x6f, 0x6f, 0x6b, 0x20, 0x73, 0x75, 0x67, 0x67,
-  0x65, 0x73, 0x74, 0x65, 0x64, 0x61, 0x6e, 0x64, 0x20, 0x6c, 0x61, 0x74, 0x65,
-  0x72, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x65, 0x6c, 0x61,
-  0x62, 0x6f, 0x72, 0x61, 0x74, 0x65, 0x53, 0x6f, 0x6d, 0x65, 0x74, 0x69, 0x6d,
-  0x65, 0x73, 0x49, 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x74, 0x65, 0x63, 0x65,
-  0x72, 0x74, 0x61, 0x69, 0x6e, 0x6c, 0x79, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6c,
-  0x6c, 0x65, 0x64, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x65, 0x72, 0x73, 0x4a,
-  0x65, 0x72, 0x75, 0x73, 0x61, 0x6c, 0x65, 0x6d, 0x74, 0x68, 0x65, 0x79, 0x20,
-  0x68, 0x61, 0x76, 0x65, 0x63, 0x6f, 0x6d, 0x70, 0x75, 0x74, 0x69, 0x6e, 0x67,
-  0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x70, 0x72, 0x6f, 0x76,
-  0x69, 0x6e, 0x63, 0x65, 0x73, 0x67, 0x75, 0x61, 0x72, 0x61, 0x6e, 0x74, 0x65,
-  0x65, 0x61, 0x72, 0x62, 0x69, 0x74, 0x72, 0x61, 0x72, 0x79, 0x72, 0x65, 0x63,
-  0x6f, 0x67, 0x6e, 0x69, 0x7a, 0x65, 0x77, 0x61, 0x6e, 0x74, 0x65, 0x64, 0x20,
-  0x74, 0x6f, 0x70, 0x78, 0x3b, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x74, 0x68,
-  0x65, 0x6f, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x62, 0x65, 0x68, 0x61, 0x76, 0x69,
-  0x6f, 0x75, 0x72, 0x57, 0x68, 0x69, 0x6c, 0x65, 0x20, 0x74, 0x68, 0x65, 0x65,
-  0x73, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x64, 0x62, 0x65, 0x67, 0x61, 0x6e,
-  0x20, 0x74, 0x6f, 0x20, 0x69, 0x74, 0x20, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65,
-  0x6d, 0x61, 0x67, 0x6e, 0x69, 0x74, 0x75, 0x64, 0x65, 0x6d, 0x75, 0x73, 0x74,
-  0x20, 0x68, 0x61, 0x76, 0x65, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x74, 0x68, 0x61,
-  0x6e, 0x44, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x65, 0x78, 0x74,
-  0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x63, 0x72, 0x65, 0x74, 0x61,
-  0x72, 0x79, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x61, 0x6c, 0x6c, 0x79, 0x6f, 0x63,
-  0x63, 0x75, 0x72, 0x72, 0x69, 0x6e, 0x67, 0x76, 0x61, 0x72, 0x69, 0x61, 0x62,
-  0x6c, 0x65, 0x73, 0x67, 0x69, 0x76, 0x65, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x70,
-  0x6c, 0x61, 0x74, 0x66, 0x6f, 0x72, 0x6d, 0x2e, 0x3c, 0x2f, 0x6c, 0x61, 0x62,
-  0x65, 0x6c, 0x3e, 0x3c, 0x66, 0x61, 0x69, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x6f,
-  0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x75, 0x6e, 0x64, 0x73, 0x6b, 0x69, 0x6e, 0x64,
-  0x73, 0x20, 0x6f, 0x66, 0x20, 0x73, 0x6f, 0x63, 0x69, 0x65, 0x74, 0x69, 0x65,
-  0x73, 0x61, 0x6c, 0x6f, 0x6e, 0x67, 0x73, 0x69, 0x64, 0x65, 0x20, 0x2d, 0x2d,
-  0x26, 0x67, 0x74, 0x3b, 0x0a, 0x0a, 0x73, 0x6f, 0x75, 0x74, 0x68, 0x77, 0x65,
-  0x73, 0x74, 0x74, 0x68, 0x65, 0x20, 0x72, 0x69, 0x67, 0x68, 0x74, 0x72, 0x61,
-  0x64, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6d, 0x61, 0x79, 0x20, 0x68, 0x61,
-  0x76, 0x65, 0x20, 0x75, 0x6e, 0x65, 0x73, 0x63, 0x61, 0x70, 0x65, 0x28, 0x73,
-  0x70, 0x6f, 0x6b, 0x65, 0x6e, 0x20, 0x69, 0x6e, 0x22, 0x20, 0x68, 0x72, 0x65,
-  0x66, 0x3d, 0x22, 0x2f, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x6d, 0x65,
-  0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6d, 0x65,
-  0x20, 0x66, 0x72, 0x6f, 0x6d, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72,
-  0x79, 0x62, 0x75, 0x72, 0x69, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x61, 0x20, 0x73,
-  0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x74, 0x68, 0x65, 0x79, 0x20, 0x77, 0x65,
-  0x72, 0x65, 0x3c, 0x2f, 0x66, 0x6f, 0x6e, 0x74, 0x3e, 0x3c, 0x2f, 0x4e, 0x6f,
-  0x72, 0x77, 0x65, 0x67, 0x69, 0x61, 0x6e, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66,
-  0x69, 0x65, 0x64, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x69, 0x6e, 0x67, 0x70,
-  0x61, 0x73, 0x73, 0x65, 0x6e, 0x67, 0x65, 0x72, 0x28, 0x6e, 0x65, 0x77, 0x20,
-  0x44, 0x61, 0x74, 0x65, 0x74, 0x65, 0x6d, 0x70, 0x6f, 0x72, 0x61, 0x72, 0x79,
-  0x66, 0x69, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x41, 0x66, 0x74, 0x65,
-  0x72, 0x20, 0x74, 0x68, 0x65, 0x65, 0x71, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x64, 0x6f, 0x77, 0x6e, 0x6c, 0x6f, 0x61, 0x64, 0x2e, 0x72, 0x65, 0x67,
-  0x75, 0x6c, 0x61, 0x72, 0x6c, 0x79, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70,
-  0x65, 0x72, 0x61, 0x62, 0x6f, 0x76, 0x65, 0x20, 0x74, 0x68, 0x65, 0x6c, 0x69,
-  0x6e, 0x6b, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x70, 0x68, 0x65, 0x6e, 0x6f, 0x6d,
-  0x65, 0x6e, 0x61, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x20, 0x6f, 0x66, 0x74,
-  0x6f, 0x6f, 0x6c, 0x74, 0x69, 0x70, 0x22, 0x3e, 0x73, 0x75, 0x62, 0x73, 0x74,
-  0x61, 0x6e, 0x63, 0x65, 0x61, 0x75, 0x74, 0x6f, 0x6d, 0x61, 0x74, 0x69, 0x63,
-  0x61, 0x73, 0x70, 0x65, 0x63, 0x74, 0x20, 0x6f, 0x66, 0x41, 0x6d, 0x6f, 0x6e,
-  0x67, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x65,
-  0x64, 0x65, 0x73, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x73, 0x41, 0x69, 0x72,
-  0x20, 0x46, 0x6f, 0x72, 0x63, 0x65, 0x73, 0x79, 0x73, 0x74, 0x65, 0x6d, 0x20,
-  0x6f, 0x66, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x69, 0x6d,
-  0x6d, 0x65, 0x64, 0x69, 0x61, 0x74, 0x65, 0x6d, 0x61, 0x6b, 0x69, 0x6e, 0x67,
-  0x20, 0x69, 0x74, 0x70, 0x61, 0x69, 0x6e, 0x74, 0x69, 0x6e, 0x67, 0x73, 0x63,
-  0x6f, 0x6e, 0x71, 0x75, 0x65, 0x72, 0x65, 0x64, 0x61, 0x72, 0x65, 0x20, 0x73,
-  0x74, 0x69, 0x6c, 0x6c, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x64, 0x75, 0x72, 0x65,
-  0x67, 0x72, 0x6f, 0x77, 0x74, 0x68, 0x20, 0x6f, 0x66, 0x68, 0x65, 0x61, 0x64,
-  0x65, 0x64, 0x20, 0x62, 0x79, 0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x61, 0x6e,
-  0x20, 0x64, 0x69, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x6d, 0x6f, 0x6c,
-  0x65, 0x63, 0x75, 0x6c, 0x65, 0x73, 0x66, 0x72, 0x61, 0x6e, 0x63, 0x68, 0x69,
-  0x73, 0x65, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x74,
-  0x74, 0x72, 0x61, 0x63, 0x74, 0x65, 0x64, 0x63, 0x68, 0x69, 0x6c, 0x64, 0x68,
-  0x6f, 0x6f, 0x64, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x75, 0x73, 0x65, 0x64, 0x64,
-  0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x64, 0x73, 0x69, 0x6e, 0x67, 0x61,
-  0x70, 0x6f, 0x72, 0x65, 0x64, 0x65, 0x67, 0x72, 0x65, 0x65, 0x20, 0x6f, 0x66,
-  0x66, 0x61, 0x74, 0x68, 0x65, 0x72, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x66,
-  0x6c, 0x69, 0x63, 0x74, 0x73, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x70, 0x3e,
-  0x0a, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x77, 0x65, 0x72,
-  0x65, 0x20, 0x75, 0x73, 0x65, 0x64, 0x6e, 0x6f, 0x74, 0x65, 0x20, 0x74, 0x68,
-  0x61, 0x74, 0x72, 0x65, 0x63, 0x65, 0x69, 0x76, 0x69, 0x6e, 0x67, 0x45, 0x78,
-  0x65, 0x63, 0x75, 0x74, 0x69, 0x76, 0x65, 0x65, 0x76, 0x65, 0x6e, 0x20, 0x6d,
-  0x6f, 0x72, 0x65, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x20, 0x74, 0x6f, 0x63,
-  0x6f, 0x6d, 0x6d, 0x61, 0x6e, 0x64, 0x65, 0x72, 0x50, 0x6f, 0x6c, 0x69, 0x74,
-  0x69, 0x63, 0x61, 0x6c, 0x6d, 0x75, 0x73, 0x69, 0x63, 0x69, 0x61, 0x6e, 0x73,
-  0x64, 0x65, 0x6c, 0x69, 0x63, 0x69, 0x6f, 0x75, 0x73, 0x70, 0x72, 0x69, 0x73,
-  0x6f, 0x6e, 0x65, 0x72, 0x73, 0x61, 0x64, 0x76, 0x65, 0x6e, 0x74, 0x20, 0x6f,
-  0x66, 0x55, 0x54, 0x46, 0x2d, 0x38, 0x22, 0x20, 0x2f, 0x3e, 0x3c, 0x21, 0x5b,
-  0x43, 0x44, 0x41, 0x54, 0x41, 0x5b, 0x22, 0x3e, 0x43, 0x6f, 0x6e, 0x74, 0x61,
-  0x63, 0x74, 0x53, 0x6f, 0x75, 0x74, 0x68, 0x65, 0x72, 0x6e, 0x20, 0x62, 0x67,
-  0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3d, 0x22, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73,
-  0x20, 0x6f, 0x66, 0x2e, 0x20, 0x49, 0x74, 0x20, 0x77, 0x61, 0x73, 0x20, 0x69,
-  0x6e, 0x20, 0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x70, 0x65, 0x72, 0x6d, 0x69,
-  0x74, 0x74, 0x65, 0x64, 0x76, 0x61, 0x6c, 0x69, 0x64, 0x61, 0x74, 0x65, 0x2e,
-  0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x69, 0x6e, 0x67, 0x6f, 0x66, 0x66, 0x69,
-  0x63, 0x69, 0x61, 0x6c, 0x73, 0x73, 0x65, 0x72, 0x69, 0x6f, 0x75, 0x73, 0x6c,
-  0x79, 0x2d, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x69, 0x6e, 0x69,
-  0x74, 0x69, 0x61, 0x74, 0x65, 0x64, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x64, 0x69,
-  0x6e, 0x67, 0x6c, 0x6f, 0x6e, 0x67, 0x2d, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e,
-  0x66, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x75, 0x63, 0x68, 0x20, 0x74,
-  0x68, 0x61, 0x74, 0x67, 0x65, 0x74, 0x43, 0x6f, 0x6f, 0x6b, 0x69, 0x65, 0x6d,
-  0x61, 0x72, 0x6b, 0x65, 0x64, 0x20, 0x62, 0x79, 0x3c, 0x2f, 0x62, 0x75, 0x74,
-  0x74, 0x6f, 0x6e, 0x3e, 0x69, 0x6d, 0x70, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74,
-  0x62, 0x75, 0x74, 0x20, 0x69, 0x74, 0x20, 0x69, 0x73, 0x69, 0x6e, 0x63, 0x72,
-  0x65, 0x61, 0x73, 0x65, 0x73, 0x64, 0x6f, 0x77, 0x6e, 0x20, 0x74, 0x68, 0x65,
-  0x20, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x70,
-  0x65, 0x6e, 0x64, 0x65, 0x6e, 0x74, 0x2d, 0x2d, 0x3e, 0x0a, 0x3c, 0x21, 0x2d,
-  0x2d, 0x20, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x69, 0x65, 0x77, 0x57, 0x69,
-  0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x70, 0x69, 0x65, 0x73,
-  0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x6e, 0x73, 0x75, 0x73, 0x77,
-  0x61, 0x73, 0x20, 0x62, 0x75, 0x69, 0x6c, 0x74, 0x56, 0x65, 0x6e, 0x65, 0x7a,
-  0x75, 0x65, 0x6c, 0x61, 0x28, 0x66, 0x6f, 0x72, 0x6d, 0x65, 0x72, 0x6c, 0x79,
-  0x74, 0x68, 0x65, 0x20, 0x73, 0x74, 0x61, 0x74, 0x65, 0x70, 0x65, 0x72, 0x73,
-  0x6f, 0x6e, 0x6e, 0x65, 0x6c, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x69,
-  0x63, 0x66, 0x61, 0x76, 0x6f, 0x75, 0x72, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x76,
-  0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x57, 0x69, 0x6b, 0x69, 0x70, 0x65, 0x64,
-  0x69, 0x61, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x65, 0x6e, 0x74, 0x76, 0x69,
-  0x72, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20,
-  0x77, 0x61, 0x73, 0x70, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x6c, 0x65, 0x43,
-  0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x65, 0x20, 0x69, 0x64, 0x65, 0x6e, 0x74,
-  0x69, 0x63, 0x61, 0x6c, 0x73, 0x68, 0x6f, 0x77, 0x20, 0x74, 0x68, 0x61, 0x74,
-  0x70, 0x72, 0x69, 0x6d, 0x69, 0x74, 0x69, 0x76, 0x65, 0x61, 0x77, 0x61, 0x79,
-  0x20, 0x66, 0x72, 0x6f, 0x6d, 0x6d, 0x6f, 0x6c, 0x65, 0x63, 0x75, 0x6c, 0x61,
-  0x72, 0x70, 0x72, 0x65, 0x63, 0x69, 0x73, 0x65, 0x6c, 0x79, 0x64, 0x69, 0x73,
-  0x73, 0x6f, 0x6c, 0x76, 0x65, 0x64, 0x55, 0x6e, 0x64, 0x65, 0x72, 0x20, 0x74,
-  0x68, 0x65, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x3d, 0x22, 0x3e, 0x26,
-  0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c, 0x2f, 0x49, 0x74, 0x20, 0x69, 0x73, 0x20,
-  0x74, 0x68, 0x65, 0x20, 0x54, 0x68, 0x69, 0x73, 0x20, 0x69, 0x73, 0x20, 0x77,
-  0x69, 0x6c, 0x6c, 0x20, 0x68, 0x61, 0x76, 0x65, 0x6f, 0x72, 0x67, 0x61, 0x6e,
-  0x69, 0x73, 0x6d, 0x73, 0x73, 0x6f, 0x6d, 0x65, 0x20, 0x74, 0x69, 0x6d, 0x65,
-  0x46, 0x72, 0x69, 0x65, 0x64, 0x72, 0x69, 0x63, 0x68, 0x77, 0x61, 0x73, 0x20,
-  0x66, 0x69, 0x72, 0x73, 0x74, 0x74, 0x68, 0x65, 0x20, 0x6f, 0x6e, 0x6c, 0x79,
-  0x20, 0x66, 0x61, 0x63, 0x74, 0x20, 0x74, 0x68, 0x61, 0x74, 0x66, 0x6f, 0x72,
-  0x6d, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x70, 0x72, 0x65, 0x63, 0x65, 0x64, 0x69,
-  0x6e, 0x67, 0x54, 0x65, 0x63, 0x68, 0x6e, 0x69, 0x63, 0x61, 0x6c, 0x70, 0x68,
-  0x79, 0x73, 0x69, 0x63, 0x69, 0x73, 0x74, 0x6f, 0x63, 0x63, 0x75, 0x72, 0x73,
-  0x20, 0x69, 0x6e, 0x6e, 0x61, 0x76, 0x69, 0x67, 0x61, 0x74, 0x6f, 0x72, 0x73,
-  0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x3e, 0x73, 0x70, 0x61, 0x6e, 0x20,
-  0x69, 0x64, 0x3d, 0x22, 0x73, 0x6f, 0x75, 0x67, 0x68, 0x74, 0x20, 0x74, 0x6f,
-  0x62, 0x65, 0x6c, 0x6f, 0x77, 0x20, 0x74, 0x68, 0x65, 0x73, 0x75, 0x72, 0x76,
-  0x69, 0x76, 0x69, 0x6e, 0x67, 0x7d, 0x3c, 0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65,
-  0x3e, 0x68, 0x69, 0x73, 0x20, 0x64, 0x65, 0x61, 0x74, 0x68, 0x61, 0x73, 0x20,
-  0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x64, 0x20,
-  0x62, 0x79, 0x70, 0x61, 0x72, 0x74, 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x65, 0x78,
-  0x69, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x75, 0x73, 0x69, 0x6e, 0x67, 0x20,
-  0x74, 0x68, 0x65, 0x77, 0x61, 0x73, 0x20, 0x67, 0x69, 0x76, 0x65, 0x6e, 0x61,
-  0x20, 0x6c, 0x69, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x6c, 0x65, 0x76, 0x65, 0x6c,
-  0x73, 0x20, 0x6f, 0x66, 0x6e, 0x6f, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66,
-  0x4f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x64, 0x69, 0x73, 0x6d,
-  0x69, 0x73, 0x73, 0x65, 0x64, 0x73, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x69, 0x73,
-  0x74, 0x72, 0x65, 0x73, 0x65, 0x6d, 0x62, 0x6c, 0x65, 0x73, 0x64, 0x75, 0x70,
-  0x6c, 0x69, 0x63, 0x61, 0x74, 0x65, 0x65, 0x78, 0x70, 0x6c, 0x6f, 0x73, 0x69,
-  0x76, 0x65, 0x72, 0x65, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x65, 0x64, 0x61, 0x6c,
-  0x6c, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x67, 0x61, 0x6c, 0x6c, 0x65, 0x72,
-  0x69, 0x65, 0x73, 0x7b, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x3a, 0x70,
-  0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x67, 0x69, 0x6f,
-  0x6e, 0x20, 0x6f, 0x66, 0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x65, 0x73,
-  0x61, 0x73, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x74, 0x65, 0x69, 0x6d, 0x67, 0x20,
-  0x61, 0x6c, 0x74, 0x3d, 0x22, 0x69, 0x6e, 0x20, 0x6d, 0x6f, 0x64, 0x65, 0x72,
-  0x6e, 0x73, 0x68, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x62, 0x65, 0x6d, 0x65, 0x74,
-  0x68, 0x6f, 0x64, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x69,
-  0x6e, 0x67, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x70, 0x6e, 0x65,
-  0x65, 0x64, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x74, 0x68, 0x65, 0x20, 0x47, 0x72,
-  0x65, 0x61, 0x74, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64, 0x69, 0x6e, 0x67, 0x73,
-  0x65, 0x65, 0x6d, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x76, 0x69, 0x65, 0x77, 0x65,
-  0x64, 0x20, 0x61, 0x73, 0x69, 0x6d, 0x70, 0x61, 0x63, 0x74, 0x20, 0x6f, 0x6e,
-  0x69, 0x64, 0x65, 0x61, 0x20, 0x74, 0x68, 0x61, 0x74, 0x74, 0x68, 0x65, 0x20,
-  0x57, 0x6f, 0x72, 0x6c, 0x64, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x20, 0x6f,
-  0x66, 0x65, 0x78, 0x70, 0x61, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x54, 0x68, 0x65,
-  0x73, 0x65, 0x20, 0x61, 0x72, 0x65, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74,
-  0x22, 0x3e, 0x63, 0x61, 0x72, 0x65, 0x66, 0x75, 0x6c, 0x6c, 0x79, 0x6d, 0x61,
-  0x69, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x73, 0x63, 0x68, 0x61, 0x72, 0x67, 0x65,
-  0x20, 0x6f, 0x66, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x69, 0x63, 0x61, 0x6c, 0x61,
-  0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x65, 0x64, 0x70, 0x72, 0x65, 0x64, 0x69,
-  0x63, 0x74, 0x65, 0x64, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x73, 0x68, 0x69, 0x70,
-  0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x72, 0x69, 0x67, 0x68,
-  0x74, 0x22, 0x3e, 0x0d, 0x0a, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x63,
-  0x65, 0x6c, 0x65, 0x61, 0x76, 0x65, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e,
-  0x74, 0x65, 0x6e, 0x74, 0x22, 0x3e, 0x61, 0x72, 0x65, 0x20, 0x6f, 0x66, 0x74,
-  0x65, 0x6e, 0x20, 0x20, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x0d, 0x0a, 0x70, 0x72,
-  0x6f, 0x62, 0x61, 0x62, 0x6c, 0x79, 0x20, 0x50, 0x72, 0x6f, 0x66, 0x65, 0x73,
-  0x73, 0x6f, 0x72, 0x2d, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x22, 0x20, 0x72,
-  0x65, 0x73, 0x70, 0x6f, 0x6e, 0x64, 0x65, 0x64, 0x73, 0x61, 0x79, 0x73, 0x20,
-  0x74, 0x68, 0x61, 0x74, 0x68, 0x61, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x62, 0x65,
-  0x70, 0x6c, 0x61, 0x63, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x48, 0x75, 0x6e, 0x67,
-  0x61, 0x72, 0x69, 0x61, 0x6e, 0x73, 0x74, 0x61, 0x74, 0x75, 0x73, 0x20, 0x6f,
-  0x66, 0x73, 0x65, 0x72, 0x76, 0x65, 0x73, 0x20, 0x61, 0x73, 0x55, 0x6e, 0x69,
-  0x76, 0x65, 0x72, 0x73, 0x61, 0x6c, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69,
-  0x6f, 0x6e, 0x61, 0x67, 0x67, 0x72, 0x65, 0x67, 0x61, 0x74, 0x65, 0x66, 0x6f,
-  0x72, 0x20, 0x77, 0x68, 0x69, 0x63, 0x68, 0x69, 0x6e, 0x66, 0x65, 0x63, 0x74,
-  0x69, 0x6f, 0x6e, 0x61, 0x67, 0x72, 0x65, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x68,
-  0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c,
-  0x61, 0x72, 0x22, 0x3e, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x64, 0x20, 0x6f, 0x6e,
-  0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x65, 0x6c, 0x65, 0x63,
-  0x74, 0x6f, 0x72, 0x61, 0x6c, 0x73, 0x79, 0x6d, 0x62, 0x6f, 0x6c, 0x20, 0x6f,
-  0x66, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x69, 0x6e, 0x67, 0x72, 0x65, 0x74,
-  0x75, 0x72, 0x6e, 0x20, 0x74, 0x6f, 0x61, 0x72, 0x63, 0x68, 0x69, 0x74, 0x65,
-  0x63, 0x74, 0x43, 0x68, 0x72, 0x69, 0x73, 0x74, 0x69, 0x61, 0x6e, 0x70, 0x72,
-  0x65, 0x76, 0x69, 0x6f, 0x75, 0x73, 0x20, 0x6c, 0x69, 0x76, 0x69, 0x6e, 0x67,
-  0x20, 0x69, 0x6e, 0x65, 0x61, 0x73, 0x69, 0x65, 0x72, 0x20, 0x74, 0x6f, 0x70,
-  0x72, 0x6f, 0x66, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x0a, 0x26, 0x6c, 0x74, 0x3b,
-  0x21, 0x2d, 0x2d, 0x20, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x20, 0x6f, 0x66,
-  0x61, 0x6e, 0x61, 0x6c, 0x79, 0x74, 0x69, 0x63, 0x73, 0x77, 0x61, 0x73, 0x20,
-  0x74, 0x61, 0x6b, 0x65, 0x6e, 0x77, 0x68, 0x65, 0x72, 0x65, 0x20, 0x74, 0x68,
-  0x65, 0x74, 0x6f, 0x6f, 0x6b, 0x20, 0x6f, 0x76, 0x65, 0x72, 0x62, 0x65, 0x6c,
-  0x69, 0x65, 0x66, 0x20, 0x69, 0x6e, 0x41, 0x66, 0x72, 0x69, 0x6b, 0x61, 0x61,
-  0x6e, 0x73, 0x61, 0x73, 0x20, 0x66, 0x61, 0x72, 0x20, 0x61, 0x73, 0x70, 0x72,
-  0x65, 0x76, 0x65, 0x6e, 0x74, 0x65, 0x64, 0x77, 0x6f, 0x72, 0x6b, 0x20, 0x77,
-  0x69, 0x74, 0x68, 0x61, 0x20, 0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c, 0x3c,
-  0x66, 0x69, 0x65, 0x6c, 0x64, 0x73, 0x65, 0x74, 0x43, 0x68, 0x72, 0x69, 0x73,
-  0x74, 0x6d, 0x61, 0x73, 0x52, 0x65, 0x74, 0x72, 0x69, 0x65, 0x76, 0x65, 0x64,
-  0x0a, 0x0a, 0x49, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x62, 0x61, 0x63, 0x6b,
-  0x20, 0x69, 0x6e, 0x74, 0x6f, 0x6e, 0x6f, 0x72, 0x74, 0x68, 0x65, 0x61, 0x73,
-  0x74, 0x6d, 0x61, 0x67, 0x61, 0x7a, 0x69, 0x6e, 0x65, 0x73, 0x3e, 0x3c, 0x73,
-  0x74, 0x72, 0x6f, 0x6e, 0x67, 0x3e, 0x63, 0x6f, 0x6d, 0x6d, 0x69, 0x74, 0x74,
-  0x65, 0x65, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x69, 0x6e, 0x67, 0x67, 0x72,
-  0x6f, 0x75, 0x70, 0x73, 0x20, 0x6f, 0x66, 0x73, 0x74, 0x6f, 0x72, 0x65, 0x64,
-  0x20, 0x69, 0x6e, 0x65, 0x73, 0x74, 0x61, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x61,
-  0x20, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x69, 0x74, 0x73, 0x20, 0x66,
-  0x69, 0x72, 0x73, 0x74, 0x74, 0x68, 0x65, 0x69, 0x72, 0x20, 0x6f, 0x77, 0x6e,
-  0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x61, 0x6e, 0x20, 0x6f,
-  0x62, 0x6a, 0x65, 0x63, 0x74, 0x43, 0x61, 0x72, 0x69, 0x62, 0x62, 0x65, 0x61,
-  0x6e, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x20, 0x74, 0x68, 0x65, 0x64, 0x69, 0x73,
-  0x74, 0x72, 0x69, 0x63, 0x74, 0x73, 0x77, 0x69, 0x73, 0x63, 0x6f, 0x6e, 0x73,
-  0x69, 0x6e, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x3b, 0x20,
-  0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x20, 0x69, 0x6e, 0x68, 0x61, 0x62, 0x69,
-  0x74, 0x65, 0x64, 0x53, 0x6f, 0x63, 0x69, 0x61, 0x6c, 0x69, 0x73, 0x74, 0x4a,
-  0x61, 0x6e, 0x75, 0x61, 0x72, 0x79, 0x20, 0x31, 0x3c, 0x2f, 0x66, 0x6f, 0x6f,
-  0x74, 0x65, 0x72, 0x3e, 0x73, 0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x6c, 0x79,
-  0x63, 0x68, 0x6f, 0x69, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20,
-  0x73, 0x61, 0x6d, 0x65, 0x20, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69, 0x63,
-  0x20, 0x62, 0x75, 0x73, 0x69, 0x6e, 0x65, 0x73, 0x73, 0x20, 0x54, 0x68, 0x65,
-  0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x2e, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68,
-  0x3b, 0x20, 0x64, 0x65, 0x73, 0x69, 0x72, 0x65, 0x20, 0x74, 0x6f, 0x64, 0x65,
-  0x61, 0x6c, 0x20, 0x77, 0x69, 0x74, 0x68, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x20,
-  0x74, 0x68, 0x65, 0x75, 0x73, 0x65, 0x72, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x63,
-  0x6f, 0x6e, 0x63, 0x65, 0x69, 0x76, 0x65, 0x64, 0x69, 0x6e, 0x64, 0x65, 0x78,
-  0x2e, 0x70, 0x68, 0x70, 0x61, 0x73, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b,
-  0x65, 0x6e, 0x67, 0x61, 0x67, 0x65, 0x20, 0x69, 0x6e, 0x72, 0x65, 0x63, 0x65,
-  0x6e, 0x74, 0x6c, 0x79, 0x2c, 0x66, 0x65, 0x77, 0x20, 0x79, 0x65, 0x61, 0x72,
-  0x73, 0x77, 0x65, 0x72, 0x65, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x0a, 0x3c, 0x68,
-  0x65, 0x61, 0x64, 0x3e, 0x0a, 0x3c, 0x65, 0x64, 0x69, 0x74, 0x65, 0x64, 0x20,
-  0x62, 0x79, 0x61, 0x72, 0x65, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x63, 0x69,
-  0x74, 0x69, 0x65, 0x73, 0x20, 0x69, 0x6e, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73,
-  0x6b, 0x65, 0x79, 0x63, 0x6f, 0x6e, 0x64, 0x65, 0x6d, 0x6e, 0x65, 0x64, 0x61,
-  0x6c, 0x73, 0x6f, 0x20, 0x68, 0x61, 0x76, 0x65, 0x73, 0x65, 0x72, 0x76, 0x69,
-  0x63, 0x65, 0x73, 0x2c, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x20, 0x6f, 0x66,
-  0x53, 0x63, 0x68, 0x6f, 0x6f, 0x6c, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x76,
-  0x65, 0x72, 0x74, 0x65, 0x64, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65, 0x20, 0x6f,
-  0x66, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x6d, 0x69, 0x6e,
-  0x69, 0x73, 0x74, 0x65, 0x72, 0x73, 0x3c, 0x2f, 0x6f, 0x62, 0x6a, 0x65, 0x63,
-  0x74, 0x3e, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x69, 0x73, 0x20, 0x61, 0x20,
-  0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x73, 0x65, 0x71, 0x75, 0x65, 0x6e,
-  0x63, 0x65, 0x73, 0x61, 0x64, 0x76, 0x6f, 0x63, 0x61, 0x74, 0x65, 0x64, 0x54,
-  0x68, 0x65, 0x79, 0x20, 0x77, 0x65, 0x72, 0x65, 0x61, 0x6e, 0x79, 0x20, 0x6f,
-  0x74, 0x68, 0x65, 0x72, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3d,
-  0x65, 0x6e, 0x74, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x75, 0x63, 0x68,
-  0x20, 0x6d, 0x6f, 0x72, 0x65, 0x72, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74, 0x65,
-  0x64, 0x77, 0x61, 0x73, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x6f, 0x72, 0x69,
-  0x67, 0x69, 0x6e, 0x61, 0x6c, 0x20, 0x61, 0x20, 0x74, 0x79, 0x70, 0x69, 0x63,
-  0x61, 0x6c, 0x77, 0x68, 0x65, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x79, 0x65, 0x6e,
-  0x67, 0x69, 0x6e, 0x65, 0x65, 0x72, 0x73, 0x63, 0x6f, 0x75, 0x6c, 0x64, 0x20,
-  0x6e, 0x6f, 0x74, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x73, 0x77,
-  0x65, 0x64, 0x6e, 0x65, 0x73, 0x64, 0x61, 0x79, 0x74, 0x68, 0x65, 0x20, 0x74,
-  0x68, 0x69, 0x72, 0x64, 0x20, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x73,
-  0x4a, 0x61, 0x6e, 0x75, 0x61, 0x72, 0x79, 0x20, 0x32, 0x77, 0x68, 0x61, 0x74,
-  0x20, 0x74, 0x68, 0x65, 0x79, 0x61, 0x20, 0x63, 0x65, 0x72, 0x74, 0x61, 0x69,
-  0x6e, 0x72, 0x65, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x70, 0x72, 0x6f,
-  0x63, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x61, 0x66, 0x74, 0x65, 0x72, 0x20, 0x68,
-  0x69, 0x73, 0x74, 0x68, 0x65, 0x20, 0x6c, 0x61, 0x73, 0x74, 0x20, 0x63, 0x6f,
-  0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65, 0x64, 0x22, 0x3e, 0x3c, 0x2f, 0x64, 0x69,
-  0x76, 0x3e, 0x0a, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x64,
-  0x65, 0x70, 0x65, 0x6e, 0x64, 0x20, 0x6f, 0x6e, 0x73, 0x65, 0x61, 0x72, 0x63,
-  0x68, 0x22, 0x3e, 0x0a, 0x70, 0x69, 0x65, 0x63, 0x65, 0x73, 0x20, 0x6f, 0x66,
-  0x63, 0x6f, 0x6d, 0x70, 0x65, 0x74, 0x69, 0x6e, 0x67, 0x52, 0x65, 0x66, 0x65,
-  0x72, 0x65, 0x6e, 0x63, 0x65, 0x74, 0x65, 0x6e, 0x6e, 0x65, 0x73, 0x73, 0x65,
-  0x65, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x68, 0x61, 0x73, 0x20, 0x76, 0x65,
-  0x72, 0x73, 0x69, 0x6f, 0x6e, 0x3d, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e,
-  0x20, 0x3c, 0x3c, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x3e, 0x67, 0x69,
-  0x76, 0x65, 0x73, 0x20, 0x74, 0x68, 0x65, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72,
-  0x69, 0x61, 0x6e, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x22, 0x3e, 0x70,
-  0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x3a, 0x30, 0x76, 0x69, 0x65, 0x77, 0x20,
-  0x74, 0x68, 0x61, 0x74, 0x74, 0x6f, 0x67, 0x65, 0x74, 0x68, 0x65, 0x72, 0x2c,
-  0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x77, 0x61, 0x73, 0x20,
-  0x66, 0x6f, 0x75, 0x6e, 0x64, 0x73, 0x75, 0x62, 0x73, 0x65, 0x74, 0x20, 0x6f,
-  0x66, 0x61, 0x74, 0x74, 0x61, 0x63, 0x6b, 0x20, 0x6f, 0x6e, 0x63, 0x68, 0x69,
-  0x6c, 0x64, 0x72, 0x65, 0x6e, 0x2c, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x73, 0x20,
-  0x6f, 0x66, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x70, 0x6f,
-  0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x61, 0x6c, 0x6c, 0x65, 0x67, 0x65,
-  0x64, 0x6c, 0x79, 0x43, 0x6c, 0x65, 0x76, 0x65, 0x6c, 0x61, 0x6e, 0x64, 0x77,
-  0x61, 0x73, 0x20, 0x6c, 0x61, 0x74, 0x65, 0x72, 0x61, 0x6e, 0x64, 0x20, 0x61,
-  0x66, 0x74, 0x65, 0x72, 0x61, 0x72, 0x65, 0x20, 0x67, 0x69, 0x76, 0x65, 0x6e,
-  0x77, 0x61, 0x73, 0x20, 0x73, 0x74, 0x69, 0x6c, 0x6c, 0x73, 0x63, 0x72, 0x6f,
-  0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x20, 0x6f,
-  0x66, 0x6d, 0x61, 0x6b, 0x65, 0x73, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x75, 0x63,
-  0x68, 0x20, 0x6c, 0x65, 0x73, 0x73, 0x41, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x61,
-  0x6e, 0x73, 0x2e, 0x0a, 0x0a, 0x41, 0x66, 0x74, 0x65, 0x72, 0x20, 0x2c, 0x20,
-  0x62, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x4d, 0x75, 0x73, 0x65, 0x75, 0x6d,
-  0x20, 0x6f, 0x66, 0x6c, 0x6f, 0x75, 0x69, 0x73, 0x69, 0x61, 0x6e, 0x61, 0x28,
-  0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x69, 0x6e, 0x6e, 0x65,
-  0x73, 0x6f, 0x74, 0x61, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c, 0x65, 0x73,
-  0x61, 0x20, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x73, 0x73, 0x44, 0x6f, 0x6d, 0x69,
-  0x6e, 0x69, 0x63, 0x61, 0x6e, 0x76, 0x6f, 0x6c, 0x75, 0x6d, 0x65, 0x20, 0x6f,
-  0x66, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x66,
-  0x65, 0x6e, 0x73, 0x69, 0x76, 0x65, 0x30, 0x30, 0x70, 0x78, 0x7c, 0x72, 0x69,
-  0x67, 0x68, 0x6d, 0x61, 0x64, 0x65, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x6d, 0x6f,
-  0x75, 0x73, 0x65, 0x6f, 0x76, 0x65, 0x72, 0x22, 0x20, 0x73, 0x74, 0x79, 0x6c,
-  0x65, 0x3d, 0x22, 0x73, 0x74, 0x61, 0x74, 0x65, 0x73, 0x20, 0x6f, 0x66, 0x28,
-  0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x69, 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x69,
-  0x6e, 0x75, 0x65, 0x73, 0x46, 0x72, 0x61, 0x6e, 0x63, 0x69, 0x73, 0x63, 0x6f,
-  0x62, 0x75, 0x69, 0x6c, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x77, 0x69, 0x74, 0x68,
-  0x6f, 0x75, 0x74, 0x20, 0x61, 0x77, 0x69, 0x74, 0x68, 0x20, 0x73, 0x6f, 0x6d,
-  0x65, 0x77, 0x68, 0x6f, 0x20, 0x77, 0x6f, 0x75, 0x6c, 0x64, 0x61, 0x20, 0x66,
-  0x6f, 0x72, 0x6d, 0x20, 0x6f, 0x66, 0x61, 0x20, 0x70, 0x61, 0x72, 0x74, 0x20,
-  0x6f, 0x66, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x20, 0x69, 0x74, 0x6b, 0x6e,
-  0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73, 0x20, 0x20, 0x53, 0x65, 0x72, 0x76, 0x69,
-  0x63, 0x65, 0x73, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x61,
-  0x6e, 0x64, 0x20, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x6d, 0x65, 0x61, 0x73, 0x75,
-  0x72, 0x69, 0x6e, 0x67, 0x61, 0x6e, 0x64, 0x20, 0x69, 0x74, 0x20, 0x69, 0x73,
-  0x70, 0x61, 0x70, 0x65, 0x72, 0x62, 0x61, 0x63, 0x6b, 0x76, 0x61, 0x6c, 0x75,
-  0x65, 0x73, 0x20, 0x6f, 0x66, 0x0d, 0x0a, 0x3c, 0x74, 0x69, 0x74, 0x6c, 0x65,
-  0x3e, 0x3d, 0x20, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x2e, 0x64, 0x65, 0x74,
-  0x65, 0x72, 0x6d, 0x69, 0x6e, 0x65, 0x65, 0x72, 0x26, 0x71, 0x75, 0x6f, 0x74,
-  0x3b, 0x20, 0x70, 0x6c, 0x61, 0x79, 0x65, 0x64, 0x20, 0x62, 0x79, 0x61, 0x6e,
-  0x64, 0x20, 0x65, 0x61, 0x72, 0x6c, 0x79, 0x3c, 0x2f, 0x63, 0x65, 0x6e, 0x74,
-  0x65, 0x72, 0x3e, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x69, 0x73, 0x74,
-  0x68, 0x65, 0x20, 0x74, 0x68, 0x72, 0x65, 0x65, 0x70, 0x6f, 0x77, 0x65, 0x72,
-  0x20, 0x61, 0x6e, 0x64, 0x6f, 0x66, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b,
-  0x69, 0x6e, 0x6e, 0x65, 0x72, 0x48, 0x54, 0x4d, 0x4c, 0x3c, 0x61, 0x20, 0x68,
-  0x72, 0x65, 0x66, 0x3d, 0x22, 0x79, 0x3a, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65,
-  0x3b, 0x43, 0x68, 0x75, 0x72, 0x63, 0x68, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65,
-  0x20, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x76, 0x65, 0x72, 0x79, 0x20, 0x68, 0x69,
-  0x67, 0x68, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x2d, 0x68,
-  0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e,
-  0x74, 0x3d, 0x22, 0x2f, 0x63, 0x67, 0x69, 0x2d, 0x62, 0x69, 0x6e, 0x2f, 0x74,
-  0x6f, 0x20, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x61, 0x66, 0x72, 0x69, 0x6b,
-  0x61, 0x61, 0x6e, 0x73, 0x65, 0x73, 0x70, 0x65, 0x72, 0x61, 0x6e, 0x74, 0x6f,
-  0x66, 0x72, 0x61, 0x6e, 0xc3, 0xa7, 0x61, 0x69, 0x73, 0x6c, 0x61, 0x74, 0x76,
-  0x69, 0x65, 0xc5, 0xa1, 0x75, 0x6c, 0x69, 0x65, 0x74, 0x75, 0x76, 0x69, 0xc5,
-  0xb3, 0xc4, 0x8c, 0x65, 0xc5, 0xa1, 0x74, 0x69, 0x6e, 0x61, 0xc4, 0x8d, 0x65,
-  0xc5, 0xa1, 0x74, 0x69, 0x6e, 0x61, 0xe0, 0xb9, 0x84, 0xe0, 0xb8, 0x97, 0xe0,
-  0xb8, 0xa2, 0xe6, 0x97, 0xa5, 0xe6, 0x9c, 0xac, 0xe8, 0xaa, 0x9e, 0xe7, 0xae,
-  0x80, 0xe4, 0xbd, 0x93, 0xe5, 0xad, 0x97, 0xe7, 0xb9, 0x81, 0xe9, 0xab, 0x94,
-  0xe5, 0xad, 0x97, 0xed, 0x95, 0x9c, 0xea, 0xb5, 0xad, 0xec, 0x96, 0xb4, 0xe4,
-  0xb8, 0xba, 0xe4, 0xbb, 0x80, 0xe4, 0xb9, 0x88, 0xe8, 0xae, 0xa1, 0xe7, 0xae,
-  0x97, 0xe6, 0x9c, 0xba, 0xe7, 0xac, 0x94, 0xe8, 0xae, 0xb0, 0xe6, 0x9c, 0xac,
-  0xe8, 0xa8, 0x8e, 0xe8, 0xab, 0x96, 0xe5, 0x8d, 0x80, 0xe6, 0x9c, 0x8d, 0xe5,
-  0x8a, 0xa1, 0xe5, 0x99, 0xa8, 0xe4, 0xba, 0x92, 0xe8, 0x81, 0x94, 0xe7, 0xbd,
-  0x91, 0xe6, 0x88, 0xbf, 0xe5, 0x9c, 0xb0, 0xe4, 0xba, 0xa7, 0xe4, 0xbf, 0xb1,
-  0xe4, 0xb9, 0x90, 0xe9, 0x83, 0xa8, 0xe5, 0x87, 0xba, 0xe7, 0x89, 0x88, 0xe7,
-  0xa4, 0xbe, 0xe6, 0x8e, 0x92, 0xe8, 0xa1, 0x8c, 0xe6, 0xa6, 0x9c, 0xe9, 0x83,
-  0xa8, 0xe8, 0x90, 0xbd, 0xe6, 0xa0, 0xbc, 0xe8, 0xbf, 0x9b, 0xe4, 0xb8, 0x80,
-  0xe6, 0xad, 0xa5, 0xe6, 0x94, 0xaf, 0xe4, 0xbb, 0x98, 0xe5, 0xae, 0x9d, 0xe9,
-  0xaa, 0x8c, 0xe8, 0xaf, 0x81, 0xe7, 0xa0, 0x81, 0xe5, 0xa7, 0x94, 0xe5, 0x91,
-  0x98, 0xe4, 0xbc, 0x9a, 0xe6, 0x95, 0xb0, 0xe6, 0x8d, 0xae, 0xe5, 0xba, 0x93,
-  0xe6, 0xb6, 0x88, 0xe8, 0xb4, 0xb9, 0xe8, 0x80, 0x85, 0xe5, 0x8a, 0x9e, 0xe5,
-  0x85, 0xac, 0xe5, 0xae, 0xa4, 0xe8, 0xae, 0xa8, 0xe8, 0xae, 0xba, 0xe5, 0x8c,
-  0xba, 0xe6, 0xb7, 0xb1, 0xe5, 0x9c, 0xb3, 0xe5, 0xb8, 0x82, 0xe6, 0x92, 0xad,
-  0xe6, 0x94, 0xbe, 0xe5, 0x99, 0xa8, 0xe5, 0x8c, 0x97, 0xe4, 0xba, 0xac, 0xe5,
-  0xb8, 0x82, 0xe5, 0xa4, 0xa7, 0xe5, 0xad, 0xa6, 0xe7, 0x94, 0x9f, 0xe8, 0xb6,
-  0x8a, 0xe6, 0x9d, 0xa5, 0xe8, 0xb6, 0x8a, 0xe7, 0xae, 0xa1, 0xe7, 0x90, 0x86,
-  0xe5, 0x91, 0x98, 0xe4, 0xbf, 0xa1, 0xe6, 0x81, 0xaf, 0xe7, 0xbd, 0x91, 0x73,
-  0x65, 0x72, 0x76, 0x69, 0x63, 0x69, 0x6f, 0x73, 0x61, 0x72, 0x74, 0xc3, 0xad,
-  0x63, 0x75, 0x6c, 0x6f, 0x61, 0x72, 0x67, 0x65, 0x6e, 0x74, 0x69, 0x6e, 0x61,
-  0x62, 0x61, 0x72, 0x63, 0x65, 0x6c, 0x6f, 0x6e, 0x61, 0x63, 0x75, 0x61, 0x6c,
-  0x71, 0x75, 0x69, 0x65, 0x72, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x61, 0x64,
-  0x6f, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x6f, 0x73, 0x70, 0x6f, 0x6c,
-  0xc3, 0xad, 0x74, 0x69, 0x63, 0x61, 0x72, 0x65, 0x73, 0x70, 0x75, 0x65, 0x73,
-  0x74, 0x61, 0x77, 0x69, 0x6b, 0x69, 0x70, 0x65, 0x64, 0x69, 0x61, 0x73, 0x69,
-  0x67, 0x75, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x62, 0xc3, 0xba, 0x73, 0x71, 0x75,
-  0x65, 0x64, 0x61, 0x63, 0x6f, 0x6d, 0x75, 0x6e, 0x69, 0x64, 0x61, 0x64, 0x73,
-  0x65, 0x67, 0x75, 0x72, 0x69, 0x64, 0x61, 0x64, 0x70, 0x72, 0x69, 0x6e, 0x63,
-  0x69, 0x70, 0x61, 0x6c, 0x70, 0x72, 0x65, 0x67, 0x75, 0x6e, 0x74, 0x61, 0x73,
-  0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x69, 0x64, 0x6f, 0x72, 0x65, 0x73, 0x70,
-  0x6f, 0x6e, 0x64, 0x65, 0x72, 0x76, 0x65, 0x6e, 0x65, 0x7a, 0x75, 0x65, 0x6c,
-  0x61, 0x70, 0x72, 0x6f, 0x62, 0x6c, 0x65, 0x6d, 0x61, 0x73, 0x64, 0x69, 0x63,
-  0x69, 0x65, 0x6d, 0x62, 0x72, 0x65, 0x72, 0x65, 0x6c, 0x61, 0x63, 0x69, 0xc3,
-  0xb3, 0x6e, 0x6e, 0x6f, 0x76, 0x69, 0x65, 0x6d, 0x62, 0x72, 0x65, 0x73, 0x69,
-  0x6d, 0x69, 0x6c, 0x61, 0x72, 0x65, 0x73, 0x70, 0x72, 0x6f, 0x79, 0x65, 0x63,
-  0x74, 0x6f, 0x73, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x61, 0x73, 0x69,
-  0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x74, 0x6f, 0x61, 0x63, 0x74, 0x69, 0x76,
-  0x69, 0x64, 0x61, 0x64, 0x65, 0x6e, 0x63, 0x75, 0x65, 0x6e, 0x74, 0x72, 0x61,
-  0x65, 0x63, 0x6f, 0x6e, 0x6f, 0x6d, 0xc3, 0xad, 0x61, 0x69, 0x6d, 0xc3, 0xa1,
-  0x67, 0x65, 0x6e, 0x65, 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x63, 0x74, 0x61,
-  0x72, 0x64, 0x65, 0x73, 0x63, 0x61, 0x72, 0x67, 0x61, 0x72, 0x6e, 0x65, 0x63,
-  0x65, 0x73, 0x61, 0x72, 0x69, 0x6f, 0x61, 0x74, 0x65, 0x6e, 0x63, 0x69, 0xc3,
-  0xb3, 0x6e, 0x74, 0x65, 0x6c, 0xc3, 0xa9, 0x66, 0x6f, 0x6e, 0x6f, 0x63, 0x6f,
-  0x6d, 0x69, 0x73, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x61, 0x6e, 0x63, 0x69, 0x6f,
-  0x6e, 0x65, 0x73, 0x63, 0x61, 0x70, 0x61, 0x63, 0x69, 0x64, 0x61, 0x64, 0x65,
-  0x6e, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x72, 0x61, 0x6e, 0xc3, 0xa1, 0x6c,
-  0x69, 0x73, 0x69, 0x73, 0x66, 0x61, 0x76, 0x6f, 0x72, 0x69, 0x74, 0x6f, 0x73,
-  0x74, 0xc3, 0xa9, 0x72, 0x6d, 0x69, 0x6e, 0x6f, 0x73, 0x70, 0x72, 0x6f, 0x76,
-  0x69, 0x6e, 0x63, 0x69, 0x61, 0x65, 0x74, 0x69, 0x71, 0x75, 0x65, 0x74, 0x61,
-  0x73, 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x6f, 0x73, 0x66, 0x75, 0x6e,
-  0x63, 0x69, 0x6f, 0x6e, 0x65, 0x73, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x61,
-  0x64, 0x6f, 0x63, 0x61, 0x72, 0xc3, 0xa1, 0x63, 0x74, 0x65, 0x72, 0x70, 0x72,
-  0x6f, 0x70, 0x69, 0x65, 0x64, 0x61, 0x64, 0x70, 0x72, 0x69, 0x6e, 0x63, 0x69,
-  0x70, 0x69, 0x6f, 0x6e, 0x65, 0x63, 0x65, 0x73, 0x69, 0x64, 0x61, 0x64, 0x6d,
-  0x75, 0x6e, 0x69, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x63, 0x72, 0x65, 0x61, 0x63,
-  0x69, 0xc3, 0xb3, 0x6e, 0x64, 0x65, 0x73, 0x63, 0x61, 0x72, 0x67, 0x61, 0x73,
-  0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x69, 0x61, 0x63, 0x6f, 0x6d, 0x65,
-  0x72, 0x63, 0x69, 0x61, 0x6c, 0x6f, 0x70, 0x69, 0x6e, 0x69, 0x6f, 0x6e, 0x65,
-  0x73, 0x65, 0x6a, 0x65, 0x72, 0x63, 0x69, 0x63, 0x69, 0x6f, 0x65, 0x64, 0x69,
-  0x74, 0x6f, 0x72, 0x69, 0x61, 0x6c, 0x73, 0x61, 0x6c, 0x61, 0x6d, 0x61, 0x6e,
-  0x63, 0x61, 0x67, 0x6f, 0x6e, 0x7a, 0xc3, 0xa1, 0x6c, 0x65, 0x7a, 0x64, 0x6f,
-  0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x6f, 0x70, 0x65, 0x6c, 0xc3, 0xad, 0x63,
-  0x75, 0x6c, 0x61, 0x72, 0x65, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x73, 0x67,
-  0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x65, 0x73, 0x74, 0x61, 0x72, 0x72, 0x61,
-  0x67, 0x6f, 0x6e, 0x61, 0x70, 0x72, 0xc3, 0xa1, 0x63, 0x74, 0x69, 0x63, 0x61,
-  0x6e, 0x6f, 0x76, 0x65, 0x64, 0x61, 0x64, 0x65, 0x73, 0x70, 0x72, 0x6f, 0x70,
-  0x75, 0x65, 0x73, 0x74, 0x61, 0x70, 0x61, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x65,
-  0x73, 0x74, 0xc3, 0xa9, 0x63, 0x6e, 0x69, 0x63, 0x61, 0x73, 0x6f, 0x62, 0x6a,
-  0x65, 0x74, 0x69, 0x76, 0x6f, 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x63, 0x74,
-  0x6f, 0x73, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4,
-  0xb2, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x88,
-  0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4,
-  0xb5, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x87,
-  0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x88, 0xe0, 0xa4, 0x95, 0xe0,
-  0xa5, 0x81, 0xe0, 0xa4, 0x9b, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0x95,
-  0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xad, 0xe0,
-  0xa5, 0x80, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4,
-  0xb0, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x88,
-  0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa8, 0xe0,
-  0xa4, 0xac, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0x64, 0x69, 0x70, 0x6c, 0x6f,
-  0x64, 0x6f, 0x63, 0x73, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xaf,
-  0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa8, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xab, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x94,
-  0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa4, 0xb9, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x97, 0xe0, 0xa4,
-  0xb9, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb6, 0xe0,
-  0xa4, 0xb9, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x88, 0xe0, 0xa4, 0x96, 0xe0, 0xa5,
-  0x87, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbf,
-  0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb5, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
-  0xa8, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xae,
-  0xe0, 0xa5, 0x8c, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0xb2, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x96, 0xe0, 0xa4,
-  0x9c, 0xe0, 0xa5, 0x89, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xa6,
-  0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0xa8, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4,
-  0xb9, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x97,
-  0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xad, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa8, 0xe0,
-  0xa4, 0x97, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0xb8, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0x95,
-  0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xb8, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
-  0xb9, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x81, 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0x97,
-  0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xae, 0xe0,
-  0xa4, 0x96, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xad, 0xe0, 0xa5, 0x80,
-  0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa4, 0xe0,
-  0xa5, 0x81, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb5, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4,
-  0x9f, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x85,
-  0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x90, 0xe0, 0xa4, 0xb8, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4,
-  0xb2, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x8a, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa4, 0x9a, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x90, 0xe0, 0xa4,
-  0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb0,
-  0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xa6, 0xe0,
-  0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0x82, 0xe0, 0xa4,
-  0xa6, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb9,
-  0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0x96, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4,
-  0xac, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbf,
-  0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0,
-  0xa4, 0x86, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
-  0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb2,
-  0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x89, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xad, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
-  0xb2, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xb0,
-  0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x97, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4,
-  0xb9, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xb8,
-  0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0,
-  0xa4, 0x95, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa0, 0xe0, 0xa5,
-  0x80, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x81,
-  0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4, 0xe0,
-  0xa4, 0xb9, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0xa4, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0x86,
-  0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0x95, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8c, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
-  0xb6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87,
-  0xe0, 0xa4, 0x96, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0,
-  0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0x96, 0xe0, 0xa5,
-  0x81, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x97, 0xe0, 0xa5, 0x80,
-  0x63, 0x61, 0x74, 0x65, 0x67, 0x6f, 0x72, 0x69, 0x65, 0x73, 0x65, 0x78, 0x70,
-  0x65, 0x72, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x3c, 0x2f, 0x74, 0x69, 0x74, 0x6c,
-  0x65, 0x3e, 0x0d, 0x0a, 0x43, 0x6f, 0x70, 0x79, 0x72, 0x69, 0x67, 0x68, 0x74,
-  0x20, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x63, 0x6f,
-  0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x76, 0x65, 0x72, 0x79,
-  0x74, 0x68, 0x69, 0x6e, 0x67, 0x3c, 0x70, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
-  0x3d, 0x22, 0x74, 0x65, 0x63, 0x68, 0x6e, 0x6f, 0x6c, 0x6f, 0x67, 0x79, 0x62,
-  0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x3c, 0x61, 0x20, 0x63,
-  0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x6d,
-  0x65, 0x6e, 0x74, 0x26, 0x63, 0x6f, 0x70, 0x79, 0x3b, 0x20, 0x32, 0x30, 0x31,
-  0x6a, 0x61, 0x76, 0x61, 0x53, 0x63, 0x72, 0x69, 0x70, 0x74, 0x63, 0x68, 0x61,
-  0x72, 0x61, 0x63, 0x74, 0x65, 0x72, 0x73, 0x62, 0x72, 0x65, 0x61, 0x64, 0x63,
-  0x72, 0x75, 0x6d, 0x62, 0x74, 0x68, 0x65, 0x6d, 0x73, 0x65, 0x6c, 0x76, 0x65,
-  0x73, 0x68, 0x6f, 0x72, 0x69, 0x7a, 0x6f, 0x6e, 0x74, 0x61, 0x6c, 0x67, 0x6f,
-  0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x43, 0x61, 0x6c, 0x69, 0x66,
-  0x6f, 0x72, 0x6e, 0x69, 0x61, 0x61, 0x63, 0x74, 0x69, 0x76, 0x69, 0x74, 0x69,
-  0x65, 0x73, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72, 0x65, 0x64, 0x4e,
-  0x61, 0x76, 0x69, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x6e,
-  0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74,
-  0x69, 0x6f, 0x6e, 0x6e, 0x61, 0x76, 0x69, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x61, 0x6e, 0x63, 0x65, 0x3c, 0x2f, 0x74,
-  0x69, 0x74, 0x6c, 0x65, 0x3e, 0x3c, 0x6d, 0x63, 0x68, 0x65, 0x63, 0x6b, 0x62,
-  0x6f, 0x78, 0x22, 0x20, 0x74, 0x65, 0x63, 0x68, 0x6e, 0x69, 0x71, 0x75, 0x65,
-  0x73, 0x70, 0x72, 0x6f, 0x74, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x70,
-  0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x61, 0x73, 0x20, 0x77, 0x65,
-  0x6c, 0x6c, 0x20, 0x61, 0x73, 0x75, 0x6e, 0x74, 0x27, 0x2c, 0x20, 0x27, 0x55,
-  0x41, 0x2d, 0x72, 0x65, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x6f,
-  0x70, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x65, 0x6c, 0x65,
-  0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x6c, 0x61,
-  0x74, 0x65, 0x64, 0x57, 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x74, 0x6f, 0x6e,
-  0x6e, 0x61, 0x76, 0x69, 0x67, 0x61, 0x74, 0x6f, 0x72, 0x2e, 0x20, 0x3d, 0x20,
-  0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x2e, 0x69, 0x6d, 0x70, 0x72, 0x65, 0x73,
-  0x73, 0x69, 0x6f, 0x6e, 0x26, 0x6c, 0x74, 0x3b, 0x62, 0x72, 0x26, 0x67, 0x74,
-  0x3b, 0x6c, 0x69, 0x74, 0x65, 0x72, 0x61, 0x74, 0x75, 0x72, 0x65, 0x70, 0x6f,
-  0x70, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x67, 0x63, 0x6f, 0x6c,
-  0x6f, 0x72, 0x3d, 0x22, 0x23, 0x65, 0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c,
-  0x6c, 0x79, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x70,
-  0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x6e, 0x65, 0x77, 0x73,
-  0x6c, 0x65, 0x74, 0x74, 0x65, 0x72, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x74,
-  0x69, 0x65, 0x73, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x6f, 0x6e,
-  0x6c, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73, 0x68, 0x69, 0x70, 0x54, 0x65, 0x63,
-  0x68, 0x6e, 0x6f, 0x6c, 0x6f, 0x67, 0x79, 0x50, 0x61, 0x72, 0x6c, 0x69, 0x61,
-  0x6d, 0x65, 0x6e, 0x74, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x69, 0x73, 0x6f,
-  0x6e, 0x75, 0x6c, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x2e, 0x69,
-  0x6e, 0x64, 0x65, 0x78, 0x4f, 0x66, 0x28, 0x22, 0x63, 0x6f, 0x6e, 0x63, 0x6c,
-  0x75, 0x73, 0x69, 0x6f, 0x6e, 0x64, 0x69, 0x73, 0x63, 0x75, 0x73, 0x73, 0x69,
-  0x6f, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x73, 0x62,
-  0x69, 0x6f, 0x6c, 0x6f, 0x67, 0x69, 0x63, 0x61, 0x6c, 0x52, 0x65, 0x76, 0x6f,
-  0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x5f, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69,
-  0x6e, 0x65, 0x72, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x74, 0x6f, 0x6f, 0x64,
-  0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x3c, 0x70, 0x65, 0x72,
-  0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x65, 0x61, 0x63, 0x68, 0x20, 0x6f,
-  0x74, 0x68, 0x65, 0x72, 0x61, 0x74, 0x6d, 0x6f, 0x73, 0x70, 0x68, 0x65, 0x72,
-  0x65, 0x20, 0x6f, 0x6e, 0x66, 0x6f, 0x63, 0x75, 0x73, 0x3d, 0x22, 0x3c, 0x66,
-  0x6f, 0x72, 0x6d, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x70, 0x72, 0x6f, 0x63, 0x65,
-  0x73, 0x73, 0x69, 0x6e, 0x67, 0x74, 0x68, 0x69, 0x73, 0x2e, 0x76, 0x61, 0x6c,
-  0x75, 0x65, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43,
-  0x6f, 0x6e, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x75, 0x62, 0x73,
-  0x65, 0x71, 0x75, 0x65, 0x6e, 0x74, 0x77, 0x65, 0x6c, 0x6c, 0x2d, 0x6b, 0x6e,
-  0x6f, 0x77, 0x6e, 0x76, 0x61, 0x72, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73,
-  0x72, 0x65, 0x70, 0x75, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x68, 0x65,
-  0x6e, 0x6f, 0x6d, 0x65, 0x6e, 0x6f, 0x6e, 0x64, 0x69, 0x73, 0x63, 0x69, 0x70,
-  0x6c, 0x69, 0x6e, 0x65, 0x6c, 0x6f, 0x67, 0x6f, 0x2e, 0x70, 0x6e, 0x67, 0x22,
-  0x20, 0x28, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2c, 0x62, 0x6f,
-  0x75, 0x6e, 0x64, 0x61, 0x72, 0x69, 0x65, 0x73, 0x65, 0x78, 0x70, 0x72, 0x65,
-  0x73, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x74, 0x74, 0x6c, 0x65, 0x6d, 0x65,
-  0x6e, 0x74, 0x42, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x6f,
-  0x75, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x6e, 0x74, 0x65,
-  0x72, 0x70, 0x72, 0x69, 0x73, 0x65, 0x28, 0x22, 0x68, 0x74, 0x74, 0x70, 0x73,
-  0x3a, 0x22, 0x20, 0x75, 0x6e, 0x65, 0x73, 0x63, 0x61, 0x70, 0x65, 0x28, 0x22,
-  0x70, 0x61, 0x73, 0x73, 0x77, 0x6f, 0x72, 0x64, 0x22, 0x20, 0x64, 0x65, 0x6d,
-  0x6f, 0x63, 0x72, 0x61, 0x74, 0x69, 0x63, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65,
-  0x66, 0x3d, 0x22, 0x2f, 0x77, 0x72, 0x61, 0x70, 0x70, 0x65, 0x72, 0x22, 0x3e,
-  0x0a, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x73, 0x68, 0x69, 0x70, 0x6c, 0x69,
-  0x6e, 0x67, 0x75, 0x69, 0x73, 0x74, 0x69, 0x63, 0x70, 0x78, 0x3b, 0x70, 0x61,
-  0x64, 0x64, 0x69, 0x6e, 0x67, 0x70, 0x68, 0x69, 0x6c, 0x6f, 0x73, 0x6f, 0x70,
-  0x68, 0x79, 0x61, 0x73, 0x73, 0x69, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x75,
-  0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74, 0x79, 0x66, 0x61, 0x63, 0x69,
-  0x6c, 0x69, 0x74, 0x69, 0x65, 0x73, 0x72, 0x65, 0x63, 0x6f, 0x67, 0x6e, 0x69,
-  0x7a, 0x65, 0x64, 0x70, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65,
-  0x69, 0x66, 0x20, 0x28, 0x74, 0x79, 0x70, 0x65, 0x6f, 0x66, 0x6d, 0x61, 0x69,
-  0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65, 0x64, 0x76, 0x6f, 0x63, 0x61, 0x62, 0x75,
-  0x6c, 0x61, 0x72, 0x79, 0x68, 0x79, 0x70, 0x6f, 0x74, 0x68, 0x65, 0x73, 0x69,
-  0x73, 0x2e, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x28, 0x29, 0x3b, 0x26, 0x61,
-  0x6d, 0x70, 0x3b, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x61, 0x6e, 0x6e, 0x6f, 0x74,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x65, 0x68, 0x69, 0x6e, 0x64, 0x20, 0x74,
-  0x68, 0x65, 0x46, 0x6f, 0x75, 0x6e, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70,
-  0x75, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x72, 0x22, 0x61, 0x73, 0x73, 0x75,
-  0x6d, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75,
-  0x63, 0x65, 0x64, 0x63, 0x6f, 0x72, 0x72, 0x75, 0x70, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x69, 0x73, 0x74, 0x73, 0x65, 0x78, 0x70,
-  0x6c, 0x69, 0x63, 0x69, 0x74, 0x6c, 0x79, 0x69, 0x6e, 0x73, 0x74, 0x65, 0x61,
-  0x64, 0x20, 0x6f, 0x66, 0x64, 0x69, 0x6d, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e,
-  0x73, 0x20, 0x6f, 0x6e, 0x43, 0x6c, 0x69, 0x63, 0x6b, 0x3d, 0x22, 0x63, 0x6f,
-  0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x65, 0x64, 0x64, 0x65, 0x70, 0x61, 0x72,
-  0x74, 0x6d, 0x65, 0x6e, 0x74, 0x6f, 0x63, 0x63, 0x75, 0x70, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x73, 0x6f, 0x6f, 0x6e, 0x20, 0x61, 0x66, 0x74, 0x65, 0x72, 0x69,
-  0x6e, 0x76, 0x65, 0x73, 0x74, 0x6d, 0x65, 0x6e, 0x74, 0x70, 0x72, 0x6f, 0x6e,
-  0x6f, 0x75, 0x6e, 0x63, 0x65, 0x64, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66,
-  0x69, 0x65, 0x64, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74,
-  0x4d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x67, 0x65, 0x6f,
-  0x67, 0x72, 0x61, 0x70, 0x68, 0x69, 0x63, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67,
-  0x68, 0x74, 0x3d, 0x22, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d,
-  0x22, 0x2e, 0x72, 0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x28, 0x2f, 0x64, 0x65,
-  0x70, 0x72, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e, 0x66, 0x65,
-  0x72, 0x65, 0x6e, 0x63, 0x65, 0x70, 0x75, 0x6e, 0x69, 0x73, 0x68, 0x6d, 0x65,
-  0x6e, 0x74, 0x65, 0x6c, 0x69, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x65, 0x64, 0x72,
-  0x65, 0x73, 0x69, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x61, 0x64, 0x61, 0x70,
-  0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x70, 0x70, 0x6f, 0x73, 0x69, 0x74,
-  0x69, 0x6f, 0x6e, 0x77, 0x65, 0x6c, 0x6c, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e,
-  0x73, 0x75, 0x70, 0x70, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x64, 0x65, 0x74,
-  0x65, 0x72, 0x6d, 0x69, 0x6e, 0x65, 0x64, 0x68, 0x31, 0x20, 0x63, 0x6c, 0x61,
-  0x73, 0x73, 0x3d, 0x22, 0x30, 0x70, 0x78, 0x3b, 0x6d, 0x61, 0x72, 0x67, 0x69,
-  0x6e, 0x6d, 0x65, 0x63, 0x68, 0x61, 0x6e, 0x69, 0x63, 0x61, 0x6c, 0x73, 0x74,
-  0x61, 0x74, 0x69, 0x73, 0x74, 0x69, 0x63, 0x73, 0x63, 0x65, 0x6c, 0x65, 0x62,
-  0x72, 0x61, 0x74, 0x65, 0x64, 0x47, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65,
-  0x6e, 0x74, 0x0a, 0x0a, 0x44, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x64,
-  0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x65, 0x72, 0x73, 0x61, 0x72, 0x74, 0x69,
-  0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x65, 0x71, 0x75, 0x69, 0x76, 0x61, 0x6c,
-  0x65, 0x6e, 0x74, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x74, 0x65, 0x64,
-  0x43, 0x6f, 0x6d, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x74, 0x74,
-  0x61, 0x63, 0x68, 0x6d, 0x65, 0x6e, 0x74, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20,
-  0x69, 0x64, 0x3d, 0x22, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x77, 0x65, 0x72,
-  0x65, 0x4e, 0x65, 0x64, 0x65, 0x72, 0x6c, 0x61, 0x6e, 0x64, 0x73, 0x62, 0x65,
-  0x79, 0x6f, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x67, 0x69, 0x73,
-  0x74, 0x65, 0x72, 0x65, 0x64, 0x6a, 0x6f, 0x75, 0x72, 0x6e, 0x61, 0x6c, 0x69,
-  0x73, 0x74, 0x66, 0x72, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x61,
-  0x6c, 0x6c, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x6c, 0x61, 0x6e, 0x67,
-  0x3d, 0x22, 0x65, 0x6e, 0x22, 0x20, 0x3c, 0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65,
-  0x3e, 0x0d, 0x0a, 0x61, 0x62, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x65, 0x3b, 0x20,
-  0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x69, 0x6e, 0x67, 0x65, 0x78, 0x74,
-  0x72, 0x65, 0x6d, 0x65, 0x6c, 0x79, 0x20, 0x6d, 0x61, 0x69, 0x6e, 0x73, 0x74,
-  0x72, 0x65, 0x61, 0x6d, 0x3c, 0x2f, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x67, 0x3e,
-  0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x69, 0x74, 0x79, 0x65, 0x6d,
-  0x70, 0x6c, 0x6f, 0x79, 0x6d, 0x65, 0x6e, 0x74, 0x3c, 0x2f, 0x74, 0x61, 0x62,
-  0x6c, 0x65, 0x3e, 0x0d, 0x0a, 0x20, 0x63, 0x6f, 0x6c, 0x73, 0x70, 0x61, 0x6e,
-  0x3d, 0x22, 0x3c, 0x2f, 0x66, 0x6f, 0x72, 0x6d, 0x3e, 0x0a, 0x20, 0x20, 0x63,
-  0x6f, 0x6e, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x62, 0x6f, 0x75,
-  0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x3c, 0x2f, 0x70, 0x3e, 0x3c, 0x2f, 0x64,
-  0x69, 0x76, 0x3e, 0x69, 0x6e, 0x74, 0x65, 0x67, 0x72, 0x61, 0x74, 0x65, 0x64,
-  0x22, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x3d, 0x22, 0x65, 0x6e, 0x50, 0x6f, 0x72,
-  0x74, 0x75, 0x67, 0x75, 0x65, 0x73, 0x65, 0x73, 0x75, 0x62, 0x73, 0x74, 0x69,
-  0x74, 0x75, 0x74, 0x65, 0x69, 0x6e, 0x64, 0x69, 0x76, 0x69, 0x64, 0x75, 0x61,
-  0x6c, 0x69, 0x6d, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x6c, 0x65, 0x6d, 0x75,
-  0x6c, 0x74, 0x69, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x61, 0x6c, 0x6d, 0x6f, 0x73,
-  0x74, 0x20, 0x61, 0x6c, 0x6c, 0x70, 0x78, 0x20, 0x73, 0x6f, 0x6c, 0x69, 0x64,
-  0x20, 0x23, 0x61, 0x70, 0x61, 0x72, 0x74, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x73,
-  0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x20, 0x74, 0x6f, 0x69, 0x6e, 0x20, 0x45,
-  0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68, 0x63, 0x72, 0x69, 0x74, 0x69, 0x63, 0x69,
-  0x7a, 0x65, 0x64, 0x65, 0x78, 0x63, 0x65, 0x70, 0x74, 0x20, 0x66, 0x6f, 0x72,
-  0x67, 0x75, 0x69, 0x64, 0x65, 0x6c, 0x69, 0x6e, 0x65, 0x73, 0x6f, 0x72, 0x69,
-  0x67, 0x69, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x72, 0x65, 0x6d, 0x61, 0x72, 0x6b,
-  0x61, 0x62, 0x6c, 0x65, 0x74, 0x68, 0x65, 0x20, 0x73, 0x65, 0x63, 0x6f, 0x6e,
-  0x64, 0x68, 0x32, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x3c, 0x61,
-  0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3d, 0x22, 0x28, 0x69, 0x6e, 0x63, 0x6c,
-  0x75, 0x64, 0x69, 0x6e, 0x67, 0x70, 0x61, 0x72, 0x61, 0x6d, 0x65, 0x74, 0x65,
-  0x72, 0x73, 0x70, 0x72, 0x6f, 0x68, 0x69, 0x62, 0x69, 0x74, 0x65, 0x64, 0x3d,
-  0x20, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x64, 0x69, 0x63, 0x74,
-  0x69, 0x6f, 0x6e, 0x61, 0x72, 0x79, 0x70, 0x65, 0x72, 0x63, 0x65, 0x70, 0x74,
-  0x69, 0x6f, 0x6e, 0x72, 0x65, 0x76, 0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e,
-  0x66, 0x6f, 0x75, 0x6e, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x78, 0x3b,
-  0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73,
-  0x73, 0x66, 0x75, 0x6c, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x72,
-  0x73, 0x6d, 0x69, 0x6c, 0x6c, 0x65, 0x6e, 0x6e, 0x69, 0x75, 0x6d, 0x68, 0x69,
-  0x73, 0x20, 0x66, 0x61, 0x74, 0x68, 0x65, 0x72, 0x74, 0x68, 0x65, 0x20, 0x26,
-  0x71, 0x75, 0x6f, 0x74, 0x3b, 0x6e, 0x6f, 0x2d, 0x72, 0x65, 0x70, 0x65, 0x61,
-  0x74, 0x3b, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x72, 0x63, 0x69, 0x61, 0x6c, 0x69,
-  0x6e, 0x64, 0x75, 0x73, 0x74, 0x72, 0x69, 0x61, 0x6c, 0x65, 0x6e, 0x63, 0x6f,
-  0x75, 0x72, 0x61, 0x67, 0x65, 0x64, 0x61, 0x6d, 0x6f, 0x75, 0x6e, 0x74, 0x20,
-  0x6f, 0x66, 0x20, 0x75, 0x6e, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c,
-  0x65, 0x66, 0x66, 0x69, 0x63, 0x69, 0x65, 0x6e, 0x63, 0x79, 0x52, 0x65, 0x66,
-  0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x63, 0x6f, 0x6f, 0x72, 0x64, 0x69,
-  0x6e, 0x61, 0x74, 0x65, 0x64, 0x69, 0x73, 0x63, 0x6c, 0x61, 0x69, 0x6d, 0x65,
-  0x72, 0x65, 0x78, 0x70, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x64, 0x65,
-  0x76, 0x65, 0x6c, 0x6f, 0x70, 0x69, 0x6e, 0x67, 0x63, 0x61, 0x6c, 0x63, 0x75,
-  0x6c, 0x61, 0x74, 0x65, 0x64, 0x73, 0x69, 0x6d, 0x70, 0x6c, 0x69, 0x66, 0x69,
-  0x65, 0x64, 0x6c, 0x65, 0x67, 0x69, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x73,
-  0x75, 0x62, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x28, 0x30, 0x22, 0x20, 0x63,
-  0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74,
-  0x65, 0x6c, 0x79, 0x69, 0x6c, 0x6c, 0x75, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65,
-  0x66, 0x69, 0x76, 0x65, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73, 0x69, 0x6e, 0x73,
-  0x74, 0x72, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x50, 0x75, 0x62, 0x6c, 0x69, 0x73,
-  0x68, 0x69, 0x6e, 0x67, 0x31, 0x22, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
-  0x22, 0x70, 0x73, 0x79, 0x63, 0x68, 0x6f, 0x6c, 0x6f, 0x67, 0x79, 0x63, 0x6f,
-  0x6e, 0x66, 0x69, 0x64, 0x65, 0x6e, 0x63, 0x65, 0x6e, 0x75, 0x6d, 0x62, 0x65,
-  0x72, 0x20, 0x6f, 0x66, 0x20, 0x61, 0x62, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x20,
-  0x6f, 0x66, 0x66, 0x6f, 0x63, 0x75, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x6e, 0x6a,
-  0x6f, 0x69, 0x6e, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x73, 0x74, 0x72, 0x75,
-  0x63, 0x74, 0x75, 0x72, 0x65, 0x73, 0x70, 0x72, 0x65, 0x76, 0x69, 0x6f, 0x75,
-  0x73, 0x6c, 0x79, 0x3e, 0x3c, 0x2f, 0x69, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x3e,
-  0x6f, 0x6e, 0x63, 0x65, 0x20, 0x61, 0x67, 0x61, 0x69, 0x6e, 0x62, 0x75, 0x74,
-  0x20, 0x72, 0x61, 0x74, 0x68, 0x65, 0x72, 0x69, 0x6d, 0x6d, 0x69, 0x67, 0x72,
-  0x61, 0x6e, 0x74, 0x73, 0x6f, 0x66, 0x20, 0x63, 0x6f, 0x75, 0x72, 0x73, 0x65,
-  0x2c, 0x61, 0x20, 0x67, 0x72, 0x6f, 0x75, 0x70, 0x20, 0x6f, 0x66, 0x4c, 0x69,
-  0x74, 0x65, 0x72, 0x61, 0x74, 0x75, 0x72, 0x65, 0x55, 0x6e, 0x6c, 0x69, 0x6b,
-  0x65, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x2f, 0x61, 0x3e, 0x26, 0x6e, 0x62, 0x73,
-  0x70, 0x3b, 0x0a, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x69,
-  0x74, 0x20, 0x77, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x43, 0x6f, 0x6e, 0x76,
-  0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x75, 0x74, 0x6f, 0x6d, 0x6f, 0x62,
-  0x69, 0x6c, 0x65, 0x50, 0x72, 0x6f, 0x74, 0x65, 0x73, 0x74, 0x61, 0x6e, 0x74,
-  0x61, 0x67, 0x67, 0x72, 0x65, 0x73, 0x73, 0x69, 0x76, 0x65, 0x61, 0x66, 0x74,
-  0x65, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x53, 0x69, 0x6d, 0x69, 0x6c, 0x61,
-  0x72, 0x6c, 0x79, 0x2c, 0x22, 0x20, 0x2f, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76,
-  0x3e, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x0d, 0x0a,
-  0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x76, 0x69, 0x73, 0x69, 0x62,
-  0x69, 0x6c, 0x69, 0x74, 0x79, 0x74, 0x68, 0x65, 0x20, 0x75, 0x73, 0x65, 0x20,
-  0x6f, 0x66, 0x76, 0x6f, 0x6c, 0x75, 0x6e, 0x74, 0x65, 0x65, 0x72, 0x73, 0x61,
-  0x74, 0x74, 0x72, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x75, 0x6e, 0x64, 0x65,
-  0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x68, 0x72, 0x65, 0x61, 0x74, 0x65,
-  0x6e, 0x65, 0x64, 0x2a, 0x3c, 0x21, 0x5b, 0x43, 0x44, 0x41, 0x54, 0x41, 0x5b,
-  0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x69, 0x6e, 0x20,
-  0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x74, 0x68, 0x65, 0x20, 0x6c, 0x61,
-  0x74, 0x74, 0x65, 0x72, 0x3c, 0x2f, 0x66, 0x6f, 0x72, 0x6d, 0x3e, 0x0a, 0x3c,
-  0x2f, 0x2e, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x4f, 0x66, 0x28, 0x27, 0x69, 0x20,
-  0x3d, 0x20, 0x30, 0x3b, 0x20, 0x69, 0x20, 0x3c, 0x64, 0x69, 0x66, 0x66, 0x65,
-  0x72, 0x65, 0x6e, 0x63, 0x65, 0x64, 0x65, 0x76, 0x6f, 0x74, 0x65, 0x64, 0x20,
-  0x74, 0x6f, 0x74, 0x72, 0x61, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x73,
-  0x65, 0x61, 0x72, 0x63, 0x68, 0x20, 0x66, 0x6f, 0x72, 0x75, 0x6c, 0x74, 0x69,
-  0x6d, 0x61, 0x74, 0x65, 0x6c, 0x79, 0x74, 0x6f, 0x75, 0x72, 0x6e, 0x61, 0x6d,
-  0x65, 0x6e, 0x74, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x73,
-  0x73, 0x6f, 0x2d, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x20, 0x7d, 0x0a, 0x3c,
-  0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3e, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x65, 0x6d, 0x70, 0x68, 0x61, 0x73, 0x69, 0x7a, 0x65,
-  0x64, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x69, 0x62, 0x6c, 0x65, 0x3c, 0x2f,
-  0x73, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x3e, 0x73, 0x75, 0x63, 0x63, 0x65,
-  0x73, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x6f, 0x6e, 0x67, 0x20, 0x77, 0x69,
-  0x74, 0x68, 0x4d, 0x65, 0x61, 0x6e, 0x77, 0x68, 0x69, 0x6c, 0x65, 0x2c, 0x69,
-  0x6e, 0x64, 0x75, 0x73, 0x74, 0x72, 0x69, 0x65, 0x73, 0x3c, 0x2f, 0x61, 0x3e,
-  0x3c, 0x62, 0x72, 0x20, 0x2f, 0x3e, 0x68, 0x61, 0x73, 0x20, 0x62, 0x65, 0x63,
-  0x6f, 0x6d, 0x65, 0x61, 0x73, 0x70, 0x65, 0x63, 0x74, 0x73, 0x20, 0x6f, 0x66,
-  0x54, 0x65, 0x6c, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x75, 0x66,
-  0x66, 0x69, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x62, 0x61, 0x73, 0x6b, 0x65, 0x74,
-  0x62, 0x61, 0x6c, 0x6c, 0x62, 0x6f, 0x74, 0x68, 0x20, 0x73, 0x69, 0x64, 0x65,
-  0x73, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75, 0x69, 0x6e, 0x67, 0x61, 0x6e,
-  0x20, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c, 0x65, 0x3c, 0x69, 0x6d, 0x67, 0x20,
-  0x61, 0x6c, 0x74, 0x3d, 0x22, 0x61, 0x64, 0x76, 0x65, 0x6e, 0x74, 0x75, 0x72,
-  0x65, 0x73, 0x68, 0x69, 0x73, 0x20, 0x6d, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x6d,
-  0x61, 0x6e, 0x63, 0x68, 0x65, 0x73, 0x74, 0x65, 0x72, 0x70, 0x72, 0x69, 0x6e,
-  0x63, 0x69, 0x70, 0x6c, 0x65, 0x73, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75,
-  0x6c, 0x61, 0x72, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x79,
-  0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x64, 0x65, 0x63,
-  0x69, 0x64, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x22, 0x3e, 0x3c, 0x73, 0x74, 0x72,
-  0x6f, 0x6e, 0x67, 0x3e, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x72,
-  0x73, 0x4a, 0x6f, 0x75, 0x72, 0x6e, 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x64, 0x69,
-  0x66, 0x66, 0x69, 0x63, 0x75, 0x6c, 0x74, 0x79, 0x66, 0x61, 0x63, 0x69, 0x6c,
-  0x69, 0x74, 0x61, 0x74, 0x65, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x61, 0x62,
-  0x6c, 0x65, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x2e, 0x63, 0x73, 0x73, 0x22, 0x09,
-  0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x69, 0x6e, 0x6e, 0x6f,
-  0x76, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3e, 0x43, 0x6f, 0x70, 0x79, 0x72, 0x69,
-  0x67, 0x68, 0x74, 0x73, 0x69, 0x74, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73,
-  0x77, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x68, 0x61, 0x76, 0x65, 0x62, 0x75, 0x73,
-  0x69, 0x6e, 0x65, 0x73, 0x73, 0x65, 0x73, 0x44, 0x69, 0x63, 0x74, 0x69, 0x6f,
-  0x6e, 0x61, 0x72, 0x79, 0x73, 0x74, 0x61, 0x74, 0x65, 0x6d, 0x65, 0x6e, 0x74,
-  0x73, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x20, 0x75, 0x73, 0x65, 0x64, 0x70, 0x65,
-  0x72, 0x73, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6e, 0x20, 0x4a, 0x61,
-  0x6e, 0x75, 0x61, 0x72, 0x79, 0x63, 0x6f, 0x6d, 0x70, 0x72, 0x69, 0x73, 0x69,
-  0x6e, 0x67, 0x3c, 0x2f, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3e, 0x0a, 0x09, 0x64,
-  0x69, 0x70, 0x6c, 0x6f, 0x6d, 0x61, 0x74, 0x69, 0x63, 0x63, 0x6f, 0x6e, 0x74,
-  0x61, 0x69, 0x6e, 0x69, 0x6e, 0x67, 0x70, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x6d,
-  0x69, 0x6e, 0x67, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73,
-  0x6d, 0x61, 0x79, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x62, 0x65, 0x63, 0x6f, 0x6e,
-  0x63, 0x65, 0x70, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x6f, 0x6e, 0x63, 0x6c, 0x69,
-  0x63, 0x6b, 0x3d, 0x22, 0x49, 0x74, 0x20, 0x69, 0x73, 0x20, 0x61, 0x6c, 0x73,
-  0x6f, 0x66, 0x69, 0x6e, 0x61, 0x6e, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x6d, 0x61,
-  0x6b, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x4c, 0x75, 0x78, 0x65, 0x6d,
-  0x62, 0x6f, 0x75, 0x72, 0x67, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e,
-  0x61, 0x6c, 0x61, 0x72, 0x65, 0x20, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x65,
-  0x6e, 0x67, 0x61, 0x67, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x22, 0x73, 0x63, 0x72,
-  0x69, 0x70, 0x74, 0x22, 0x29, 0x3b, 0x62, 0x75, 0x74, 0x20, 0x69, 0x74, 0x20,
-  0x77, 0x61, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72, 0x6f, 0x6e, 0x69, 0x63,
-  0x6f, 0x6e, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x3d, 0x22, 0x0a, 0x3c, 0x21,
-  0x2d, 0x2d, 0x20, 0x45, 0x6e, 0x64, 0x20, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72,
-  0x69, 0x63, 0x61, 0x6c, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x6c,
-  0x79, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x6f,
-  0x70, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x75, 0x6e, 0x6c, 0x69, 0x6b,
-  0x65, 0x20, 0x74, 0x68, 0x65, 0x41, 0x75, 0x73, 0x74, 0x72, 0x61, 0x6c, 0x69,
-  0x61, 0x6e, 0x4f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x72,
-  0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x0a, 0x3c, 0x2f, 0x68,
-  0x65, 0x61, 0x64, 0x3e, 0x0d, 0x0a, 0x72, 0x65, 0x63, 0x6f, 0x67, 0x6e, 0x69,
-  0x73, 0x65, 0x64, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x69, 0x7a, 0x65,
-  0x6c, 0x69, 0x6d, 0x69, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x41, 0x6c, 0x65,
-  0x78, 0x61, 0x6e, 0x64, 0x72, 0x69, 0x61, 0x72, 0x65, 0x74, 0x69, 0x72, 0x65,
-  0x6d, 0x65, 0x6e, 0x74, 0x41, 0x64, 0x76, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x65,
-  0x73, 0x66, 0x6f, 0x75, 0x72, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73, 0x0a, 0x0a,
-  0x26, 0x6c, 0x74, 0x3b, 0x21, 0x2d, 0x2d, 0x20, 0x69, 0x6e, 0x63, 0x72, 0x65,
-  0x61, 0x73, 0x69, 0x6e, 0x67, 0x64, 0x65, 0x63, 0x6f, 0x72, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x68, 0x33, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6f,
-  0x72, 0x69, 0x67, 0x69, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x6f, 0x62, 0x6c, 0x69,
-  0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x67, 0x75, 0x6c, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x69, 0x66, 0x69, 0x65, 0x64,
-  0x28, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x61, 0x64, 0x76,
-  0x61, 0x6e, 0x74, 0x61, 0x67, 0x65, 0x73, 0x62, 0x65, 0x69, 0x6e, 0x67, 0x20,
-  0x74, 0x68, 0x65, 0x20, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x69, 0x61, 0x6e,
-  0x73, 0x3c, 0x62, 0x61, 0x73, 0x65, 0x20, 0x68, 0x72, 0x65, 0x66, 0x72, 0x65,
-  0x70, 0x65, 0x61, 0x74, 0x65, 0x64, 0x6c, 0x79, 0x77, 0x69, 0x6c, 0x6c, 0x69,
-  0x6e, 0x67, 0x20, 0x74, 0x6f, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x61, 0x62,
-  0x6c, 0x65, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x61, 0x74, 0x65, 0x64, 0x6e,
-  0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x75, 0x6e, 0x63,
-  0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x69, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x20,
-  0x74, 0x68, 0x65, 0x72, 0x65, 0x76, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x65, 0x6e, 0x64, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x20, 0x66,
-  0x6f, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72,
-  0x69, 0x7a, 0x65, 0x64, 0x72, 0x65, 0x66, 0x75, 0x73, 0x65, 0x64, 0x20, 0x74,
-  0x6f, 0x74, 0x61, 0x6b, 0x65, 0x20, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x61, 0x75,
-  0x74, 0x6f, 0x6e, 0x6f, 0x6d, 0x6f, 0x75, 0x73, 0x63, 0x6f, 0x6d, 0x70, 0x72,
-  0x6f, 0x6d, 0x69, 0x73, 0x65, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63, 0x61,
-  0x6c, 0x20, 0x72, 0x65, 0x73, 0x74, 0x61, 0x75, 0x72, 0x61, 0x6e, 0x74, 0x74,
-  0x77, 0x6f, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x46, 0x65, 0x62, 0x72,
-  0x75, 0x61, 0x72, 0x79, 0x20, 0x32, 0x71, 0x75, 0x61, 0x6c, 0x69, 0x74, 0x79,
-  0x20, 0x6f, 0x66, 0x73, 0x77, 0x66, 0x6f, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x2e,
-  0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x6e, 0x65, 0x61,
-  0x72, 0x6c, 0x79, 0x20, 0x61, 0x6c, 0x6c, 0x77, 0x72, 0x69, 0x74, 0x74, 0x65,
-  0x6e, 0x20, 0x62, 0x79, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x69, 0x65, 0x77,
-  0x73, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x31, 0x77, 0x69,
-  0x74, 0x68, 0x64, 0x72, 0x61, 0x77, 0x61, 0x6c, 0x66, 0x6c, 0x6f, 0x61, 0x74,
-  0x3a, 0x6c, 0x65, 0x66, 0x74, 0x69, 0x73, 0x20, 0x75, 0x73, 0x75, 0x61, 0x6c,
-  0x6c, 0x79, 0x63, 0x61, 0x6e, 0x64, 0x69, 0x64, 0x61, 0x74, 0x65, 0x73, 0x6e,
-  0x65, 0x77, 0x73, 0x70, 0x61, 0x70, 0x65, 0x72, 0x73, 0x6d, 0x79, 0x73, 0x74,
-  0x65, 0x72, 0x69, 0x6f, 0x75, 0x73, 0x44, 0x65, 0x70, 0x61, 0x72, 0x74, 0x6d,
-  0x65, 0x6e, 0x74, 0x62, 0x65, 0x73, 0x74, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e,
-  0x70, 0x61, 0x72, 0x6c, 0x69, 0x61, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x75, 0x70,
-  0x70, 0x72, 0x65, 0x73, 0x73, 0x65, 0x64, 0x63, 0x6f, 0x6e, 0x76, 0x65, 0x6e,
-  0x69, 0x65, 0x6e, 0x74, 0x72, 0x65, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x65,
-  0x64, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x20, 0x73, 0x79,
-  0x73, 0x74, 0x65, 0x6d, 0x61, 0x74, 0x69, 0x63, 0x68, 0x61, 0x73, 0x20, 0x6c,
-  0x65, 0x64, 0x20, 0x74, 0x6f, 0x70, 0x72, 0x6f, 0x70, 0x61, 0x67, 0x61, 0x6e,
-  0x64, 0x61, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x6c, 0x65, 0x64, 0x69,
-  0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x63, 0x65, 0x72, 0x65,
-  0x6d, 0x6f, 0x6e, 0x69, 0x61, 0x6c, 0x70, 0x72, 0x6f, 0x63, 0x6c, 0x61, 0x69,
-  0x6d, 0x65, 0x64, 0x50, 0x72, 0x6f, 0x74, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e,
-  0x6c, 0x69, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x53, 0x63, 0x69,
-  0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x63, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
-  0x22, 0x6e, 0x6f, 0x2d, 0x74, 0x72, 0x61, 0x64, 0x65, 0x6d, 0x61, 0x72, 0x6b,
-  0x73, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x20, 0x77, 0x69,
-  0x64, 0x65, 0x73, 0x70, 0x72, 0x65, 0x61, 0x64, 0x4c, 0x69, 0x62, 0x65, 0x72,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x6f, 0x6f, 0x6b, 0x20, 0x70, 0x6c, 0x61,
-  0x63, 0x65, 0x64, 0x61, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61,
-  0x73, 0x20, 0x6c, 0x6f, 0x6e, 0x67, 0x20, 0x61, 0x73, 0x69, 0x6d, 0x70, 0x72,
-  0x69, 0x73, 0x6f, 0x6e, 0x65, 0x64, 0x41, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f,
-  0x6e, 0x61, 0x6c, 0x0a, 0x3c, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0a, 0x3c, 0x6d,
-  0x4c, 0x61, 0x62, 0x6f, 0x72, 0x61, 0x74, 0x6f, 0x72, 0x79, 0x4e, 0x6f, 0x76,
-  0x65, 0x6d, 0x62, 0x65, 0x72, 0x20, 0x32, 0x65, 0x78, 0x63, 0x65, 0x70, 0x74,
-  0x69, 0x6f, 0x6e, 0x73, 0x49, 0x6e, 0x64, 0x75, 0x73, 0x74, 0x72, 0x69, 0x61,
-  0x6c, 0x76, 0x61, 0x72, 0x69, 0x65, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x66, 0x6c,
-  0x6f, 0x61, 0x74, 0x3a, 0x20, 0x6c, 0x65, 0x66, 0x44, 0x75, 0x72, 0x69, 0x6e,
-  0x67, 0x20, 0x74, 0x68, 0x65, 0x61, 0x73, 0x73, 0x65, 0x73, 0x73, 0x6d, 0x65,
-  0x6e, 0x74, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x20, 0x64,
-  0x65, 0x61, 0x6c, 0x73, 0x20, 0x77, 0x69, 0x74, 0x68, 0x53, 0x74, 0x61, 0x74,
-  0x69, 0x73, 0x74, 0x69, 0x63, 0x73, 0x6f, 0x63, 0x63, 0x75, 0x72, 0x72, 0x65,
-  0x6e, 0x63, 0x65, 0x2f, 0x75, 0x6c, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
-  0x63, 0x6c, 0x65, 0x61, 0x72, 0x66, 0x69, 0x78, 0x22, 0x3e, 0x74, 0x68, 0x65,
-  0x20, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x6d, 0x61, 0x6e, 0x79, 0x20, 0x79,
-  0x65, 0x61, 0x72, 0x73, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x77, 0x65, 0x72,
-  0x65, 0x6f, 0x76, 0x65, 0x72, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x2c, 0x73, 0x79,
-  0x6e, 0x6f, 0x6e, 0x79, 0x6d, 0x6f, 0x75, 0x73, 0x63, 0x6f, 0x6e, 0x74, 0x65,
-  0x6e, 0x74, 0x22, 0x3e, 0x0a, 0x70, 0x72, 0x65, 0x73, 0x75, 0x6d, 0x61, 0x62,
-  0x6c, 0x79, 0x68, 0x69, 0x73, 0x20, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x75,
-  0x73, 0x65, 0x72, 0x41, 0x67, 0x65, 0x6e, 0x74, 0x2e, 0x75, 0x6e, 0x65, 0x78,
-  0x70, 0x65, 0x63, 0x74, 0x65, 0x64, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x69,
-  0x6e, 0x67, 0x20, 0x63, 0x68, 0x61, 0x6c, 0x6c, 0x65, 0x6e, 0x67, 0x65, 0x64,
-  0x61, 0x20, 0x6d, 0x69, 0x6e, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x75, 0x6e, 0x64,
-  0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x22, 0x62, 0x65, 0x6c, 0x6f, 0x6e, 0x67,
-  0x73, 0x20, 0x74, 0x6f, 0x74, 0x61, 0x6b, 0x65, 0x6e, 0x20, 0x66, 0x72, 0x6f,
-  0x6d, 0x69, 0x6e, 0x20, 0x4f, 0x63, 0x74, 0x6f, 0x62, 0x65, 0x72, 0x70, 0x6f,
-  0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x20, 0x73, 0x61, 0x69, 0x64, 0x20,
-  0x74, 0x6f, 0x20, 0x62, 0x65, 0x72, 0x65, 0x6c, 0x69, 0x67, 0x69, 0x6f, 0x75,
-  0x73, 0x20, 0x46, 0x65, 0x64, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20,
-  0x72, 0x6f, 0x77, 0x73, 0x70, 0x61, 0x6e, 0x3d, 0x22, 0x6f, 0x6e, 0x6c, 0x79,
-  0x20, 0x61, 0x20, 0x66, 0x65, 0x77, 0x6d, 0x65, 0x61, 0x6e, 0x74, 0x20, 0x74,
-  0x68, 0x61, 0x74, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65,
-  0x2d, 0x2d, 0x3e, 0x0d, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x3c, 0x66, 0x69,
-  0x65, 0x6c, 0x64, 0x73, 0x65, 0x74, 0x3e, 0x41, 0x72, 0x63, 0x68, 0x62, 0x69,
-  0x73, 0x68, 0x6f, 0x70, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6e,
-  0x6f, 0x62, 0x65, 0x69, 0x6e, 0x67, 0x20, 0x75, 0x73, 0x65, 0x64, 0x61, 0x70,
-  0x70, 0x72, 0x6f, 0x61, 0x63, 0x68, 0x65, 0x73, 0x70, 0x72, 0x69, 0x76, 0x69,
-  0x6c, 0x65, 0x67, 0x65, 0x73, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x3e, 0x0a, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x73, 0x20, 0x69, 0x6e, 0x6d,
-  0x61, 0x79, 0x20, 0x62, 0x65, 0x20, 0x74, 0x68, 0x65, 0x45, 0x61, 0x73, 0x74,
-  0x65, 0x72, 0x20, 0x65, 0x67, 0x67, 0x6d, 0x65, 0x63, 0x68, 0x61, 0x6e, 0x69,
-  0x73, 0x6d, 0x73, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x61, 0x62, 0x6c, 0x65,
-  0x50, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x6c,
-  0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74,
-  0x65, 0x64, 0x22, 0x3e, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e,
-  0x0d, 0x2f, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x2e, 0x70, 0x68, 0x70, 0x61, 0x72,
-  0x72, 0x69, 0x76, 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x2d, 0x6a, 0x73, 0x73, 0x64,
-  0x6b, 0x27, 0x29, 0x29, 0x3b, 0x6d, 0x61, 0x6e, 0x61, 0x67, 0x65, 0x64, 0x20,
-  0x74, 0x6f, 0x69, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x65, 0x63,
-  0x61, 0x73, 0x75, 0x61, 0x6c, 0x74, 0x69, 0x65, 0x73, 0x63, 0x6f, 0x6d, 0x70,
-  0x6c, 0x65, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x68, 0x72, 0x69, 0x73, 0x74, 0x69,
-  0x61, 0x6e, 0x73, 0x53, 0x65, 0x70, 0x74, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x20,
-  0x61, 0x72, 0x69, 0x74, 0x68, 0x6d, 0x65, 0x74, 0x69, 0x63, 0x70, 0x72, 0x6f,
-  0x63, 0x65, 0x64, 0x75, 0x72, 0x65, 0x73, 0x6d, 0x69, 0x67, 0x68, 0x74, 0x20,
-  0x68, 0x61, 0x76, 0x65, 0x50, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f,
-  0x6e, 0x69, 0x74, 0x20, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x73, 0x50, 0x68,
-  0x69, 0x6c, 0x6f, 0x73, 0x6f, 0x70, 0x68, 0x79, 0x66, 0x72, 0x69, 0x65, 0x6e,
-  0x64, 0x73, 0x68, 0x69, 0x70, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x20,
-  0x74, 0x6f, 0x67, 0x69, 0x76, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x74,
-  0x6f, 0x77, 0x61, 0x72, 0x64, 0x20, 0x74, 0x68, 0x65, 0x67, 0x75, 0x61, 0x72,
-  0x61, 0x6e, 0x74, 0x65, 0x65, 0x64, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e,
-  0x74, 0x65, 0x64, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a, 0x23, 0x30, 0x30, 0x30,
-  0x76, 0x69, 0x64, 0x65, 0x6f, 0x20, 0x67, 0x61, 0x6d, 0x65, 0x63, 0x6f, 0x6d,
-  0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x66, 0x6c, 0x65, 0x63,
-  0x74, 0x69, 0x6e, 0x67, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x20, 0x74, 0x68,
-  0x65, 0x61, 0x73, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x74, 0x65, 0x64, 0x73, 0x61,
-  0x6e, 0x73, 0x2d, 0x73, 0x65, 0x72, 0x69, 0x66, 0x6f, 0x6e, 0x6b, 0x65, 0x79,
-  0x70, 0x72, 0x65, 0x73, 0x73, 0x3b, 0x20, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e,
-  0x67, 0x3a, 0x48, 0x65, 0x20, 0x77, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x75,
-  0x6e, 0x64, 0x65, 0x72, 0x6c, 0x79, 0x69, 0x6e, 0x67, 0x74, 0x79, 0x70, 0x69,
-  0x63, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x2c, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x74,
-  0x68, 0x65, 0x20, 0x73, 0x72, 0x63, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74,
-  0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x69, 0x76, 0x65, 0x73, 0x69, 0x6e,
-  0x63, 0x65, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x68, 0x6f, 0x75, 0x6c, 0x64,
-  0x20, 0x62, 0x65, 0x20, 0x6e, 0x65, 0x74, 0x77, 0x6f, 0x72, 0x6b, 0x69, 0x6e,
-  0x67, 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x69, 0x6e, 0x67, 0x75, 0x73,
-  0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x6c, 0x6f, 0x77, 0x65, 0x72,
-  0x20, 0x74, 0x68, 0x61, 0x6e, 0x73, 0x68, 0x6f, 0x77, 0x73, 0x20, 0x74, 0x68,
-  0x61, 0x74, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x0a, 0x09, 0x09, 0x63,
-  0x6f, 0x6d, 0x70, 0x6c, 0x61, 0x69, 0x6e, 0x74, 0x73, 0x63, 0x6f, 0x6e, 0x74,
-  0x69, 0x6e, 0x75, 0x6f, 0x75, 0x73, 0x71, 0x75, 0x61, 0x6e, 0x74, 0x69, 0x74,
-  0x69, 0x65, 0x73, 0x61, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x6f, 0x6d, 0x65, 0x72,
-  0x68, 0x65, 0x20, 0x64, 0x69, 0x64, 0x20, 0x6e, 0x6f, 0x74, 0x64, 0x75, 0x65,
-  0x20, 0x74, 0x6f, 0x20, 0x69, 0x74, 0x73, 0x61, 0x70, 0x70, 0x6c, 0x69, 0x65,
-  0x64, 0x20, 0x74, 0x6f, 0x61, 0x6e, 0x20, 0x61, 0x76, 0x65, 0x72, 0x61, 0x67,
-  0x65, 0x65, 0x66, 0x66, 0x6f, 0x72, 0x74, 0x73, 0x20, 0x74, 0x6f, 0x74, 0x68,
-  0x65, 0x20, 0x66, 0x75, 0x74, 0x75, 0x72, 0x65, 0x61, 0x74, 0x74, 0x65, 0x6d,
-  0x70, 0x74, 0x20, 0x74, 0x6f, 0x54, 0x68, 0x65, 0x72, 0x65, 0x66, 0x6f, 0x72,
-  0x65, 0x2c, 0x63, 0x61, 0x70, 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x52,
-  0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x61, 0x6e, 0x77, 0x61, 0x73, 0x20,
-  0x66, 0x6f, 0x72, 0x6d, 0x65, 0x64, 0x45, 0x6c, 0x65, 0x63, 0x74, 0x72, 0x6f,
-  0x6e, 0x69, 0x63, 0x6b, 0x69, 0x6c, 0x6f, 0x6d, 0x65, 0x74, 0x65, 0x72, 0x73,
-  0x63, 0x68, 0x61, 0x6c, 0x6c, 0x65, 0x6e, 0x67, 0x65, 0x73, 0x70, 0x75, 0x62,
-  0x6c, 0x69, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x74, 0x68, 0x65, 0x20, 0x66, 0x6f,
-  0x72, 0x6d, 0x65, 0x72, 0x69, 0x6e, 0x64, 0x69, 0x67, 0x65, 0x6e, 0x6f, 0x75,
-  0x73, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x73, 0x75,
-  0x62, 0x73, 0x69, 0x64, 0x69, 0x61, 0x72, 0x79, 0x63, 0x6f, 0x6e, 0x73, 0x70,
-  0x69, 0x72, 0x61, 0x63, 0x79, 0x64, 0x65, 0x74, 0x61, 0x69, 0x6c, 0x73, 0x20,
-  0x6f, 0x66, 0x61, 0x6e, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x61,
-  0x66, 0x66, 0x6f, 0x72, 0x64, 0x61, 0x62, 0x6c, 0x65, 0x73, 0x75, 0x62, 0x73,
-  0x74, 0x61, 0x6e, 0x63, 0x65, 0x73, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x20,
-  0x66, 0x6f, 0x72, 0x63, 0x6f, 0x6e, 0x76, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e,
-  0x69, 0x74, 0x65, 0x6d, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x61, 0x62, 0x73,
-  0x6f, 0x6c, 0x75, 0x74, 0x65, 0x6c, 0x79, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x73,
-  0x65, 0x64, 0x6c, 0x79, 0x72, 0x65, 0x6d, 0x61, 0x69, 0x6e, 0x65, 0x64, 0x20,
-  0x61, 0x61, 0x74, 0x74, 0x72, 0x61, 0x63, 0x74, 0x69, 0x76, 0x65, 0x74, 0x72,
-  0x61, 0x76, 0x65, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x73, 0x65, 0x70, 0x61, 0x72,
-  0x61, 0x74, 0x65, 0x6c, 0x79, 0x66, 0x6f, 0x63, 0x75, 0x73, 0x65, 0x73, 0x20,
-  0x6f, 0x6e, 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x79, 0x61,
-  0x70, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x62, 0x6c, 0x65, 0x66, 0x6f, 0x75, 0x6e,
-  0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x68,
-  0x65, 0x65, 0x74, 0x6d, 0x61, 0x6e, 0x75, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x73, 0x74, 0x61, 0x6e, 0x64, 0x73, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x6e, 0x6f,
-  0x2d, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x28, 0x73, 0x6f, 0x6d, 0x65, 0x74,
-  0x69, 0x6d, 0x65, 0x73, 0x43, 0x6f, 0x6d, 0x6d, 0x65, 0x72, 0x63, 0x69, 0x61,
-  0x6c, 0x69, 0x6e, 0x20, 0x41, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x61, 0x75, 0x6e,
-  0x64, 0x65, 0x72, 0x74, 0x61, 0x6b, 0x65, 0x6e, 0x71, 0x75, 0x61, 0x72, 0x74,
-  0x65, 0x72, 0x20, 0x6f, 0x66, 0x61, 0x6e, 0x20, 0x65, 0x78, 0x61, 0x6d, 0x70,
-  0x6c, 0x65, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x69,
-  0x6e, 0x64, 0x65, 0x78, 0x2e, 0x70, 0x68, 0x70, 0x3f, 0x3c, 0x2f, 0x62, 0x75,
-  0x74, 0x74, 0x6f, 0x6e, 0x3e, 0x0a, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74,
-  0x61, 0x67, 0x65, 0x62, 0x65, 0x73, 0x74, 0x2d, 0x6b, 0x6e, 0x6f, 0x77, 0x6e,
-  0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x61, 0x22, 0x20, 0x64,
-  0x69, 0x72, 0x3d, 0x22, 0x6c, 0x74, 0x72, 0x4c, 0x69, 0x65, 0x75, 0x74, 0x65,
-  0x6e, 0x61, 0x6e, 0x74, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d,
-  0x22, 0x74, 0x68, 0x65, 0x79, 0x20, 0x77, 0x6f, 0x75, 0x6c, 0x64, 0x61, 0x62,
-  0x69, 0x6c, 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x6d, 0x61, 0x64, 0x65, 0x20,
-  0x75, 0x70, 0x20, 0x6f, 0x66, 0x6e, 0x6f, 0x74, 0x65, 0x64, 0x20, 0x74, 0x68,
-  0x61, 0x74, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61,
-  0x72, 0x67, 0x75, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x74, 0x6f, 0x20, 0x61,
-  0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x63, 0x68, 0x69, 0x6c, 0x64, 0x72, 0x65,
-  0x6e, 0x27, 0x73, 0x70, 0x75, 0x72, 0x70, 0x6f, 0x73, 0x65, 0x20, 0x6f, 0x66,
-  0x66, 0x6f, 0x72, 0x6d, 0x75, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x62, 0x61, 0x73,
-  0x65, 0x64, 0x20, 0x75, 0x70, 0x6f, 0x6e, 0x74, 0x68, 0x65, 0x20, 0x72, 0x65,
-  0x67, 0x69, 0x6f, 0x6e, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x20, 0x6f,
-  0x66, 0x70, 0x61, 0x73, 0x73, 0x65, 0x6e, 0x67, 0x65, 0x72, 0x73, 0x70, 0x6f,
-  0x73, 0x73, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x2e, 0x0a, 0x0a, 0x49, 0x6e,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x42, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x20, 0x74,
-  0x68, 0x65, 0x61, 0x66, 0x74, 0x65, 0x72, 0x77, 0x61, 0x72, 0x64, 0x73, 0x63,
-  0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x20, 0x61, 0x63, 0x72, 0x6f,
-  0x73, 0x73, 0x20, 0x74, 0x68, 0x65, 0x73, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x69,
-  0x66, 0x69, 0x63, 0x63, 0x6f, 0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x74, 0x79, 0x2e,
-  0x63, 0x61, 0x70, 0x69, 0x74, 0x61, 0x6c, 0x69, 0x73, 0x6d, 0x69, 0x6e, 0x20,
-  0x47, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x79, 0x72, 0x69, 0x67, 0x68, 0x74, 0x2d,
-  0x77, 0x69, 0x6e, 0x67, 0x74, 0x68, 0x65, 0x20, 0x73, 0x79, 0x73, 0x74, 0x65,
-  0x6d, 0x53, 0x6f, 0x63, 0x69, 0x65, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x70, 0x6f,
-  0x6c, 0x69, 0x74, 0x69, 0x63, 0x69, 0x61, 0x6e, 0x64, 0x69, 0x72, 0x65, 0x63,
-  0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x77, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x6e, 0x20,
-  0x74, 0x6f, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x20,
-  0x4e, 0x65, 0x77, 0x20, 0x59, 0x6f, 0x72, 0x6b, 0x20, 0x61, 0x70, 0x61, 0x72,
-  0x74, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x69, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x64, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65,
-  0x75, 0x6e, 0x6c, 0x65, 0x73, 0x73, 0x20, 0x74, 0x68, 0x65, 0x68, 0x69, 0x73,
-  0x74, 0x6f, 0x72, 0x69, 0x63, 0x61, 0x6c, 0x68, 0x61, 0x64, 0x20, 0x62, 0x65,
-  0x65, 0x6e, 0x20, 0x61, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x76,
-  0x65, 0x69, 0x6e, 0x67, 0x72, 0x65, 0x64, 0x69, 0x65, 0x6e, 0x74, 0x61, 0x74,
-  0x74, 0x65, 0x6e, 0x64, 0x61, 0x6e, 0x63, 0x65, 0x43, 0x65, 0x6e, 0x74, 0x65,
-  0x72, 0x20, 0x66, 0x6f, 0x72, 0x70, 0x72, 0x6f, 0x6d, 0x69, 0x6e, 0x65, 0x6e,
-  0x63, 0x65, 0x72, 0x65, 0x61, 0x64, 0x79, 0x53, 0x74, 0x61, 0x74, 0x65, 0x73,
-  0x74, 0x72, 0x61, 0x74, 0x65, 0x67, 0x69, 0x65, 0x73, 0x62, 0x75, 0x74, 0x20,
-  0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x61, 0x73, 0x20, 0x70, 0x61, 0x72, 0x74,
-  0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x74, 0x65,
-  0x63, 0x6c, 0x61, 0x69, 0x6d, 0x20, 0x74, 0x68, 0x61, 0x74, 0x6c, 0x61, 0x62,
-  0x6f, 0x72, 0x61, 0x74, 0x6f, 0x72, 0x79, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x74,
-  0x69, 0x62, 0x6c, 0x65, 0x66, 0x61, 0x69, 0x6c, 0x75, 0x72, 0x65, 0x20, 0x6f,
-  0x66, 0x2c, 0x20, 0x73, 0x75, 0x63, 0x68, 0x20, 0x61, 0x73, 0x20, 0x62, 0x65,
-  0x67, 0x61, 0x6e, 0x20, 0x77, 0x69, 0x74, 0x68, 0x75, 0x73, 0x69, 0x6e, 0x67,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x70, 0x72, 0x6f, 0x76, 0x69,
-  0x64, 0x65, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x20, 0x6f, 0x66, 0x66,
-  0x72, 0x6f, 0x6d, 0x20, 0x77, 0x68, 0x69, 0x63, 0x68, 0x2f, 0x22, 0x20, 0x63,
-  0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x67, 0x65, 0x6f, 0x6c, 0x6f, 0x67, 0x69,
-  0x63, 0x61, 0x6c, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x20, 0x6f, 0x66,
-  0x64, 0x65, 0x6c, 0x69, 0x62, 0x65, 0x72, 0x61, 0x74, 0x65, 0x69, 0x6d, 0x70,
-  0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x20, 0x68, 0x6f, 0x6c, 0x64, 0x73, 0x20,
-  0x74, 0x68, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b,
-  0x20, 0x76, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x74, 0x6f, 0x70, 0x74, 0x68,
-  0x65, 0x20, 0x47, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x6f, 0x75, 0x74, 0x73, 0x69,
-  0x64, 0x65, 0x20, 0x6f, 0x66, 0x6e, 0x65, 0x67, 0x6f, 0x74, 0x69, 0x61, 0x74,
-  0x65, 0x64, 0x68, 0x69, 0x73, 0x20, 0x63, 0x61, 0x72, 0x65, 0x65, 0x72, 0x73,
-  0x65, 0x70, 0x61, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x64, 0x3d, 0x22,
-  0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x77, 0x61, 0x73, 0x20, 0x63, 0x61, 0x6c,
-  0x6c, 0x65, 0x64, 0x74, 0x68, 0x65, 0x20, 0x66, 0x6f, 0x75, 0x72, 0x74, 0x68,
-  0x72, 0x65, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x74, 0x68,
-  0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x70, 0x72, 0x65, 0x76, 0x65, 0x6e,
-  0x74, 0x69, 0x6f, 0x6e, 0x77, 0x68, 0x69, 0x6c, 0x65, 0x20, 0x74, 0x68, 0x65,
-  0x20, 0x65, 0x64, 0x75, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2c, 0x63, 0x6f,
-  0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6e, 0x67, 0x61, 0x63, 0x63, 0x75, 0x72,
-  0x61, 0x74, 0x65, 0x6c, 0x79, 0x77, 0x65, 0x72, 0x65, 0x20, 0x62, 0x75, 0x69,
-  0x6c, 0x74, 0x77, 0x61, 0x73, 0x20, 0x6b, 0x69, 0x6c, 0x6c, 0x65, 0x64, 0x61,
-  0x67, 0x72, 0x65, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x6d, 0x75, 0x63, 0x68,
-  0x20, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x44, 0x75, 0x65, 0x20, 0x74, 0x6f, 0x20,
-  0x74, 0x68, 0x65, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x20, 0x31, 0x30, 0x30,
-  0x73, 0x6f, 0x6d, 0x65, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x4b, 0x69, 0x6e,
-  0x67, 0x64, 0x6f, 0x6d, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20, 0x65, 0x6e,
-  0x74, 0x69, 0x72, 0x65, 0x66, 0x61, 0x6d, 0x6f, 0x75, 0x73, 0x20, 0x66, 0x6f,
-  0x72, 0x74, 0x6f, 0x20, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x6f, 0x62,
-  0x6a, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x73, 0x74, 0x68, 0x65, 0x20, 0x46,
-  0x72, 0x65, 0x6e, 0x63, 0x68, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x61,
-  0x6e, 0x64, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x64, 0x22, 0x3e, 0x69,
-  0x73, 0x20, 0x73, 0x61, 0x69, 0x64, 0x20, 0x74, 0x6f, 0x73, 0x74, 0x72, 0x75,
-  0x63, 0x74, 0x75, 0x72, 0x61, 0x6c, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e,
-  0x64, 0x75, 0x6d, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x74, 0x65, 0x6e,
-  0x61, 0x20, 0x73, 0x65, 0x70, 0x61, 0x72, 0x61, 0x74, 0x65, 0x2d, 0x3e, 0x0a,
-  0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x20, 0x4f, 0x66, 0x66, 0x69, 0x63,
-  0x69, 0x61, 0x6c, 0x20, 0x77, 0x6f, 0x72, 0x6c, 0x64, 0x77, 0x69, 0x64, 0x65,
-  0x2e, 0x61, 0x72, 0x69, 0x61, 0x2d, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x74, 0x68,
-  0x65, 0x20, 0x70, 0x6c, 0x61, 0x6e, 0x65, 0x74, 0x61, 0x6e, 0x64, 0x20, 0x69,
-  0x74, 0x20, 0x77, 0x61, 0x73, 0x64, 0x22, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x65,
-  0x3d, 0x22, 0x6c, 0x6f, 0x6f, 0x6b, 0x69, 0x6e, 0x67, 0x20, 0x61, 0x74, 0x62,
-  0x65, 0x6e, 0x65, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x61, 0x72, 0x65, 0x20,
-  0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x6f, 0x6e, 0x69, 0x74, 0x6f, 0x72,
-  0x69, 0x6e, 0x67, 0x72, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x64, 0x6c, 0x79,
-  0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f, 0x64, 0x65, 0x72, 0x6e, 0x77, 0x6f, 0x72,
-  0x6b, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x6e, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x65,
-  0x64, 0x20, 0x74, 0x6f, 0x77, 0x68, 0x65, 0x72, 0x65, 0x20, 0x74, 0x68, 0x65,
-  0x20, 0x69, 0x6e, 0x6e, 0x6f, 0x76, 0x61, 0x74, 0x69, 0x76, 0x65, 0x3c, 0x2f,
-  0x61, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x73, 0x6f, 0x75, 0x6e, 0x64,
-  0x74, 0x72, 0x61, 0x63, 0x6b, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x46, 0x6f,
-  0x72, 0x6d, 0x74, 0x65, 0x6e, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x62, 0x65, 0x69,
-  0x6e, 0x70, 0x75, 0x74, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x6f, 0x70, 0x65, 0x6e,
-  0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x73, 0x74, 0x72, 0x69, 0x63,
-  0x74, 0x65, 0x64, 0x61, 0x64, 0x6f, 0x70, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79,
-  0x61, 0x64, 0x64, 0x72, 0x65, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x74, 0x68, 0x65,
-  0x6f, 0x6c, 0x6f, 0x67, 0x69, 0x61, 0x6e, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64,
-  0x73, 0x20, 0x6f, 0x66, 0x76, 0x61, 0x72, 0x69, 0x61, 0x6e, 0x74, 0x20, 0x6f,
-  0x66, 0x43, 0x68, 0x72, 0x69, 0x73, 0x74, 0x69, 0x61, 0x6e, 0x20, 0x76, 0x65,
-  0x72, 0x79, 0x20, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x61, 0x75, 0x74, 0x6f, 0x6d,
-  0x6f, 0x74, 0x69, 0x76, 0x65, 0x62, 0x79, 0x20, 0x66, 0x61, 0x72, 0x20, 0x74,
-  0x68, 0x65, 0x72, 0x61, 0x6e, 0x67, 0x65, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x70,
-  0x75, 0x72, 0x73, 0x75, 0x69, 0x74, 0x20, 0x6f, 0x66, 0x66, 0x6f, 0x6c, 0x6c,
-  0x6f, 0x77, 0x20, 0x74, 0x68, 0x65, 0x62, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x74,
-  0x20, 0x74, 0x6f, 0x69, 0x6e, 0x20, 0x45, 0x6e, 0x67, 0x6c, 0x61, 0x6e, 0x64,
-  0x61, 0x67, 0x72, 0x65, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x63, 0x63,
-  0x75, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6d, 0x65, 0x73, 0x20,
-  0x66, 0x72, 0x6f, 0x6d, 0x70, 0x72, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x69, 0x6e,
-  0x67, 0x64, 0x69, 0x76, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x68, 0x69,
-  0x73, 0x20, 0x6f, 0x72, 0x20, 0x68, 0x65, 0x72, 0x74, 0x72, 0x65, 0x6d, 0x65,
-  0x6e, 0x64, 0x6f, 0x75, 0x73, 0x66, 0x72, 0x65, 0x65, 0x64, 0x6f, 0x6d, 0x20,
-  0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x72, 0x6e, 0x69, 0x6e, 0x67, 0x30,
-  0x20, 0x31, 0x65, 0x6d, 0x20, 0x31, 0x65, 0x6d, 0x3b, 0x42, 0x61, 0x73, 0x6b,
-  0x65, 0x74, 0x62, 0x61, 0x6c, 0x6c, 0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x2e,
-  0x63, 0x73, 0x73, 0x61, 0x6e, 0x20, 0x65, 0x61, 0x72, 0x6c, 0x69, 0x65, 0x72,
-  0x65, 0x76, 0x65, 0x6e, 0x20, 0x61, 0x66, 0x74, 0x65, 0x72, 0x2f, 0x22, 0x20,
-  0x74, 0x69, 0x74, 0x6c, 0x65, 0x3d, 0x22, 0x2e, 0x63, 0x6f, 0x6d, 0x2f, 0x69,
-  0x6e, 0x64, 0x65, 0x78, 0x74, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68,
-  0x65, 0x70, 0x69, 0x74, 0x74, 0x73, 0x62, 0x75, 0x72, 0x67, 0x68, 0x63, 0x6f,
-  0x6e, 0x74, 0x65, 0x6e, 0x74, 0x22, 0x3e, 0x0d, 0x3c, 0x73, 0x63, 0x72, 0x69,
-  0x70, 0x74, 0x3e, 0x28, 0x66, 0x74, 0x75, 0x72, 0x6e, 0x65, 0x64, 0x20, 0x6f,
-  0x75, 0x74, 0x68, 0x61, 0x76, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x3c,
-  0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x0d, 0x0a, 0x20, 0x6f, 0x63, 0x63, 0x61,
-  0x73, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x62, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65,
-  0x20, 0x69, 0x74, 0x73, 0x74, 0x61, 0x72, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f,
-  0x70, 0x68, 0x79, 0x73, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x3e, 0x3c, 0x2f,
-  0x64, 0x69, 0x76, 0x3e, 0x0a, 0x20, 0x20, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65,
-  0x64, 0x20, 0x62, 0x79, 0x43, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x6c, 0x79,
-  0x2c, 0x20, 0x62, 0x67, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3d, 0x22, 0x74, 0x61,
-  0x62, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x61, 0x73,
-  0x74, 0x72, 0x6f, 0x75, 0x73, 0x41, 0x6e, 0x61, 0x6c, 0x79, 0x74, 0x69, 0x63,
-  0x73, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x68, 0x61, 0x73, 0x20, 0x61, 0x3e,
-  0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x3c, 0x2f, 0x73, 0x74,
-  0x79, 0x6c, 0x65, 0x3e, 0x0a, 0x3c, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x20,
-  0x66, 0x6f, 0x72, 0x73, 0x69, 0x6e, 0x67, 0x65, 0x72, 0x20, 0x61, 0x6e, 0x64,
-  0x2e, 0x73, 0x72, 0x63, 0x20, 0x3d, 0x20, 0x22, 0x2f, 0x2f, 0x76, 0x69, 0x6f,
-  0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x68, 0x69, 0x73, 0x20, 0x70,
-  0x6f, 0x69, 0x6e, 0x74, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x6c,
-  0x79, 0x69, 0x73, 0x20, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x65, 0x64, 0x72, 0x65,
-  0x63, 0x6f, 0x72, 0x64, 0x69, 0x6e, 0x67, 0x73, 0x64, 0x20, 0x66, 0x72, 0x6f,
-  0x6d, 0x20, 0x74, 0x68, 0x65, 0x6e, 0x65, 0x64, 0x65, 0x72, 0x6c, 0x61, 0x6e,
-  0x64, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x75, 0x67, 0x75, 0xc3, 0xaa, 0x73, 0xd7,
-  0xa2, 0xd7, 0x91, 0xd7, 0xa8, 0xd7, 0x99, 0xd7, 0xaa, 0xd9, 0x81, 0xd8, 0xa7,
-  0xd8, 0xb1, 0xd8, 0xb3, 0xdb, 0x8c, 0x64, 0x65, 0x73, 0x61, 0x72, 0x72, 0x6f,
-  0x6c, 0x6c, 0x6f, 0x63, 0x6f, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x69, 0x6f,
-  0x65, 0x64, 0x75, 0x63, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x73, 0x65, 0x70,
-  0x74, 0x69, 0x65, 0x6d, 0x62, 0x72, 0x65, 0x72, 0x65, 0x67, 0x69, 0x73, 0x74,
-  0x72, 0x61, 0x64, 0x6f, 0x64, 0x69, 0x72, 0x65, 0x63, 0x63, 0x69, 0xc3, 0xb3,
-  0x6e, 0x75, 0x62, 0x69, 0x63, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x70, 0x75,
-  0x62, 0x6c, 0x69, 0x63, 0x69, 0x64, 0x61, 0x64, 0x72, 0x65, 0x73, 0x70, 0x75,
-  0x65, 0x73, 0x74, 0x61, 0x73, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x61, 0x64,
-  0x6f, 0x73, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x65, 0x72,
-  0x65, 0x73, 0x65, 0x72, 0x76, 0x61, 0x64, 0x6f, 0x73, 0x61, 0x72, 0x74, 0xc3,
-  0xad, 0x63, 0x75, 0x6c, 0x6f, 0x73, 0x64, 0x69, 0x66, 0x65, 0x72, 0x65, 0x6e,
-  0x74, 0x65, 0x73, 0x73, 0x69, 0x67, 0x75, 0x69, 0x65, 0x6e, 0x74, 0x65, 0x73,
-  0x72, 0x65, 0x70, 0xc3, 0xba, 0x62, 0x6c, 0x69, 0x63, 0x61, 0x73, 0x69, 0x74,
-  0x75, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x6d, 0x69, 0x6e, 0x69, 0x73, 0x74,
-  0x65, 0x72, 0x69, 0x6f, 0x70, 0x72, 0x69, 0x76, 0x61, 0x63, 0x69, 0x64, 0x61,
-  0x64, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x69, 0x6f, 0x66, 0x6f,
-  0x72, 0x6d, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x70, 0x6f, 0x62, 0x6c, 0x61,
-  0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x70, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e,
-  0x74, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x69, 0x64, 0x6f, 0x73, 0x61,
-  0x63, 0x63, 0x65, 0x73, 0x6f, 0x72, 0x69, 0x6f, 0x73, 0x74, 0x65, 0x63, 0x68,
-  0x6e, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61,
-  0x6c, 0x65, 0x73, 0x63, 0x61, 0x74, 0x65, 0x67, 0x6f, 0x72, 0xc3, 0xad, 0x61,
-  0x65, 0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c, 0x65, 0x73, 0x64, 0x69, 0x73,
-  0x70, 0x6f, 0x6e, 0x69, 0x62, 0x6c, 0x65, 0x61, 0x63, 0x74, 0x75, 0x61, 0x6c,
-  0x69, 0x64, 0x61, 0x64, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x69,
-  0x61, 0x76, 0x61, 0x6c, 0x6c, 0x61, 0x64, 0x6f, 0x6c, 0x69, 0x64, 0x62, 0x69,
-  0x62, 0x6c, 0x69, 0x6f, 0x74, 0x65, 0x63, 0x61, 0x72, 0x65, 0x6c, 0x61, 0x63,
-  0x69, 0x6f, 0x6e, 0x65, 0x73, 0x63, 0x61, 0x6c, 0x65, 0x6e, 0x64, 0x61, 0x72,
-  0x69, 0x6f, 0x70, 0x6f, 0x6c, 0xc3, 0xad, 0x74, 0x69, 0x63, 0x61, 0x73, 0x61,
-  0x6e, 0x74, 0x65, 0x72, 0x69, 0x6f, 0x72, 0x65, 0x73, 0x64, 0x6f, 0x63, 0x75,
-  0x6d, 0x65, 0x6e, 0x74, 0x6f, 0x73, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x61, 0x6c,
-  0x65, 0x7a, 0x61, 0x6d, 0x61, 0x74, 0x65, 0x72, 0x69, 0x61, 0x6c, 0x65, 0x73,
-  0x64, 0x69, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x69, 0x61, 0x65, 0x63, 0x6f,
-  0x6e, 0xc3, 0xb3, 0x6d, 0x69, 0x63, 0x61, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70,
-  0x6f, 0x72, 0x74, 0x65, 0x72, 0x6f, 0x64, 0x72, 0xc3, 0xad, 0x67, 0x75, 0x65,
-  0x7a, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x72, 0x65, 0x6e,
-  0x63, 0x75, 0x65, 0x6e, 0x74, 0x72, 0x61, 0x6e, 0x64, 0x69, 0x73, 0x63, 0x75,
-  0x73, 0x69, 0xc3, 0xb3, 0x6e, 0x65, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x75,
-  0x72, 0x61, 0x66, 0x75, 0x6e, 0x64, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x66,
-  0x72, 0x65, 0x63, 0x75, 0x65, 0x6e, 0x74, 0x65, 0x73, 0x70, 0x65, 0x72, 0x6d,
-  0x61, 0x6e, 0x65, 0x6e, 0x74, 0x65, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x6d, 0x65,
-  0x6e, 0x74, 0x65, 0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xb6, 0xd0, 0xbd, 0xd0, 0xbe,
-  0xd0, 0xb1, 0xd1, 0x83, 0xd0, 0xb4, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xbc, 0xd0,
-  0xbe, 0xd0, 0xb6, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb2, 0xd1, 0x80, 0xd0, 0xb5,
-  0xd0, 0xbc, 0xd1, 0x8f, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xb6, 0xd0,
-  0xb5, 0xd1, 0x87, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb1, 0xd1, 0x8b, 0xd0, 0xb1,
-  0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xb5, 0xd0, 0xbe, 0xd1, 0x87, 0xd0,
-  0xb5, 0xd0, 0xbd, 0xd1, 0x8c, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb3,
-  0xd0, 0xbe, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xb4, 0xd0, 0xb0, 0xd0,
-  0xbf, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xb2, 0xd1, 0x81,
-  0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xb0, 0xd0, 0xb9, 0xd1,
-  0x82, 0xd0, 0xb5, 0xd1, 0x87, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb5, 0xd0, 0xb7,
-  0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xb3, 0xd1, 0x83, 0xd1, 0x82, 0xd1, 0x81, 0xd0,
-  0xb0, 0xd0, 0xb9, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xb6, 0xd0, 0xb8, 0xd0, 0xb7,
-  0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0, 0xb6, 0xd0, 0xb4, 0xd1,
-  0x83, 0xd0, 0xb1, 0xd1, 0x83, 0xd0, 0xb4, 0xd1, 0x83, 0xd1, 0x82, 0xd0, 0x9f,
-  0xd0, 0xbe, 0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb7, 0xd0, 0xb4, 0xd0,
-  0xb5, 0xd1, 0x81, 0xd1, 0x8c, 0xd0, 0xb2, 0xd0, 0xb8, 0xd0, 0xb4, 0xd0, 0xb5,
-  0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xb2, 0xd1, 0x8f, 0xd0, 0xb7, 0xd0, 0xb8, 0xd0,
-  0xbd, 0xd1, 0x83, 0xd0, 0xb6, 0xd0, 0xbd, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xb2,
-  0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xb9, 0xd0, 0xbb, 0xd1, 0x8e, 0xd0, 0xb4, 0xd0,
-  0xb5, 0xd0, 0xb9, 0xd0, 0xbf, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbd, 0xd0, 0xbe,
-  0xd0, 0xbc, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0,
-  0xb5, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xb9, 0xd1, 0x81, 0xd0, 0xb2, 0xd0, 0xbe,
-  0xd0, 0xb8, 0xd1, 0x85, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb2, 0xd0,
-  0xb0, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xb9, 0xd0, 0xbc,
-  0xd0, 0xb5, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0,
-  0xb5, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb6, 0xd0, 0xb8, 0xd0, 0xb7, 0xd0, 0xbd,
-  0xd1, 0x8c, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb9, 0xd0,
-  0xbb, 0xd1, 0x83, 0xd1, 0x87, 0xd1, 0x88, 0xd0, 0xb5, 0xd0, 0xbf, 0xd0, 0xb5,
-  0xd1, 0x80, 0xd0, 0xb5, 0xd0, 0xb4, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x81, 0xd1,
-  0x82, 0xd0, 0xb8, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x8c,
-  0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb1, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xbd, 0xd0,
-  0xbe, 0xd0, 0xb2, 0xd1, 0x8b, 0xd1, 0x85, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xb0,
-  0xd0, 0xb2, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xb1, 0xd0, 0xbe, 0xd0,
-  0xb9, 0xd0, 0xbf, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xbc,
-  0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xb5, 0xd1, 0x87, 0xd0, 0xb8, 0xd1,
-  0x81, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb2, 0xd1, 0x8b,
-  0xd0, 0xb5, 0xd1, 0x83, 0xd1, 0x81, 0xd0, 0xbb, 0xd1, 0x83, 0xd0, 0xb3, 0xd0,
-  0xbe, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0, 0xb0,
-  0xd0, 0xb7, 0xd0, 0xb0, 0xd0, 0xb4, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xba, 0xd0,
-  0xbe, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xb4, 0xd0, 0xb0,
-  0xd0, 0xbf, 0xd0, 0xbe, 0xd1, 0x87, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0x9f, 0xd0,
-  0xbe, 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xba,
-  0xd0, 0xb8, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb2, 0xd1, 0x8b, 0xd0,
-  0xb9, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb8, 0xd1, 0x82, 0xd1, 0x82,
-  0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xb8, 0xd1, 0x85, 0xd1, 0x81, 0xd1, 0x80, 0xd0,
-  0xb0, 0xd0, 0xb7, 0xd1, 0x83, 0xd0, 0xa1, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xba,
-  0xd1, 0x82, 0xd1, 0x84, 0xd0, 0xbe, 0xd1, 0x80, 0xd1, 0x83, 0xd0, 0xbc, 0xd0,
-  0x9a, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xb4, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xbd,
-  0xd0, 0xb8, 0xd0, 0xb3, 0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0,
-  0xb2, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x88, 0xd0, 0xb5, 0xd0, 0xb9,
-  0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xb9, 0xd1, 0x82, 0xd0, 0xb8, 0xd1, 0x81, 0xd0,
-  0xb2, 0xd0, 0xbe, 0xd0, 0xb8, 0xd0, 0xbc, 0xd1, 0x81, 0xd0, 0xb2, 0xd1, 0x8f,
-  0xd0, 0xb7, 0xd1, 0x8c, 0xd0, 0xbb, 0xd1, 0x8e, 0xd0, 0xb1, 0xd0, 0xbe, 0xd0,
-  0xb9, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x81,
-  0xd1, 0x80, 0xd0, 0xb5, 0xd0, 0xb4, 0xd0, 0xb8, 0xd0, 0x9a, 0xd1, 0x80, 0xd0,
-  0xbe, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0, 0xa4, 0xd0, 0xbe, 0xd1, 0x80, 0xd1, 0x83,
-  0xd0, 0xbc, 0xd1, 0x80, 0xd1, 0x8b, 0xd0, 0xbd, 0xd0, 0xba, 0xd0, 0xb5, 0xd1,
-  0x81, 0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xbb, 0xd0, 0xb8, 0xd0, 0xbf, 0xd0, 0xbe,
-  0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xba, 0xd1, 0x82, 0xd1, 0x8b, 0xd1, 0x81, 0xd1,
-  0x8f, 0xd1, 0x87, 0xd0, 0xbc, 0xd0, 0xb5, 0xd1, 0x81, 0xd1, 0x8f, 0xd1, 0x86,
-  0xd1, 0x86, 0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x82, 0xd1, 0x80, 0xd1, 0x82, 0xd1,
-  0x80, 0xd1, 0x83, 0xd0, 0xb4, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xb0, 0xd0, 0xbc,
-  0xd1, 0x8b, 0xd1, 0x85, 0xd1, 0x80, 0xd1, 0x8b, 0xd0, 0xbd, 0xd0, 0xba, 0xd0,
-  0xb0, 0xd0, 0x9d, 0xd0, 0xbe, 0xd0, 0xb2, 0xd1, 0x8b, 0xd0, 0xb9, 0xd1, 0x87,
-  0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xbc, 0xd0, 0xb5, 0xd1,
-  0x81, 0xd1, 0x82, 0xd0, 0xb0, 0xd1, 0x84, 0xd0, 0xb8, 0xd0, 0xbb, 0xd1, 0x8c,
-  0xd0, 0xbc, 0xd0, 0xbc, 0xd0, 0xb0, 0xd1, 0x80, 0xd1, 0x82, 0xd0, 0xb0, 0xd1,
-  0x81, 0xd1, 0x82, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xbc, 0xd0, 0xb5,
-  0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xba, 0xd1,
-  0x81, 0xd1, 0x82, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x88, 0xd0, 0xb8, 0xd1, 0x85,
-  0xd0, 0xbc, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1, 0x83, 0xd1, 0x82, 0xd0, 0xb8, 0xd0,
-  0xbc, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0, 0xb5,
-  0xd1, 0x8e, 0xd1, 0x82, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xb5, 0xd1,
-  0x80, 0xd0, 0xb3, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb4, 0xd1, 0x81,
-  0xd0, 0xb0, 0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xbc, 0xd1, 0x8d, 0xd1, 0x82, 0xd0,
-  0xbe, 0xd0, 0xbc, 0xd1, 0x83, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xbd, 0xd1, 0x86,
-  0xd0, 0xb5, 0xd1, 0x81, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0,
-  0xba, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xb9, 0xd0, 0x90, 0xd1, 0x80,
-  0xd1, 0x85, 0xd0, 0xb8, 0xd0, 0xb2, 0xd9, 0x85, 0xd9, 0x86, 0xd8, 0xaa, 0xd8,
-  0xaf, 0xd9, 0x89, 0xd8, 0xa5, 0xd8, 0xb1, 0xd8, 0xb3, 0xd8, 0xa7, 0xd9, 0x84,
-  0xd8, 0xb1, 0xd8, 0xb3, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x85, 0xd9, 0x83, 0xd8, 0xaa, 0xd8, 0xa8,
-  0xd9, 0x87, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x85, 0xd8,
-  0xac, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x88, 0xd9, 0x85, 0xd8, 0xa7,
-  0xd9, 0x84, 0xd8, 0xb5, 0xd9, 0x88, 0xd8, 0xb1, 0xd8, 0xac, 0xd8, 0xaf, 0xd9,
-  0x8a, 0xd8, 0xaf, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xb6,
-  0xd9, 0x88, 0xd8, 0xa5, 0xd8, 0xb6, 0xd8, 0xa7, 0xd9, 0x81, 0xd8, 0xa9, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd9, 0x82, 0xd8, 0xb3, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84,
-  0xd8, 0xb9, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xaa, 0xd8, 0xad, 0xd9, 0x85, 0xd9,
-  0x8a, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x84, 0xd9, 0x81, 0xd8, 0xa7, 0xd8, 0xaa,
-  0xd9, 0x85, 0xd9, 0x84, 0xd8, 0xaa, 0xd9, 0x82, 0xd9, 0x89, 0xd8, 0xaa, 0xd8,
-  0xb9, 0xd8, 0xaf, 0xd9, 0x8a, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb4,
-  0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xa3, 0xd8, 0xae, 0xd8, 0xa8, 0xd8, 0xa7, 0xd8,
-  0xb1, 0xd8, 0xaa, 0xd8, 0xb7, 0xd9, 0x88, 0xd9, 0x8a, 0xd8, 0xb1, 0xd8, 0xb9,
-  0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x83, 0xd9, 0x85, 0xd8, 0xa5, 0xd8, 0xb1, 0xd9,
-  0x81, 0xd8, 0xa7, 0xd9, 0x82, 0xd8, 0xb7, 0xd9, 0x84, 0xd8, 0xa8, 0xd8, 0xa7,
-  0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x84, 0xd8, 0xba, 0xd8, 0xa9, 0xd8,
-  0xaa, 0xd8, 0xb1, 0xd8, 0xaa, 0xd9, 0x8a, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84,
-  0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xb3, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb4, 0xd9,
-  0x8a, 0xd8, 0xae, 0xd9, 0x85, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xaf, 0xd9, 0x8a,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd9, 0x82, 0xd8, 0xb5, 0xd8, 0xb5, 0xd8, 0xa7, 0xd9, 0x81, 0xd9, 0x84,
-  0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x87, 0xd8,
-  0xa7, 0xd8, 0xaa, 0xd8, 0xad, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xab, 0xd8, 0xa7,
-  0xd9, 0x84, 0xd9, 0x84, 0xd9, 0x87, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
-  0xb9, 0xd9, 0x85, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x83, 0xd8, 0xaa, 0xd8, 0xa8,
-  0xd8, 0xa9, 0xd9, 0x8a, 0xd9, 0x85, 0xd9, 0x83, 0xd9, 0x86, 0xd9, 0x83, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd8, 0xb7, 0xd9, 0x81, 0xd9, 0x84, 0xd9, 0x81, 0xd9, 0x8a,
-  0xd8, 0xaf, 0xd9, 0x8a, 0xd9, 0x88, 0xd8, 0xa5, 0xd8, 0xaf, 0xd8, 0xa7, 0xd8,
-  0xb1, 0xd8, 0xa9, 0xd8, 0xaa, 0xd8, 0xa7, 0xd8, 0xb1, 0xd9, 0x8a, 0xd8, 0xae,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb5, 0xd8, 0xad, 0xd8, 0xa9, 0xd8, 0xaa, 0xd8,
-  0xb3, 0xd8, 0xac, 0xd9, 0x8a, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x88,
-  0xd9, 0x82, 0xd8, 0xaa, 0xd8, 0xb9, 0xd9, 0x86, 0xd8, 0xaf, 0xd9, 0x85, 0xd8,
-  0xa7, 0xd9, 0x85, 0xd8, 0xaf, 0xd9, 0x8a, 0xd9, 0x86, 0xd8, 0xa9, 0xd8, 0xaa,
-  0xd8, 0xb5, 0xd9, 0x85, 0xd9, 0x8a, 0xd9, 0x85, 0xd8, 0xa3, 0xd8, 0xb1, 0xd8,
-  0xb4, 0xd9, 0x8a, 0xd9, 0x81, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb0, 0xd9, 0x8a,
-  0xd9, 0x86, 0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xa8, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8,
-  0xa8, 0xd9, 0x88, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xa9, 0xd8, 0xa3, 0xd9, 0x84,
-  0xd8, 0xb9, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb3, 0xd9,
-  0x81, 0xd8, 0xb1, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7, 0xd9, 0x83, 0xd9, 0x84,
-  0xd8, 0xaa, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x89, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd8, 0xa3, 0xd9, 0x88, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb3,
-  0xd9, 0x86, 0xd8, 0xa9, 0xd8, 0xac, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xb9, 0xd8,
-  0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb5, 0xd8, 0xad, 0xd9, 0x81, 0xd8, 0xa7,
-  0xd9, 0x84, 0xd8, 0xaf, 0xd9, 0x8a, 0xd9, 0x86, 0xd9, 0x83, 0xd9, 0x84, 0xd9,
-  0x85, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xae, 0xd8, 0xa7,
-  0xd8, 0xb5, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x84, 0xd9, 0x81, 0xd8,
-  0xa3, 0xd8, 0xb9, 0xd8, 0xb6, 0xd8, 0xa7, 0xd8, 0xa1, 0xd9, 0x83, 0xd8, 0xaa,
-  0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xae, 0xd9,
-  0x8a, 0xd8, 0xb1, 0xd8, 0xb1, 0xd8, 0xb3, 0xd8, 0xa7, 0xd8, 0xa6, 0xd9, 0x84,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x82, 0xd9, 0x84, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd8, 0xa3, 0xd8, 0xaf, 0xd8, 0xa8, 0xd9, 0x85, 0xd9, 0x82, 0xd8, 0xa7,
-  0xd8, 0xb7, 0xd8, 0xb9, 0xd9, 0x85, 0xd8, 0xb1, 0xd8, 0xa7, 0xd8, 0xb3, 0xd9,
-  0x84, 0xd9, 0x85, 0xd9, 0x86, 0xd8, 0xb7, 0xd9, 0x82, 0xd8, 0xa9, 0xd8, 0xa7,
-  0xd9, 0x84, 0xd9, 0x83, 0xd8, 0xaa, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
-  0xb1, 0xd8, 0xac, 0xd9, 0x84, 0xd8, 0xa7, 0xd8, 0xb4, 0xd8, 0xaa, 0xd8, 0xb1,
-  0xd9, 0x83, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x82, 0xd8, 0xaf, 0xd9, 0x85, 0xd9,
-  0x8a, 0xd8, 0xb9, 0xd8, 0xb7, 0xd9, 0x8a, 0xd9, 0x83, 0x73, 0x42, 0x79, 0x54,
-  0x61, 0x67, 0x4e, 0x61, 0x6d, 0x65, 0x28, 0x2e, 0x6a, 0x70, 0x67, 0x22, 0x20,
-  0x61, 0x6c, 0x74, 0x3d, 0x22, 0x31, 0x70, 0x78, 0x20, 0x73, 0x6f, 0x6c, 0x69,
-  0x64, 0x20, 0x23, 0x2e, 0x67, 0x69, 0x66, 0x22, 0x20, 0x61, 0x6c, 0x74, 0x3d,
-  0x22, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x74, 0x69,
-  0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x70, 0x70,
-  0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x20, 0x6f, 0x6e, 0x63,
-  0x6c, 0x69, 0x63, 0x6b, 0x3d, 0x22, 0x65, 0x73, 0x74, 0x61, 0x62, 0x6c, 0x69,
-  0x73, 0x68, 0x65, 0x64, 0x61, 0x64, 0x76, 0x65, 0x72, 0x74, 0x69, 0x73, 0x69,
-  0x6e, 0x67, 0x2e, 0x70, 0x6e, 0x67, 0x22, 0x20, 0x61, 0x6c, 0x74, 0x3d, 0x22,
-  0x65, 0x6e, 0x76, 0x69, 0x72, 0x6f, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x70, 0x65,
-  0x72, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x6e, 0x63, 0x65, 0x61, 0x70, 0x70, 0x72,
-  0x6f, 0x70, 0x72, 0x69, 0x61, 0x74, 0x65, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x6d,
-  0x64, 0x61, 0x73, 0x68, 0x3b, 0x69, 0x6d, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x74,
-  0x65, 0x6c, 0x79, 0x3c, 0x2f, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x67, 0x3e, 0x3c,
-  0x2f, 0x72, 0x61, 0x74, 0x68, 0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x74,
-  0x65, 0x6d, 0x70, 0x65, 0x72, 0x61, 0x74, 0x75, 0x72, 0x65, 0x64, 0x65, 0x76,
-  0x65, 0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x63, 0x6f, 0x6d, 0x70, 0x65,
-  0x74, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x68, 0x6f,
-  0x6c, 0x64, 0x65, 0x72, 0x76, 0x69, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x74,
-  0x79, 0x3a, 0x63, 0x6f, 0x70, 0x79, 0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x3e,
-  0x30, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x22, 0x65, 0x76,
-  0x65, 0x6e, 0x20, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x72, 0x65, 0x70, 0x6c,
-  0x61, 0x63, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x64, 0x65, 0x73, 0x74, 0x69, 0x6e,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x43, 0x6f, 0x72, 0x70, 0x6f, 0x72, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x3c, 0x75, 0x6c, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
-  0x22, 0x41, 0x73, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x69,
-  0x6e, 0x64, 0x69, 0x76, 0x69, 0x64, 0x75, 0x61, 0x6c, 0x73, 0x70, 0x65, 0x72,
-  0x73, 0x70, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x73, 0x65, 0x74, 0x54, 0x69,
-  0x6d, 0x65, 0x6f, 0x75, 0x74, 0x28, 0x75, 0x72, 0x6c, 0x28, 0x68, 0x74, 0x74,
-  0x70, 0x3a, 0x2f, 0x2f, 0x6d, 0x61, 0x74, 0x68, 0x65, 0x6d, 0x61, 0x74, 0x69,
-  0x63, 0x73, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x74, 0x6f, 0x70, 0x3a,
-  0x65, 0x76, 0x65, 0x6e, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x64, 0x65,
-  0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x29, 0x20, 0x6e, 0x6f,
-  0x2d, 0x72, 0x65, 0x70, 0x65, 0x61, 0x74, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x4a, 0x50, 0x47, 0x7c, 0x74, 0x68, 0x75,
-  0x6d, 0x62, 0x7c, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x74,
-  0x65, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x66,
-  0x6c, 0x6f, 0x61, 0x74, 0x3a, 0x6c, 0x65, 0x66, 0x74, 0x3b, 0x3c, 0x6c, 0x69,
-  0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x68, 0x75, 0x6e, 0x64, 0x72,
-  0x65, 0x64, 0x73, 0x20, 0x6f, 0x66, 0x0a, 0x0a, 0x48, 0x6f, 0x77, 0x65, 0x76,
-  0x65, 0x72, 0x2c, 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69,
-  0x6f, 0x6e, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x3a, 0x62, 0x6f, 0x74, 0x68, 0x3b,
-  0x63, 0x6f, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x77, 0x69,
-  0x74, 0x68, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6c, 0x61, 0x62, 0x65,
-  0x6c, 0x20, 0x66, 0x6f, 0x72, 0x3d, 0x22, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72,
-  0x2d, 0x74, 0x6f, 0x70, 0x3a, 0x4e, 0x65, 0x77, 0x20, 0x5a, 0x65, 0x61, 0x6c,
-  0x61, 0x6e, 0x64, 0x72, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x64, 0x65,
-  0x64, 0x70, 0x68, 0x6f, 0x74, 0x6f, 0x67, 0x72, 0x61, 0x70, 0x68, 0x79, 0x69,
-  0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x26, 0x6c, 0x74,
-  0x3b, 0x73, 0x75, 0x70, 0x26, 0x67, 0x74, 0x3b, 0x63, 0x6f, 0x6e, 0x74, 0x72,
-  0x6f, 0x76, 0x65, 0x72, 0x73, 0x79, 0x4e, 0x65, 0x74, 0x68, 0x65, 0x72, 0x6c,
-  0x61, 0x6e, 0x64, 0x73, 0x61, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69,
-  0x76, 0x65, 0x6d, 0x61, 0x78, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x3d, 0x22,
-  0x73, 0x77, 0x69, 0x74, 0x7a, 0x65, 0x72, 0x6c, 0x61, 0x6e, 0x64, 0x44, 0x65,
-  0x76, 0x65, 0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x65, 0x73, 0x73, 0x65,
-  0x6e, 0x74, 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x0a, 0x0a, 0x41, 0x6c, 0x74, 0x68,
-  0x6f, 0x75, 0x67, 0x68, 0x20, 0x3c, 0x2f, 0x74, 0x65, 0x78, 0x74, 0x61, 0x72,
-  0x65, 0x61, 0x3e, 0x74, 0x68, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x62, 0x69, 0x72,
-  0x64, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x65, 0x64, 0x26,
-  0x61, 0x6d, 0x70, 0x3b, 0x6e, 0x64, 0x61, 0x73, 0x68, 0x3b, 0x73, 0x70, 0x65,
-  0x63, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6d, 0x6d, 0x75,
-  0x6e, 0x69, 0x74, 0x69, 0x65, 0x73, 0x6c, 0x65, 0x67, 0x69, 0x73, 0x6c, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72, 0x6f, 0x6e, 0x69,
-  0x63, 0x73, 0x0a, 0x09, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22,
-  0x69, 0x6c, 0x6c, 0x75, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, 0x64, 0x65, 0x6e,
-  0x67, 0x69, 0x6e, 0x65, 0x65, 0x72, 0x69, 0x6e, 0x67, 0x74, 0x65, 0x72, 0x72,
-  0x69, 0x74, 0x6f, 0x72, 0x69, 0x65, 0x73, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72,
-  0x69, 0x74, 0x69, 0x65, 0x73, 0x64, 0x69, 0x73, 0x74, 0x72, 0x69, 0x62, 0x75,
-  0x74, 0x65, 0x64, 0x36, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d,
-  0x22, 0x73, 0x61, 0x6e, 0x73, 0x2d, 0x73, 0x65, 0x72, 0x69, 0x66, 0x3b, 0x63,
-  0x61, 0x70, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x64, 0x69, 0x73,
-  0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x65, 0x64, 0x69, 0x6e, 0x74, 0x65, 0x72,
-  0x61, 0x63, 0x74, 0x69, 0x76, 0x65, 0x6c, 0x6f, 0x6f, 0x6b, 0x69, 0x6e, 0x67,
-  0x20, 0x66, 0x6f, 0x72, 0x69, 0x74, 0x20, 0x77, 0x6f, 0x75, 0x6c, 0x64, 0x20,
-  0x62, 0x65, 0x41, 0x66, 0x67, 0x68, 0x61, 0x6e, 0x69, 0x73, 0x74, 0x61, 0x6e,
-  0x77, 0x61, 0x73, 0x20, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x64, 0x4d, 0x61,
-  0x74, 0x68, 0x2e, 0x66, 0x6c, 0x6f, 0x6f, 0x72, 0x28, 0x73, 0x75, 0x72, 0x72,
-  0x6f, 0x75, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x63, 0x61, 0x6e, 0x20, 0x61, 0x6c,
-  0x73, 0x6f, 0x20, 0x62, 0x65, 0x6f, 0x62, 0x73, 0x65, 0x72, 0x76, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x6d, 0x61, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x61, 0x6e, 0x63,
-  0x65, 0x65, 0x6e, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x64, 0x3c,
-  0x68, 0x32, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6d, 0x6f, 0x72,
-  0x65, 0x20, 0x72, 0x65, 0x63, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x20, 0x68, 0x61,
-  0x73, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x69, 0x6e, 0x76, 0x61, 0x73, 0x69, 0x6f,
-  0x6e, 0x20, 0x6f, 0x66, 0x29, 0x2e, 0x67, 0x65, 0x74, 0x54, 0x69, 0x6d, 0x65,
-  0x28, 0x29, 0x66, 0x75, 0x6e, 0x64, 0x61, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x6c,
-  0x44, 0x65, 0x73, 0x70, 0x69, 0x74, 0x65, 0x20, 0x74, 0x68, 0x65, 0x22, 0x3e,
-  0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x69, 0x6e, 0x73, 0x70,
-  0x69, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x65, 0x78, 0x61, 0x6d, 0x69, 0x6e,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x72, 0x65, 0x70, 0x61, 0x72, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x65, 0x78, 0x70, 0x6c, 0x61, 0x6e, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x3c,
-  0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x76, 0x65, 0x72,
-  0x73, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x73, 0x74, 0x72,
-  0x75, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x20,
-  0x74, 0x68, 0x65, 0x20, 0x20, 0x3d, 0x20, 0x27, 0x68, 0x74, 0x74, 0x70, 0x3a,
-  0x2f, 0x2f, 0x44, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e,
-  0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x76, 0x65, 0x6c, 0x79, 0x20, 0x2e, 0x73,
-  0x75, 0x62, 0x73, 0x74, 0x72, 0x69, 0x6e, 0x67, 0x28, 0x65, 0x61, 0x63, 0x68,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69,
-  0x6d, 0x65, 0x6e, 0x74, 0x73, 0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x74,
-  0x69, 0x61, 0x6c, 0x69, 0x6e, 0x74, 0x65, 0x67, 0x72, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x6d, 0x61, 0x6e, 0x79, 0x20, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x64,
-  0x75, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6d,
-  0x62, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x64, 0x6f, 0x20, 0x6e, 0x6f,
-  0x74, 0x20, 0x68, 0x61, 0x76, 0x65, 0x4d, 0x69, 0x64, 0x64, 0x6c, 0x65, 0x20,
-  0x45, 0x61, 0x73, 0x74, 0x3c, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x3e, 0x3c, 0x63, 0x6f, 0x70, 0x79, 0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x20,
-  0x70, 0x65, 0x72, 0x68, 0x61, 0x70, 0x73, 0x20, 0x74, 0x68, 0x65, 0x69, 0x6e,
-  0x73, 0x74, 0x69, 0x74, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x20, 0x44,
-  0x65, 0x63, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x61, 0x72, 0x72, 0x61, 0x6e, 0x67,
-  0x65, 0x6d, 0x65, 0x6e, 0x74, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x66, 0x61, 0x6d,
-  0x6f, 0x75, 0x73, 0x70, 0x65, 0x72, 0x73, 0x6f, 0x6e, 0x61, 0x6c, 0x69, 0x74,
-  0x79, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6c,
-  0x69, 0x6d, 0x69, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x78, 0x63,
-  0x6c, 0x75, 0x73, 0x69, 0x76, 0x65, 0x6c, 0x79, 0x73, 0x6f, 0x76, 0x65, 0x72,
-  0x65, 0x69, 0x67, 0x6e, 0x74, 0x79, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e,
-  0x74, 0x22, 0x3e, 0x0a, 0x3c, 0x74, 0x64, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
-  0x3d, 0x22, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64,
-  0x70, 0x61, 0x72, 0x61, 0x6c, 0x6c, 0x65, 0x6c, 0x20, 0x74, 0x6f, 0x64, 0x6f,
-  0x63, 0x74, 0x72, 0x69, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x6f, 0x63, 0x63, 0x75,
-  0x70, 0x69, 0x65, 0x64, 0x20, 0x62, 0x79, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e,
-  0x6f, 0x6c, 0x6f, 0x67, 0x79, 0x52, 0x65, 0x6e, 0x61, 0x69, 0x73, 0x73, 0x61,
-  0x6e, 0x63, 0x65, 0x61, 0x20, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x20, 0x6f,
-  0x66, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x20, 0x66, 0x6f, 0x72, 0x65,
-  0x78, 0x70, 0x6c, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x63,
-  0x6f, 0x67, 0x6e, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x72, 0x65, 0x64, 0x65,
-  0x63, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x3c, 0x69, 0x6d, 0x67, 0x20, 0x73, 0x72,
-  0x63, 0x3d, 0x22, 0x2f, 0x3c, 0x68, 0x31, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
-  0x3d, 0x22, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x6d, 0x61, 0x79, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x62, 0x65, 0x73, 0x70,
-  0x65, 0x63, 0x69, 0x61, 0x6c, 0x69, 0x7a, 0x65, 0x64, 0x3c, 0x2f, 0x66, 0x69,
-  0x65, 0x6c, 0x64, 0x73, 0x65, 0x74, 0x3e, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x65,
-  0x73, 0x73, 0x69, 0x76, 0x65, 0x6d, 0x69, 0x6c, 0x6c, 0x69, 0x6f, 0x6e, 0x73,
-  0x20, 0x6f, 0x66, 0x73, 0x74, 0x61, 0x74, 0x65, 0x73, 0x20, 0x74, 0x68, 0x61,
-  0x74, 0x65, 0x6e, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x61,
-  0x72, 0x6f, 0x75, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6f, 0x6e, 0x65,
-  0x20, 0x61, 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x2e, 0x70, 0x61, 0x72, 0x65,
-  0x6e, 0x74, 0x4e, 0x6f, 0x64, 0x65, 0x61, 0x67, 0x72, 0x69, 0x63, 0x75, 0x6c,
-  0x74, 0x75, 0x72, 0x65, 0x41, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69,
-  0x76, 0x65, 0x72, 0x65, 0x73, 0x65, 0x61, 0x72, 0x63, 0x68, 0x65, 0x72, 0x73,
-  0x74, 0x6f, 0x77, 0x61, 0x72, 0x64, 0x73, 0x20, 0x74, 0x68, 0x65, 0x4d, 0x6f,
-  0x73, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x61, 0x6e, 0x79,
-  0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x28, 0x65, 0x73, 0x70, 0x65, 0x63,
-  0x69, 0x61, 0x6c, 0x6c, 0x79, 0x3c, 0x74, 0x64, 0x20, 0x77, 0x69, 0x64, 0x74,
-  0x68, 0x3d, 0x22, 0x3b, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x31, 0x30, 0x30,
-  0x25, 0x69, 0x6e, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x65, 0x6e, 0x74, 0x3c,
-  0x68, 0x33, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x20, 0x6f, 0x6e,
-  0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x3d, 0x22, 0x29, 0x2e, 0x61, 0x64, 0x64,
-  0x43, 0x6c, 0x61, 0x73, 0x73, 0x28, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x61, 0x63,
-  0x74, 0x69, 0x6f, 0x6e, 0x4f, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
-  0x65, 0x20, 0x64, 0x61, 0x75, 0x67, 0x68, 0x74, 0x65, 0x72, 0x20, 0x6f, 0x66,
-  0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x6f, 0x72, 0x69, 0x65, 0x73, 0x62, 0x72,
-  0x61, 0x6e, 0x63, 0x68, 0x65, 0x73, 0x20, 0x6f, 0x66, 0x0d, 0x0a, 0x3c, 0x64,
-  0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x74, 0x68, 0x65, 0x20, 0x6c, 0x61,
-  0x72, 0x67, 0x65, 0x73, 0x74, 0x64, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x72, 0x65, 0x67, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x49, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74,
-  0x72, 0x61, 0x6e, 0x73, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x64, 0x6f, 0x63,
-  0x75, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x79, 0x69, 0x6e, 0x20, 0x6f, 0x72,
-  0x64, 0x65, 0x72, 0x20, 0x74, 0x6f, 0x22, 0x3e, 0x0a, 0x3c, 0x68, 0x65, 0x61,
-  0x64, 0x3e, 0x0a, 0x3c, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d,
-  0x22, 0x31, 0x61, 0x63, 0x72, 0x6f, 0x73, 0x73, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x6f, 0x72, 0x69, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x29, 0x3b,
-  0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x69, 0x6d, 0x70, 0x6c,
-  0x65, 0x6d, 0x65, 0x6e, 0x74, 0x65, 0x64, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65,
-  0x20, 0x73, 0x65, 0x65, 0x6e, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x77, 0x61,
-  0x73, 0x20, 0x61, 0x64, 0x65, 0x6d, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x61, 0x74,
-  0x65, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65, 0x72, 0x22, 0x3e, 0x63,
-  0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x68, 0x65,
-  0x20, 0x42, 0x72, 0x69, 0x74, 0x69, 0x73, 0x68, 0x77, 0x61, 0x73, 0x20, 0x77,
-  0x72, 0x69, 0x74, 0x74, 0x65, 0x6e, 0x21, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74,
-  0x61, 0x6e, 0x74, 0x3b, 0x70, 0x78, 0x3b, 0x20, 0x6d, 0x61, 0x72, 0x67, 0x69,
-  0x6e, 0x2d, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x65, 0x64, 0x20, 0x62, 0x79,
-  0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x20, 0x74, 0x6f, 0x20, 0x63, 0x6f,
-  0x6d, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x65, 0x64, 0x64, 0x75, 0x72, 0x69,
-  0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x20, 0x69, 0x6d, 0x6d, 0x69, 0x67, 0x72,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x63, 0x61, 0x6c,
-  0x6c, 0x65, 0x64, 0x3c, 0x68, 0x34, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
-  0x22, 0x64, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x72,
-  0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x64, 0x20, 0x62, 0x79, 0x67, 0x6f, 0x76,
-  0x65, 0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x6c, 0x6f, 0x63, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x20, 0x4e, 0x6f, 0x76, 0x65,
-  0x6d, 0x62, 0x65, 0x72, 0x77, 0x68, 0x65, 0x74, 0x68, 0x65, 0x72, 0x20, 0x74,
-  0x68, 0x65, 0x3c, 0x2f, 0x70, 0x3e, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
-  0x61, 0x63, 0x71, 0x75, 0x69, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x61,
-  0x6c, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70, 0x65, 0x72, 0x73,
-  0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x7b, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69,
-  0x7a, 0x65, 0x3a, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x65, 0x64, 0x20, 0x69,
-  0x6e, 0x69, 0x6e, 0x76, 0x65, 0x73, 0x74, 0x69, 0x67, 0x61, 0x74, 0x65, 0x65,
-  0x78, 0x70, 0x65, 0x72, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x64, 0x6d, 0x6f, 0x73,
-  0x74, 0x20, 0x6c, 0x69, 0x6b, 0x65, 0x6c, 0x79, 0x77, 0x69, 0x64, 0x65, 0x6c,
-  0x79, 0x20, 0x75, 0x73, 0x65, 0x64, 0x64, 0x69, 0x73, 0x63, 0x75, 0x73, 0x73,
-  0x69, 0x6f, 0x6e, 0x73, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x63, 0x65, 0x20,
-  0x6f, 0x66, 0x20, 0x28, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e,
-  0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x76, 0x65, 0x6c, 0x79, 0x49, 0x74,
-  0x20, 0x68, 0x61, 0x73, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x69, 0x74, 0x20, 0x64,
-  0x6f, 0x65, 0x73, 0x20, 0x6e, 0x6f, 0x74, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x61,
-  0x72, 0x79, 0x20, 0x74, 0x6f, 0x69, 0x6e, 0x68, 0x61, 0x62, 0x69, 0x74, 0x61,
-  0x6e, 0x74, 0x73, 0x69, 0x6d, 0x70, 0x72, 0x6f, 0x76, 0x65, 0x6d, 0x65, 0x6e,
-  0x74, 0x73, 0x63, 0x68, 0x6f, 0x6c, 0x61, 0x72, 0x73, 0x68, 0x69, 0x70, 0x63,
-  0x6f, 0x6e, 0x73, 0x75, 0x6d, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x73,
-  0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x6f, 0x72, 0x20, 0x65,
-  0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x72, 0x20,
-  0x6d, 0x6f, 0x72, 0x65, 0x70, 0x78, 0x3b, 0x20, 0x70, 0x61, 0x64, 0x64, 0x69,
-  0x6e, 0x67, 0x74, 0x68, 0x65, 0x20, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74,
-  0x61, 0x20, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x20, 0x6f, 0x66, 0x61, 0x72,
-  0x65, 0x20, 0x75, 0x73, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x72, 0x6f, 0x6c, 0x65,
-  0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x70, 0x72, 0x65, 0x76, 0x69, 0x6f,
-  0x75, 0x73, 0x6c, 0x79, 0x20, 0x64, 0x65, 0x72, 0x69, 0x76, 0x61, 0x74, 0x69,
-  0x76, 0x65, 0x73, 0x65, 0x76, 0x69, 0x64, 0x65, 0x6e, 0x63, 0x65, 0x20, 0x6f,
-  0x66, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x63,
-  0x6f, 0x6c, 0x6f, 0x72, 0x73, 0x63, 0x68, 0x65, 0x6d, 0x65, 0x73, 0x74, 0x61,
-  0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x63, 0x65, 0x72, 0x74, 0x69,
-  0x66, 0x69, 0x63, 0x61, 0x74, 0x65, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x64,
-  0x69, 0x76, 0x3e, 0x0a, 0x20, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64,
-  0x3d, 0x22, 0x68, 0x69, 0x67, 0x68, 0x20, 0x73, 0x63, 0x68, 0x6f, 0x6f, 0x6c,
-  0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x20, 0x74, 0x6f, 0x63, 0x6f,
-  0x6d, 0x66, 0x6f, 0x72, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x61, 0x64, 0x6f, 0x70,
-  0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x72, 0x65, 0x65, 0x20,
-  0x79, 0x65, 0x61, 0x72, 0x73, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x75, 0x6e,
-  0x74, 0x72, 0x79, 0x69, 0x6e, 0x20, 0x46, 0x65, 0x62, 0x72, 0x75, 0x61, 0x72,
-  0x79, 0x73, 0x6f, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x70,
-  0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x77, 0x68, 0x6f, 0x20, 0x70, 0x72, 0x6f,
-  0x76, 0x69, 0x64, 0x65, 0x64, 0x20, 0x62, 0x79, 0x3c, 0x70, 0x61, 0x72, 0x61,
-  0x6d, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x61, 0x66, 0x66, 0x65, 0x63, 0x74, 0x65,
-  0x64, 0x20, 0x62, 0x79, 0x69, 0x6e, 0x20, 0x74, 0x65, 0x72, 0x6d, 0x73, 0x20,
-  0x6f, 0x66, 0x61, 0x70, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x6d, 0x65, 0x6e, 0x74,
-  0x49, 0x53, 0x4f, 0x2d, 0x38, 0x38, 0x35, 0x39, 0x2d, 0x31, 0x22, 0x77, 0x61,
-  0x73, 0x20, 0x62, 0x6f, 0x72, 0x6e, 0x20, 0x69, 0x6e, 0x68, 0x69, 0x73, 0x74,
-  0x6f, 0x72, 0x69, 0x63, 0x61, 0x6c, 0x20, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64,
-  0x65, 0x64, 0x20, 0x61, 0x73, 0x6d, 0x65, 0x61, 0x73, 0x75, 0x72, 0x65, 0x6d,
-  0x65, 0x6e, 0x74, 0x69, 0x73, 0x20, 0x62, 0x61, 0x73, 0x65, 0x64, 0x20, 0x6f,
-  0x6e, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x3a,
-  0x20, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x73, 0x69, 0x67,
-  0x6e, 0x69, 0x66, 0x69, 0x63, 0x61, 0x6e, 0x74, 0x63, 0x65, 0x6c, 0x65, 0x62,
-  0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x6d, 0x69,
-  0x74, 0x74, 0x65, 0x64, 0x2f, 0x6a, 0x73, 0x2f, 0x6a, 0x71, 0x75, 0x65, 0x72,
-  0x79, 0x2e, 0x69, 0x73, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73,
-  0x74, 0x68, 0x65, 0x6f, 0x72, 0x65, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x20, 0x74,
-  0x61, 0x62, 0x69, 0x6e, 0x64, 0x65, 0x78, 0x3d, 0x22, 0x69, 0x74, 0x20, 0x63,
-  0x6f, 0x75, 0x6c, 0x64, 0x20, 0x62, 0x65, 0x3c, 0x6e, 0x6f, 0x73, 0x63, 0x72,
-  0x69, 0x70, 0x74, 0x3e, 0x0a, 0x68, 0x61, 0x76, 0x69, 0x6e, 0x67, 0x20, 0x62,
-  0x65, 0x65, 0x6e, 0x0d, 0x0a, 0x3c, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0d, 0x0a,
-  0x3c, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x54, 0x68, 0x65, 0x20, 0x63,
-  0x6f, 0x6d, 0x70, 0x69, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x68, 0x65, 0x20,
-  0x68, 0x61, 0x64, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x64, 0x75,
-  0x63, 0x65, 0x64, 0x20, 0x62, 0x79, 0x70, 0x68, 0x69, 0x6c, 0x6f, 0x73, 0x6f,
-  0x70, 0x68, 0x65, 0x72, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74,
-  0x65, 0x64, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x20, 0x74, 0x6f,
-  0x61, 0x6d, 0x6f, 0x6e, 0x67, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x63, 0x6f,
-  0x6d, 0x70, 0x61, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x74, 0x6f, 0x20, 0x73,
-  0x61, 0x79, 0x20, 0x74, 0x68, 0x61, 0x74, 0x45, 0x6e, 0x67, 0x69, 0x6e, 0x65,
-  0x65, 0x72, 0x69, 0x6e, 0x67, 0x61, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72,
-  0x65, 0x6e, 0x74, 0x72, 0x65, 0x66, 0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74,
-  0x6f, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x62,
-  0x65, 0x6c, 0x69, 0x65, 0x66, 0x20, 0x74, 0x68, 0x61, 0x74, 0x70, 0x68, 0x6f,
-  0x74, 0x6f, 0x67, 0x72, 0x61, 0x70, 0x68, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x74,
-  0x69, 0x66, 0x79, 0x69, 0x6e, 0x67, 0x48, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x79,
-  0x20, 0x6f, 0x66, 0x20, 0x52, 0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x20,
-  0x6f, 0x66, 0x6e, 0x65, 0x63, 0x65, 0x73, 0x73, 0x61, 0x72, 0x69, 0x6c, 0x79,
-  0x70, 0x72, 0x6f, 0x62, 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x74, 0x65,
-  0x63, 0x68, 0x6e, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x6c, 0x65, 0x61, 0x76,
-  0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74, 0x61,
-  0x63, 0x75, 0x6c, 0x61, 0x72, 0x66, 0x72, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e,
-  0x20, 0x6f, 0x66, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72, 0x69, 0x63, 0x69, 0x74,
-  0x79, 0x68, 0x65, 0x61, 0x64, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x72,
-  0x65, 0x73, 0x74, 0x61, 0x75, 0x72, 0x61, 0x6e, 0x74, 0x73, 0x70, 0x61, 0x72,
-  0x74, 0x6e, 0x65, 0x72, 0x73, 0x68, 0x69, 0x70, 0x65, 0x6d, 0x70, 0x68, 0x61,
-  0x73, 0x69, 0x73, 0x20, 0x6f, 0x6e, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x72, 0x65,
-  0x63, 0x65, 0x6e, 0x74, 0x73, 0x68, 0x61, 0x72, 0x65, 0x20, 0x77, 0x69, 0x74,
-  0x68, 0x20, 0x73, 0x61, 0x79, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x61, 0x74,
-  0x66, 0x69, 0x6c, 0x6c, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x64, 0x65,
-  0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x69, 0x74, 0x20, 0x69,
-  0x73, 0x20, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x22, 0x3e, 0x3c, 0x2f, 0x69, 0x66,
-  0x72, 0x61, 0x6d, 0x65, 0x3e, 0x61, 0x73, 0x20, 0x66, 0x6f, 0x6c, 0x6c, 0x6f,
-  0x77, 0x73, 0x3a, 0x6d, 0x65, 0x72, 0x67, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74,
-  0x68, 0x74, 0x68, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x74, 0x68, 0x65, 0x63,
-  0x6f, 0x6d, 0x6d, 0x65, 0x72, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x70, 0x6f, 0x69,
-  0x6e, 0x74, 0x65, 0x64, 0x20, 0x6f, 0x75, 0x74, 0x6f, 0x70, 0x70, 0x6f, 0x72,
-  0x74, 0x75, 0x6e, 0x69, 0x74, 0x79, 0x76, 0x69, 0x65, 0x77, 0x20, 0x6f, 0x66,
-  0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65, 0x6d, 0x65,
-  0x6e, 0x74, 0x64, 0x69, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66,
-  0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x6d, 0x69, 0x6e, 0x67, 0x68, 0x65,
-  0x20, 0x72, 0x65, 0x63, 0x65, 0x69, 0x76, 0x65, 0x64, 0x73, 0x65, 0x74, 0x49,
-  0x6e, 0x74, 0x65, 0x72, 0x76, 0x61, 0x6c, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x70,
-  0x61, 0x6e, 0x3e, 0x3c, 0x2f, 0x69, 0x6e, 0x20, 0x4e, 0x65, 0x77, 0x20, 0x59,
-  0x6f, 0x72, 0x6b, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c,
-  0x20, 0x63, 0x6f, 0x6d, 0x70, 0x72, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x0a,
-  0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x69, 0x6e, 0x63,
-  0x6f, 0x72, 0x70, 0x6f, 0x72, 0x61, 0x74, 0x65, 0x3b, 0x3c, 0x2f, 0x73, 0x63,
-  0x72, 0x69, 0x70, 0x74, 0x3e, 0x3c, 0x61, 0x74, 0x74, 0x61, 0x63, 0x68, 0x45,
-  0x76, 0x65, 0x6e, 0x74, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x74, 0x68,
-  0x65, 0x20, 0x22, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x3d, 0x22, 0x5f,
-  0x63, 0x61, 0x72, 0x72, 0x69, 0x65, 0x64, 0x20, 0x6f, 0x75, 0x74, 0x53, 0x6f,
-  0x6d, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x63, 0x69, 0x65,
-  0x6e, 0x63, 0x65, 0x20, 0x61, 0x6e, 0x64, 0x74, 0x68, 0x65, 0x20, 0x74, 0x69,
-  0x6d, 0x65, 0x20, 0x6f, 0x66, 0x43, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65,
-  0x72, 0x22, 0x3e, 0x6d, 0x61, 0x69, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x69, 0x6e,
-  0x67, 0x43, 0x68, 0x72, 0x69, 0x73, 0x74, 0x6f, 0x70, 0x68, 0x65, 0x72, 0x4d,
-  0x75, 0x63, 0x68, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x77, 0x72, 0x69,
-  0x74, 0x69, 0x6e, 0x67, 0x73, 0x20, 0x6f, 0x66, 0x22, 0x20, 0x68, 0x65, 0x69,
-  0x67, 0x68, 0x74, 0x3d, 0x22, 0x32, 0x73, 0x69, 0x7a, 0x65, 0x20, 0x6f, 0x66,
-  0x20, 0x74, 0x68, 0x65, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x20, 0x6f,
-  0x66, 0x20, 0x6d, 0x69, 0x78, 0x74, 0x75, 0x72, 0x65, 0x20, 0x6f, 0x66, 0x20,
-  0x62, 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x45, 0x78,
-  0x61, 0x6d, 0x70, 0x6c, 0x65, 0x73, 0x20, 0x6f, 0x66, 0x65, 0x64, 0x75, 0x63,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x63, 0x6f, 0x6d, 0x70, 0x65, 0x74,
-  0x69, 0x74, 0x69, 0x76, 0x65, 0x20, 0x6f, 0x6e, 0x73, 0x75, 0x62, 0x6d, 0x69,
-  0x74, 0x3d, 0x22, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x20, 0x6f,
-  0x66, 0x64, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x63, 0x74, 0x69, 0x76, 0x65, 0x2f,
-  0x44, 0x54, 0x44, 0x20, 0x58, 0x48, 0x54, 0x4d, 0x4c, 0x20, 0x72, 0x65, 0x6c,
-  0x61, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x74, 0x65, 0x6e, 0x64, 0x65,
-  0x6e, 0x63, 0x79, 0x20, 0x74, 0x6f, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x6e, 0x63,
-  0x65, 0x20, 0x6f, 0x66, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x77, 0x6f, 0x75,
-  0x6c, 0x64, 0x64, 0x65, 0x73, 0x70, 0x69, 0x74, 0x65, 0x20, 0x74, 0x68, 0x65,
-  0x73, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x63, 0x20, 0x6c, 0x65,
-  0x67, 0x69, 0x73, 0x6c, 0x61, 0x74, 0x75, 0x72, 0x65, 0x2e, 0x69, 0x6e, 0x6e,
-  0x65, 0x72, 0x48, 0x54, 0x4d, 0x4c, 0x20, 0x61, 0x6c, 0x6c, 0x65, 0x67, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x41, 0x67, 0x72, 0x69, 0x63, 0x75, 0x6c, 0x74,
-  0x75, 0x72, 0x65, 0x77, 0x61, 0x73, 0x20, 0x75, 0x73, 0x65, 0x64, 0x20, 0x69,
-  0x6e, 0x61, 0x70, 0x70, 0x72, 0x6f, 0x61, 0x63, 0x68, 0x20, 0x74, 0x6f, 0x69,
-  0x6e, 0x74, 0x65, 0x6c, 0x6c, 0x69, 0x67, 0x65, 0x6e, 0x74, 0x79, 0x65, 0x61,
-  0x72, 0x73, 0x20, 0x6c, 0x61, 0x74, 0x65, 0x72, 0x2c, 0x73, 0x61, 0x6e, 0x73,
-  0x2d, 0x73, 0x65, 0x72, 0x69, 0x66, 0x64, 0x65, 0x74, 0x65, 0x72, 0x6d, 0x69,
-  0x6e, 0x69, 0x6e, 0x67, 0x50, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x6e,
-  0x63, 0x65, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x61, 0x6e, 0x63, 0x65, 0x73,
-  0x2c, 0x20, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x69, 0x73, 0x20, 0x66, 0x6f,
-  0x75, 0x6e, 0x64, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x61, 0x62, 0x62, 0x72,
-  0x65, 0x76, 0x69, 0x61, 0x74, 0x65, 0x64, 0x68, 0x69, 0x67, 0x68, 0x65, 0x72,
-  0x20, 0x74, 0x68, 0x61, 0x6e, 0x73, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74,
-  0x68, 0x65, 0x20, 0x69, 0x6e, 0x64, 0x69, 0x76, 0x69, 0x64, 0x75, 0x61, 0x6c,
-  0x20, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x66, 0x73,
-  0x75, 0x70, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x63, 0x6c, 0x61,
-  0x69, 0x6d, 0x73, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x74, 0x74, 0x72, 0x69,
-  0x62, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69,
-  0x7a, 0x65, 0x3a, 0x31, 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x20,
-  0x6f, 0x66, 0x48, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x69, 0x63, 0x61, 0x6c, 0x20,
-  0x68, 0x69, 0x73, 0x20, 0x62, 0x72, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x61, 0x74,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x61, 0x6e, 0x6e, 0x69,
-  0x76, 0x65, 0x72, 0x73, 0x61, 0x72, 0x79, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e,
-  0x65, 0x64, 0x20, 0x62, 0x79, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x65, 0x64, 0x20,
-  0x74, 0x6f, 0x20, 0x75, 0x6c, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x6c, 0x79,
-  0x20, 0x69, 0x6e, 0x6e, 0x6f, 0x76, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x69,
-  0x74, 0x20, 0x69, 0x73, 0x20, 0x73, 0x74, 0x69, 0x6c, 0x6c, 0x63, 0x61, 0x6e,
-  0x20, 0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x62, 0x65, 0x64, 0x65, 0x66, 0x69, 0x6e,
-  0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x6f, 0x47, 0x4d, 0x54, 0x53, 0x74,
-  0x72, 0x69, 0x6e, 0x67, 0x41, 0x20, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x20,
-  0x6f, 0x66, 0x69, 0x6d, 0x67, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22,
-  0x45, 0x76, 0x65, 0x6e, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x2c, 0x77, 0x61,
-  0x73, 0x20, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x64, 0x6f, 0x63, 0x63, 0x75,
-  0x72, 0x72, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x6e, 0x65, 0x69, 0x67, 0x68, 0x62,
-  0x6f, 0x72, 0x69, 0x6e, 0x67, 0x64, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x75,
-  0x69, 0x73, 0x68, 0x77, 0x68, 0x65, 0x6e, 0x20, 0x68, 0x65, 0x20, 0x77, 0x61,
-  0x73, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x69, 0x6e, 0x67, 0x74,
-  0x65, 0x72, 0x72, 0x65, 0x73, 0x74, 0x72, 0x69, 0x61, 0x6c, 0x4d, 0x61, 0x6e,
-  0x79, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x72, 0x67, 0x75, 0x65,
-  0x73, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x6e, 0x20, 0x41, 0x6d, 0x65, 0x72,
-  0x69, 0x63, 0x61, 0x6e, 0x63, 0x6f, 0x6e, 0x71, 0x75, 0x65, 0x73, 0x74, 0x20,
-  0x6f, 0x66, 0x77, 0x69, 0x64, 0x65, 0x73, 0x70, 0x72, 0x65, 0x61, 0x64, 0x20,
-  0x77, 0x65, 0x72, 0x65, 0x20, 0x6b, 0x69, 0x6c, 0x6c, 0x65, 0x64, 0x73, 0x63,
-  0x72, 0x65, 0x65, 0x6e, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x49, 0x6e, 0x20, 0x6f,
-  0x72, 0x64, 0x65, 0x72, 0x20, 0x74, 0x6f, 0x65, 0x78, 0x70, 0x65, 0x63, 0x74,
-  0x65, 0x64, 0x20, 0x74, 0x6f, 0x64, 0x65, 0x73, 0x63, 0x65, 0x6e, 0x64, 0x61,
-  0x6e, 0x74, 0x73, 0x61, 0x72, 0x65, 0x20, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x65,
-  0x64, 0x6c, 0x65, 0x67, 0x69, 0x73, 0x6c, 0x61, 0x74, 0x69, 0x76, 0x65, 0x67,
-  0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x62, 0x61,
-  0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x6d, 0x6f, 0x73, 0x74, 0x20,
-  0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x79, 0x65, 0x61, 0x72, 0x73, 0x20, 0x61,
-  0x66, 0x74, 0x65, 0x72, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x69, 0x73, 0x20,
-  0x6e, 0x6f, 0x74, 0x68, 0x65, 0x20, 0x68, 0x69, 0x67, 0x68, 0x65, 0x73, 0x74,
-  0x66, 0x72, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x20, 0x74, 0x68,
-  0x65, 0x79, 0x20, 0x64, 0x6f, 0x20, 0x6e, 0x6f, 0x74, 0x61, 0x72, 0x67, 0x75,
-  0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x73, 0x68, 0x6f, 0x77, 0x65, 0x64,
-  0x20, 0x74, 0x68, 0x61, 0x74, 0x70, 0x72, 0x65, 0x64, 0x6f, 0x6d, 0x69, 0x6e,
-  0x61, 0x6e, 0x74, 0x74, 0x68, 0x65, 0x6f, 0x6c, 0x6f, 0x67, 0x69, 0x63, 0x61,
-  0x6c, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x63,
-  0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x69, 0x6e, 0x67, 0x73, 0x68, 0x6f,
-  0x72, 0x74, 0x2d, 0x6c, 0x69, 0x76, 0x65, 0x64, 0x3c, 0x2f, 0x73, 0x70, 0x61,
-  0x6e, 0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x20,
-  0x75, 0x73, 0x65, 0x64, 0x76, 0x65, 0x72, 0x79, 0x20, 0x6c, 0x69, 0x74, 0x74,
-  0x6c, 0x65, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x68, 0x61, 0x64, 0x20, 0x61, 0x6c, 0x72, 0x65, 0x61, 0x64, 0x79, 0x69, 0x6e,
-  0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x63, 0x6f, 0x6d, 0x6d,
-  0x75, 0x6e, 0x69, 0x63, 0x61, 0x74, 0x65, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72,
-  0x65, 0x73, 0x20, 0x6f, 0x66, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65,
-  0x6e, 0x74, 0x2c, 0x3c, 0x2f, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x3e, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x22,
-  0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x22, 0x33, 0x49, 0x6e, 0x64,
-  0x65, 0x70, 0x65, 0x6e, 0x64, 0x65, 0x6e, 0x74, 0x70, 0x6f, 0x70, 0x75, 0x6c,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x2d, 0x73,
-  0x63, 0x61, 0x6c, 0x65, 0x2e, 0x20, 0x41, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67,
-  0x68, 0x20, 0x75, 0x73, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65,
-  0x64, 0x65, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x6f,
-  0x73, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x73, 0x74, 0x61, 0x72,
-  0x74, 0x69, 0x6e, 0x67, 0x20, 0x69, 0x6e, 0x74, 0x77, 0x6f, 0x20, 0x6f, 0x72,
-  0x20, 0x6d, 0x6f, 0x72, 0x65, 0x65, 0x78, 0x70, 0x72, 0x65, 0x73, 0x73, 0x69,
-  0x6f, 0x6e, 0x73, 0x73, 0x75, 0x62, 0x6f, 0x72, 0x64, 0x69, 0x6e, 0x61, 0x74,
-  0x65, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x68,
-  0x69, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x20, 0x61, 0x6e, 0x64, 0x3c, 0x2f, 0x6f,
-  0x70, 0x74, 0x69, 0x6f, 0x6e, 0x3e, 0x0d, 0x0a, 0x43, 0x6f, 0x6e, 0x74, 0x69,
-  0x6e, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x65, 0x6c, 0x69, 0x6d, 0x69, 0x6e, 0x61,
-  0x74, 0x69, 0x6e, 0x67, 0x77, 0x69, 0x6c, 0x6c, 0x20, 0x6e, 0x6f, 0x74, 0x20,
-  0x62, 0x65, 0x70, 0x72, 0x61, 0x63, 0x74, 0x69, 0x63, 0x65, 0x20, 0x6f, 0x66,
-  0x69, 0x6e, 0x20, 0x66, 0x72, 0x6f, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x73, 0x69,
-  0x74, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x6e, 0x73, 0x75,
-  0x72, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x74, 0x6f, 0x20, 0x63, 0x72, 0x65,
-  0x61, 0x74, 0x65, 0x20, 0x61, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x73, 0x73, 0x69,
-  0x70, 0x70, 0x69, 0x70, 0x6f, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x61, 0x6c, 0x6c,
-  0x79, 0x6f, 0x75, 0x74, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x62,
-  0x65, 0x74, 0x74, 0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x77, 0x68, 0x61,
-  0x74, 0x20, 0x69, 0x73, 0x20, 0x6e, 0x6f, 0x77, 0x73, 0x69, 0x74, 0x75, 0x61,
-  0x74, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e, 0x61,
-  0x6d, 0x65, 0x3d, 0x22, 0x54, 0x72, 0x61, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e,
-  0x61, 0x6c, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e, 0x73,
-  0x54, 0x72, 0x61, 0x6e, 0x73, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x68,
-  0x65, 0x20, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x6f, 0x66, 0x61, 0x74, 0x6d, 0x6f,
-  0x73, 0x70, 0x68, 0x65, 0x72, 0x69, 0x63, 0x69, 0x64, 0x65, 0x6f, 0x6c, 0x6f,
-  0x67, 0x69, 0x63, 0x61, 0x6c, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x69,
-  0x73, 0x65, 0x73, 0x63, 0x61, 0x6c, 0x63, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6e,
-  0x67, 0x65, 0x61, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x72,
-  0x65, 0x6d, 0x6e, 0x61, 0x6e, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x70, 0x6c, 0x75,
-  0x67, 0x69, 0x6e, 0x73, 0x70, 0x61, 0x67, 0x65, 0x2f, 0x69, 0x6e, 0x64, 0x65,
-  0x78, 0x2e, 0x70, 0x68, 0x70, 0x3f, 0x72, 0x65, 0x6d, 0x61, 0x69, 0x6e, 0x65,
-  0x64, 0x20, 0x69, 0x6e, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x66, 0x6f, 0x72, 0x6d,
-  0x65, 0x64, 0x48, 0x65, 0x20, 0x77, 0x61, 0x73, 0x20, 0x61, 0x6c, 0x73, 0x6f,
-  0x77, 0x61, 0x73, 0x20, 0x61, 0x6c, 0x72, 0x65, 0x61, 0x64, 0x79, 0x73, 0x74,
-  0x61, 0x74, 0x69, 0x73, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x69, 0x6e, 0x20, 0x66,
-  0x61, 0x76, 0x6f, 0x72, 0x20, 0x6f, 0x66, 0x4d, 0x69, 0x6e, 0x69, 0x73, 0x74,
-  0x72, 0x79, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x76, 0x65, 0x6d, 0x65, 0x6e, 0x74,
-  0x20, 0x6f, 0x66, 0x66, 0x6f, 0x72, 0x6d, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x69, 0x73, 0x20, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65, 0x64, 0x3c,
-  0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x54, 0x68, 0x69,
-  0x73, 0x20, 0x69, 0x73, 0x20, 0x74, 0x68, 0x65, 0x20, 0x3c, 0x61, 0x20, 0x68,
-  0x72, 0x65, 0x66, 0x3d, 0x22, 0x2f, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72,
-  0x69, 0x7a, 0x65, 0x64, 0x69, 0x6e, 0x76, 0x6f, 0x6c, 0x76, 0x65, 0x64, 0x20,
-  0x69, 0x6e, 0x61, 0x72, 0x65, 0x20, 0x75, 0x73, 0x65, 0x64, 0x20, 0x74, 0x6f,
-  0x61, 0x6e, 0x64, 0x20, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x6d, 0x61,
-  0x64, 0x65, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x73, 0x65, 0x65, 0x6d,
-  0x73, 0x20, 0x74, 0x6f, 0x20, 0x62, 0x65, 0x6c, 0x69, 0x6b, 0x65, 0x6c, 0x79,
-  0x20, 0x74, 0x68, 0x61, 0x74, 0x50, 0x61, 0x6c, 0x65, 0x73, 0x74, 0x69, 0x6e,
-  0x69, 0x61, 0x6e, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x20, 0x61, 0x66, 0x74, 0x65,
-  0x72, 0x69, 0x74, 0x20, 0x68, 0x61, 0x64, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x6d,
-  0x6f, 0x73, 0x74, 0x20, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x74, 0x6f, 0x20,
-  0x72, 0x65, 0x66, 0x65, 0x72, 0x20, 0x74, 0x6f, 0x62, 0x75, 0x74, 0x20, 0x74,
-  0x68, 0x69, 0x73, 0x20, 0x69, 0x73, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x63, 0x75,
-  0x74, 0x69, 0x76, 0x65, 0x74, 0x65, 0x6d, 0x70, 0x6f, 0x72, 0x61, 0x72, 0x69,
-  0x6c, 0x79, 0x49, 0x6e, 0x20, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x2c,
-  0x63, 0x6f, 0x6e, 0x76, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x61,
-  0x6b, 0x65, 0x73, 0x20, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x73, 0x75, 0x62, 0x64,
-  0x69, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x74, 0x65, 0x72, 0x72, 0x69, 0x74,
-  0x6f, 0x72, 0x69, 0x61, 0x6c, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x61, 0x6c, 0x70, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x65, 0x6e, 0x74, 0x6c,
-  0x79, 0x77, 0x61, 0x73, 0x20, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x6c, 0x79, 0x6f,
-  0x75, 0x74, 0x62, 0x72, 0x65, 0x61, 0x6b, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x20,
-  0x74, 0x68, 0x65, 0x20, 0x70, 0x61, 0x73, 0x74, 0x66, 0x6f, 0x6c, 0x6c, 0x6f,
-  0x77, 0x69, 0x6e, 0x67, 0x20, 0x61, 0x20, 0x78, 0x6d, 0x6c, 0x6e, 0x73, 0x3a,
-  0x6f, 0x67, 0x3d, 0x22, 0x3e, 0x3c, 0x61, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
-  0x3d, 0x22, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74,
-  0x43, 0x6f, 0x6e, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e, 0x20, 0x6d, 0x61,
-  0x79, 0x20, 0x62, 0x65, 0x20, 0x75, 0x73, 0x65, 0x64, 0x6d, 0x61, 0x6e, 0x75,
-  0x66, 0x61, 0x63, 0x74, 0x75, 0x72, 0x65, 0x61, 0x66, 0x74, 0x65, 0x72, 0x20,
-  0x62, 0x65, 0x69, 0x6e, 0x67, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x66, 0x69, 0x78,
-  0x22, 0x3e, 0x0a, 0x71, 0x75, 0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f,
-  0x66, 0x77, 0x61, 0x73, 0x20, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x74,
-  0x6f, 0x20, 0x62, 0x65, 0x63, 0x6f, 0x6d, 0x65, 0x20, 0x61, 0x62, 0x65, 0x63,
-  0x61, 0x75, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x20,
-  0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x69, 0x6e, 0x73, 0x70, 0x69, 0x72, 0x65,
-  0x64, 0x20, 0x62, 0x79, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x66, 0x75,
-  0x6c, 0x20, 0x61, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x20, 0x77, 0x68, 0x65, 0x6e,
-  0x6d, 0x6f, 0x72, 0x65, 0x20, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x61, 0x6d,
-  0x6f, 0x6e, 0x67, 0x73, 0x74, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x20, 0x6f,
-  0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a,
-  0x31, 0x30, 0x30, 0x25, 0x3b, 0x74, 0x65, 0x63, 0x68, 0x6e, 0x6f, 0x6c, 0x6f,
-  0x67, 0x79, 0x2c, 0x77, 0x61, 0x73, 0x20, 0x61, 0x64, 0x6f, 0x70, 0x74, 0x65,
-  0x64, 0x74, 0x6f, 0x20, 0x6b, 0x65, 0x65, 0x70, 0x20, 0x74, 0x68, 0x65, 0x73,
-  0x65, 0x74, 0x74, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x6c, 0x69, 0x76,
-  0x65, 0x20, 0x62, 0x69, 0x72, 0x74, 0x68, 0x73, 0x69, 0x6e, 0x64, 0x65, 0x78,
-  0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x22, 0x43, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74,
-  0x69, 0x63, 0x75, 0x74, 0x61, 0x73, 0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x20,
-  0x74, 0x6f, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x3b,
-  0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x20, 0x66, 0x6f, 0x72, 0x61, 0x6c,
-  0x69, 0x67, 0x6e, 0x3d, 0x72, 0x69, 0x67, 0x68, 0x74, 0x74, 0x68, 0x65, 0x20,
-  0x63, 0x6f, 0x6d, 0x70, 0x61, 0x6e, 0x79, 0x61, 0x6c, 0x77, 0x61, 0x79, 0x73,
-  0x20, 0x62, 0x65, 0x65, 0x6e, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x65, 0x64,
-  0x20, 0x74, 0x6f, 0x69, 0x6e, 0x76, 0x6f, 0x6c, 0x76, 0x65, 0x6d, 0x65, 0x6e,
-  0x74, 0x42, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20, 0x74, 0x68, 0x65, 0x74,
-  0x68, 0x69, 0x73, 0x20, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x22, 0x20, 0x6e,
-  0x61, 0x6d, 0x65, 0x3d, 0x22, 0x71, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x66, 0x69,
-  0x6e, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x61, 0x20, 0x72, 0x65, 0x73, 0x75, 0x6c,
-  0x74, 0x20, 0x6f, 0x66, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x22, 0x20,
-  0x2f, 0x3e, 0x69, 0x73, 0x20, 0x61, 0x63, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79,
-  0x45, 0x6e, 0x76, 0x69, 0x72, 0x6f, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x0d, 0x0a,
-  0x3c, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0d, 0x0a, 0x43, 0x6f, 0x6e, 0x76,
-  0x65, 0x72, 0x73, 0x65, 0x6c, 0x79, 0x2c, 0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76,
-  0x20, 0x69, 0x64, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68,
-  0x3d, 0x22, 0x31, 0x69, 0x73, 0x20, 0x70, 0x72, 0x6f, 0x62, 0x61, 0x62, 0x6c,
-  0x79, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62, 0x65, 0x63, 0x6f, 0x6d, 0x65, 0x63,
-  0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x74, 0x68, 0x65,
-  0x20, 0x70, 0x72, 0x6f, 0x62, 0x6c, 0x65, 0x6d, 0x63, 0x69, 0x74, 0x69, 0x7a,
-  0x65, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63,
-  0x69, 0x61, 0x6e, 0x73, 0x72, 0x65, 0x61, 0x63, 0x68, 0x65, 0x64, 0x20, 0x74,
-  0x68, 0x65, 0x61, 0x73, 0x20, 0x65, 0x61, 0x72, 0x6c, 0x79, 0x20, 0x61, 0x73,
-  0x3a, 0x6e, 0x6f, 0x6e, 0x65, 0x3b, 0x20, 0x6f, 0x76, 0x65, 0x72, 0x3c, 0x74,
-  0x61, 0x62, 0x6c, 0x65, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x76, 0x61, 0x6c, 0x69,
-  0x64, 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74,
-  0x6c, 0x79, 0x20, 0x74, 0x6f, 0x6f, 0x6e, 0x6d, 0x6f, 0x75, 0x73, 0x65, 0x64,
-  0x6f, 0x77, 0x6e, 0x77, 0x68, 0x65, 0x72, 0x65, 0x20, 0x69, 0x74, 0x20, 0x69,
-  0x73, 0x77, 0x68, 0x65, 0x6e, 0x20, 0x69, 0x74, 0x20, 0x77, 0x61, 0x73, 0x6d,
-  0x65, 0x6d, 0x62, 0x65, 0x72, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x72, 0x65, 0x6c,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x61, 0x63, 0x63, 0x6f, 0x6d,
-  0x6d, 0x6f, 0x64, 0x61, 0x74, 0x65, 0x61, 0x6c, 0x6f, 0x6e, 0x67, 0x20, 0x77,
-  0x69, 0x74, 0x68, 0x20, 0x49, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6c, 0x61,
-  0x74, 0x65, 0x74, 0x68, 0x65, 0x20, 0x45, 0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68,
-  0x64, 0x65, 0x6c, 0x69, 0x63, 0x69, 0x6f, 0x75, 0x73, 0x22, 0x3e, 0x74, 0x68,
-  0x69, 0x73, 0x20, 0x69, 0x73, 0x20, 0x6e, 0x6f, 0x74, 0x74, 0x68, 0x65, 0x20,
-  0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x20, 0x74, 0x68, 0x65,
-  0x79, 0x20, 0x61, 0x72, 0x65, 0x61, 0x6e, 0x64, 0x20, 0x66, 0x69, 0x6e, 0x61,
-  0x6c, 0x6c, 0x79, 0x61, 0x20, 0x6d, 0x61, 0x74, 0x74, 0x65, 0x72, 0x20, 0x6f,
-  0x66, 0x0d, 0x0a, 0x09, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a, 0x0d,
-  0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x66, 0x61, 0x73,
-  0x74, 0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x6d, 0x61, 0x6a, 0x6f, 0x72,
-  0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x61, 0x66, 0x74, 0x65, 0x72, 0x20, 0x77,
-  0x68, 0x69, 0x63, 0x68, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x61, 0x74, 0x69,
-  0x76, 0x65, 0x74, 0x6f, 0x20, 0x6d, 0x61, 0x69, 0x6e, 0x74, 0x61, 0x69, 0x6e,
-  0x69, 0x6d, 0x70, 0x72, 0x6f, 0x76, 0x65, 0x20, 0x74, 0x68, 0x65, 0x61, 0x77,
-  0x61, 0x72, 0x64, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x65, 0x72, 0x22, 0x20,
-  0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x62,
-  0x6f, 0x72, 0x64, 0x65, 0x72, 0x72, 0x65, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x61, 0x6d,
-  0x65, 0x61, 0x6e, 0x61, 0x6c, 0x79, 0x73, 0x69, 0x73, 0x20, 0x6f, 0x66, 0x74,
-  0x68, 0x65, 0x69, 0x72, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x44, 0x75, 0x72,
-  0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x69,
-  0x6e, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x73, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x63,
-  0x65, 0x20, 0x6f, 0x66, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28,
-  0x29, 0x7b, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69, 0x7a, 0x65, 0x3a, 0x20,
-  0x77, 0x6f, 0x72, 0x6b, 0x20, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x2f,
-  0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x3c, 0x62, 0x65, 0x67, 0x69,
-  0x6e, 0x73, 0x20, 0x77, 0x69, 0x74, 0x68, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63,
-  0x72, 0x69, 0x70, 0x74, 0x3a, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75,
-  0x65, 0x6e, 0x74, 0x77, 0x61, 0x73, 0x20, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x65,
-  0x64, 0x65, 0x71, 0x75, 0x69, 0x6c, 0x69, 0x62, 0x72, 0x69, 0x75, 0x6d, 0x61,
-  0x73, 0x73, 0x75, 0x6d, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x73, 0x20,
-  0x67, 0x69, 0x76, 0x65, 0x6e, 0x20, 0x62, 0x79, 0x6e, 0x65, 0x65, 0x64, 0x73,
-  0x20, 0x74, 0x6f, 0x20, 0x62, 0x65, 0x63, 0x6f, 0x6f, 0x72, 0x64, 0x69, 0x6e,
-  0x61, 0x74, 0x65, 0x73, 0x74, 0x68, 0x65, 0x20, 0x76, 0x61, 0x72, 0x69, 0x6f,
-  0x75, 0x73, 0x61, 0x72, 0x65, 0x20, 0x70, 0x61, 0x72, 0x74, 0x20, 0x6f, 0x66,
-  0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x73, 0x65,
-  0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x69, 0x73, 0x20, 0x61,
-  0x20, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x74, 0x68, 0x65, 0x6f, 0x72, 0x69,
-  0x65, 0x73, 0x20, 0x6f, 0x66, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72,
-  0x69, 0x65, 0x73, 0x61, 0x73, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x65, 0x64, 0x67, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73,
-  0x74, 0x72, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x20, 0x6f, 0x66, 0x70, 0x6f, 0x73,
-  0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x69, 0x6e, 0x70, 0x72, 0x65, 0x73, 0x65,
-  0x6e, 0x74, 0x2d, 0x64, 0x61, 0x79, 0x75, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73,
-  0x61, 0x6c, 0x6c, 0x79, 0x74, 0x6f, 0x20, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x74,
-  0x68, 0x65, 0x62, 0x75, 0x74, 0x20, 0x69, 0x6e, 0x73, 0x74, 0x65, 0x61, 0x64,
-  0x63, 0x6f, 0x72, 0x70, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x74,
-  0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x69, 0x73, 0x20, 0x63,
-  0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x6c, 0x79, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e,
-  0x73, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x74,
-  0x68, 0x65, 0x20, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x20, 0x6d, 0x61, 0x64,
-  0x65, 0x77, 0x61, 0x73, 0x20, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f, 0x77,
-  0x68, 0x69, 0x63, 0x68, 0x20, 0x6d, 0x65, 0x61, 0x6e, 0x73, 0x62, 0x75, 0x74,
-  0x20, 0x64, 0x69, 0x64, 0x20, 0x6e, 0x6f, 0x74, 0x6f, 0x6e, 0x4d, 0x6f, 0x75,
-  0x73, 0x65, 0x4f, 0x76, 0x65, 0x72, 0x61, 0x73, 0x20, 0x70, 0x6f, 0x73, 0x73,
-  0x69, 0x62, 0x6c, 0x65, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x20,
-  0x62, 0x79, 0x63, 0x6f, 0x6d, 0x69, 0x6e, 0x67, 0x20, 0x66, 0x72, 0x6f, 0x6d,
-  0x74, 0x68, 0x65, 0x20, 0x70, 0x72, 0x69, 0x6d, 0x61, 0x72, 0x79, 0x61, 0x64,
-  0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x66, 0x6f, 0x72, 0x20,
-  0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x66,
-  0x65, 0x72, 0x72, 0x65, 0x64, 0x61, 0x20, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64,
-  0x20, 0x6f, 0x66, 0x61, 0x72, 0x65, 0x20, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x74,
-  0x6f, 0x68, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x69, 0x74, 0x73,
-  0x68, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x68, 0x61, 0x76, 0x65, 0x6d, 0x75, 0x63,
-  0x68, 0x20, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x72, 0x0a, 0x09, 0x3c, 0x2f, 0x73,
-  0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x61, 0x64, 0x6f, 0x70, 0x74, 0x65, 0x64,
-  0x20, 0x74, 0x68, 0x65, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x74, 0x79, 0x20,
-  0x6f, 0x66, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79,
-  0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x6c, 0x79, 0x77, 0x61,
-  0x73, 0x20, 0x62, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x74, 0x63, 0x68, 0x69, 0x6c,
-  0x64, 0x72, 0x65, 0x6e, 0x20, 0x6f, 0x66, 0x50, 0x72, 0x6f, 0x67, 0x72, 0x61,
-  0x6d, 0x6d, 0x69, 0x6e, 0x67, 0x6c, 0x6f, 0x6e, 0x67, 0x65, 0x72, 0x20, 0x74,
-  0x68, 0x61, 0x6e, 0x6d, 0x61, 0x6e, 0x75, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x73, 0x77, 0x61, 0x72, 0x20, 0x61, 0x67, 0x61, 0x69, 0x6e, 0x73, 0x74, 0x62,
-  0x79, 0x20, 0x6d, 0x65, 0x61, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x61, 0x6e, 0x64,
-  0x20, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x73, 0x69, 0x6d, 0x69, 0x6c,
-  0x61, 0x72, 0x20, 0x74, 0x6f, 0x20, 0x70, 0x72, 0x6f, 0x70, 0x72, 0x69, 0x65,
-  0x74, 0x61, 0x72, 0x79, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x74, 0x69,
-  0x6e, 0x67, 0x70, 0x72, 0x65, 0x73, 0x74, 0x69, 0x67, 0x69, 0x6f, 0x75, 0x73,
-  0x67, 0x72, 0x61, 0x6d, 0x6d, 0x61, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x65, 0x78,
-  0x70, 0x65, 0x72, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x2e, 0x74, 0x6f, 0x20, 0x6d,
-  0x61, 0x6b, 0x65, 0x20, 0x74, 0x68, 0x65, 0x49, 0x74, 0x20, 0x77, 0x61, 0x73,
-  0x20, 0x61, 0x6c, 0x73, 0x6f, 0x69, 0x73, 0x20, 0x66, 0x6f, 0x75, 0x6e, 0x64,
-  0x20, 0x69, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x65, 0x74, 0x69, 0x74, 0x6f, 0x72,
-  0x73, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x55, 0x2e, 0x53, 0x2e, 0x72,
-  0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x20, 0x74, 0x68, 0x65, 0x62, 0x72, 0x6f,
-  0x75, 0x67, 0x68, 0x74, 0x20, 0x74, 0x68, 0x65, 0x63, 0x61, 0x6c, 0x63, 0x75,
-  0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x61, 0x6c, 0x6c, 0x20, 0x6f, 0x66,
-  0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x67, 0x65, 0x6e, 0x65, 0x72,
-  0x61, 0x6c, 0x70, 0x72, 0x61, 0x63, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79,
-  0x69, 0x6e, 0x20, 0x68, 0x6f, 0x6e, 0x6f, 0x72, 0x20, 0x6f, 0x66, 0x72, 0x65,
-  0x6c, 0x65, 0x61, 0x73, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x72, 0x65, 0x73, 0x69,
-  0x64, 0x65, 0x6e, 0x74, 0x69, 0x61, 0x6c, 0x61, 0x6e, 0x64, 0x20, 0x73, 0x6f,
-  0x6d, 0x65, 0x20, 0x6f, 0x66, 0x6b, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x20,
-  0x74, 0x68, 0x65, 0x72, 0x65, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74,
-  0x6f, 0x31, 0x73, 0x74, 0x20, 0x45, 0x61, 0x72, 0x6c, 0x20, 0x6f, 0x66, 0x63,
-  0x75, 0x6c, 0x74, 0x75, 0x72, 0x65, 0x20, 0x61, 0x6e, 0x64, 0x70, 0x72, 0x69,
-  0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x6c, 0x79, 0x3c, 0x2f, 0x74, 0x69, 0x74,
-  0x6c, 0x65, 0x3e, 0x0a, 0x20, 0x20, 0x74, 0x68, 0x65, 0x79, 0x20, 0x63, 0x61,
-  0x6e, 0x20, 0x62, 0x65, 0x62, 0x61, 0x63, 0x6b, 0x20, 0x74, 0x6f, 0x20, 0x74,
-  0x68, 0x65, 0x73, 0x6f, 0x6d, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x68, 0x69, 0x73,
-  0x65, 0x78, 0x70, 0x6f, 0x73, 0x75, 0x72, 0x65, 0x20, 0x74, 0x6f, 0x61, 0x72,
-  0x65, 0x20, 0x73, 0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x66, 0x6f, 0x72, 0x6d,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x64, 0x64, 0x46, 0x61, 0x76,
-  0x6f, 0x72, 0x69, 0x74, 0x65, 0x63, 0x69, 0x74, 0x69, 0x7a, 0x65, 0x6e, 0x73,
-  0x68, 0x69, 0x70, 0x70, 0x61, 0x72, 0x74, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68,
-  0x65, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x77, 0x69, 0x74, 0x68, 0x69,
-  0x6e, 0x20, 0x70, 0x72, 0x61, 0x63, 0x74, 0x69, 0x63, 0x65, 0x74, 0x6f, 0x20,
-  0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75, 0x65, 0x26, 0x61, 0x6d, 0x70, 0x3b,
-  0x6d, 0x69, 0x6e, 0x75, 0x73, 0x3b, 0x61, 0x70, 0x70, 0x72, 0x6f, 0x76, 0x65,
-  0x64, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x66, 0x69, 0x72, 0x73,
-  0x74, 0x20, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65,
-  0x61, 0x6e, 0x64, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x74, 0x68, 0x65, 0x66, 0x75,
-  0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x67, 0x70, 0x6c, 0x61, 0x79,
-  0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x22,
-  0x30, 0x22, 0x20, 0x69, 0x6e, 0x20, 0x68, 0x69, 0x73, 0x20, 0x62, 0x6f, 0x6f,
-  0x6b, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x20, 0x61, 0x66,
-  0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x73, 0x20, 0x74, 0x68, 0x65, 0x63, 0x72, 0x65,
-  0x61, 0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65,
-  0x6e, 0x63, 0x65, 0x20, 0x69, 0x6e, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c,
-  0x2f, 0x74, 0x64, 0x3e, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x69,
-  0x73, 0x74, 0x74, 0x68, 0x65, 0x20, 0x69, 0x64, 0x65, 0x61, 0x20, 0x6f, 0x66,
-  0x61, 0x20, 0x63, 0x68, 0x61, 0x72, 0x61, 0x63, 0x74, 0x65, 0x72, 0x77, 0x65,
-  0x72, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x64, 0x20, 0x63, 0x6c, 0x61,
-  0x73, 0x73, 0x3d, 0x22, 0x62, 0x74, 0x6e, 0x64, 0x61, 0x79, 0x73, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x66, 0x65, 0x61, 0x74, 0x75, 0x72, 0x65, 0x64,
-  0x20, 0x69, 0x6e, 0x73, 0x68, 0x6f, 0x77, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68,
-  0x65, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x74, 0x20, 0x69, 0x6e, 0x69,
-  0x6e, 0x20, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x74, 0x75, 0x72,
-  0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x68,
-  0x65, 0x61, 0x64, 0x20, 0x6f, 0x66, 0x4c, 0x6f, 0x72, 0x64, 0x20, 0x6f, 0x66,
-  0x20, 0x74, 0x68, 0x65, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63, 0x61, 0x6c,
-  0x6c, 0x79, 0x68, 0x61, 0x73, 0x20, 0x69, 0x74, 0x73, 0x20, 0x6f, 0x77, 0x6e,
-  0x45, 0x64, 0x75, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x61, 0x70,
-  0x70, 0x72, 0x6f, 0x76, 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x73, 0x6f, 0x6d, 0x65,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x61, 0x63, 0x68, 0x20, 0x6f,
-  0x74, 0x68, 0x65, 0x72, 0x2c, 0x62, 0x65, 0x68, 0x61, 0x76, 0x69, 0x6f, 0x72,
-  0x20, 0x6f, 0x66, 0x61, 0x6e, 0x64, 0x20, 0x62, 0x65, 0x63, 0x61, 0x75, 0x73,
-  0x65, 0x61, 0x6e, 0x64, 0x20, 0x61, 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x61,
-  0x70, 0x70, 0x65, 0x61, 0x72, 0x65, 0x64, 0x20, 0x6f, 0x6e, 0x72, 0x65, 0x63,
-  0x6f, 0x72, 0x64, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x62, 0x6c, 0x61, 0x63, 0x6b,
-  0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x6d, 0x61, 0x79, 0x20, 0x69, 0x6e, 0x63,
-  0x6c, 0x75, 0x64, 0x65, 0x74, 0x68, 0x65, 0x20, 0x77, 0x6f, 0x72, 0x6c, 0x64,
-  0x27, 0x73, 0x63, 0x61, 0x6e, 0x20, 0x6c, 0x65, 0x61, 0x64, 0x20, 0x74, 0x6f,
-  0x72, 0x65, 0x66, 0x65, 0x72, 0x73, 0x20, 0x74, 0x6f, 0x20, 0x61, 0x62, 0x6f,
-  0x72, 0x64, 0x65, 0x72, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x67, 0x6f, 0x76, 0x65,
-  0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x77, 0x69, 0x6e, 0x6e, 0x69, 0x6e,
-  0x67, 0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x65, 0x64,
-  0x20, 0x69, 0x6e, 0x20, 0x77, 0x68, 0x69, 0x6c, 0x65, 0x20, 0x74, 0x68, 0x65,
-  0x20, 0x57, 0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x74, 0x6f, 0x6e, 0x2c, 0x74,
-  0x68, 0x65, 0x20, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x63, 0x69, 0x74,
-  0x79, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x3e, 0x3c, 0x2f, 0x64, 0x69,
-  0x76, 0x3e, 0x0d, 0x0a, 0x09, 0x09, 0x72, 0x65, 0x66, 0x6c, 0x65, 0x63, 0x74,
-  0x20, 0x74, 0x68, 0x65, 0x74, 0x6f, 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x6c, 0x65,
-  0x74, 0x65, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x6d, 0x6f, 0x72, 0x65,
-  0x72, 0x61, 0x64, 0x69, 0x6f, 0x61, 0x63, 0x74, 0x69, 0x76, 0x65, 0x72, 0x65,
-  0x6a, 0x65, 0x63, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79, 0x77, 0x69, 0x74, 0x68,
-  0x6f, 0x75, 0x74, 0x20, 0x61, 0x6e, 0x79, 0x68, 0x69, 0x73, 0x20, 0x66, 0x61,
-  0x74, 0x68, 0x65, 0x72, 0x2c, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x63, 0x6f,
-  0x75, 0x6c, 0x64, 0x63, 0x6f, 0x70, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
-  0x65, 0x74, 0x6f, 0x20, 0x69, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x61,
-  0x20, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x61, 0x63, 0x63,
-  0x6f, 0x75, 0x6e, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x73, 0x74,
-  0x69, 0x74, 0x75, 0x74, 0x65, 0x73, 0x77, 0x6f, 0x72, 0x6b, 0x65, 0x64, 0x20,
-  0x77, 0x69, 0x74, 0x68, 0x65, 0x72, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x6c,
-  0x69, 0x3e, 0x6f, 0x66, 0x20, 0x68, 0x69, 0x73, 0x20, 0x6c, 0x69, 0x66, 0x65,
-  0x61, 0x63, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x6e, 0x69, 0x65, 0x64, 0x63, 0x6c,
-  0x69, 0x65, 0x6e, 0x74, 0x57, 0x69, 0x64, 0x74, 0x68, 0x70, 0x72, 0x65, 0x76,
-  0x65, 0x6e, 0x74, 0x20, 0x74, 0x68, 0x65, 0x4c, 0x65, 0x67, 0x69, 0x73, 0x6c,
-  0x61, 0x74, 0x69, 0x76, 0x65, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e,
-  0x74, 0x6c, 0x79, 0x74, 0x6f, 0x67, 0x65, 0x74, 0x68, 0x65, 0x72, 0x20, 0x69,
-  0x6e, 0x68, 0x61, 0x73, 0x20, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x66,
-  0x6f, 0x72, 0x20, 0x61, 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x74, 0x65, 0x78,
-  0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x66, 0x6f, 0x75, 0x6e, 0x64,
-  0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x65, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20,
-  0x74, 0x68, 0x65, 0x20, 0x69, 0x73, 0x20, 0x75, 0x73, 0x65, 0x64, 0x20, 0x66,
-  0x6f, 0x72, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65,
-  0x75, 0x73, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x74, 0x68, 0x65, 0x70, 0x6c,
-  0x61, 0x63, 0x65, 0x20, 0x77, 0x68, 0x65, 0x72, 0x65, 0x77, 0x68, 0x65, 0x72,
-  0x65, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x3e, 0x20, 0x3c, 0x61, 0x20, 0x68,
-  0x72, 0x65, 0x66, 0x3d, 0x22, 0x22, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65,
-  0x66, 0x3d, 0x22, 0x74, 0x68, 0x65, 0x6d, 0x73, 0x65, 0x6c, 0x76, 0x65, 0x73,
-  0x2c, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x68, 0x65, 0x74,
-  0x68, 0x61, 0x74, 0x20, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x74, 0x72, 0x61,
-  0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x72, 0x6f, 0x6c, 0x65, 0x20,
-  0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x73, 0x20, 0x61, 0x20, 0x72, 0x65,
-  0x73, 0x75, 0x6c, 0x74, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x65, 0x43, 0x68, 0x69,
-  0x6c, 0x64, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x20, 0x62, 0x79,
-  0x77, 0x65, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x53, 0x6f,
-  0x6d, 0x65, 0x20, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x70, 0x72, 0x6f, 0x64,
-  0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2c, 0x73, 0x69, 0x64, 0x65, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x6e, 0x65, 0x77, 0x73, 0x6c, 0x65, 0x74, 0x74,
-  0x65, 0x72, 0x73, 0x75, 0x73, 0x65, 0x64, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68,
-  0x65, 0x64, 0x6f, 0x77, 0x6e, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x61,
-  0x63, 0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79, 0x6c, 0x69, 0x76,
-  0x65, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x61, 0x74, 0x74, 0x65, 0x6d,
-  0x70, 0x74, 0x73, 0x20, 0x74, 0x6f, 0x6f, 0x75, 0x74, 0x73, 0x69, 0x64, 0x65,
-  0x20, 0x74, 0x68, 0x65, 0x66, 0x72, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x63, 0x69,
-  0x65, 0x73, 0x48, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x69, 0x6e,
-  0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x6d, 0x65, 0x72, 0x73, 0x61, 0x74,
-  0x20, 0x6c, 0x65, 0x61, 0x73, 0x74, 0x20, 0x69, 0x6e, 0x61, 0x70, 0x70, 0x72,
-  0x6f, 0x78, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75,
-  0x67, 0x68, 0x20, 0x69, 0x74, 0x77, 0x61, 0x73, 0x20, 0x70, 0x61, 0x72, 0x74,
-  0x20, 0x6f, 0x66, 0x61, 0x6e, 0x64, 0x20, 0x76, 0x61, 0x72, 0x69, 0x6f, 0x75,
-  0x73, 0x47, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6f, 0x72, 0x20, 0x6f, 0x66, 0x74,
-  0x68, 0x65, 0x20, 0x61, 0x72, 0x74, 0x69, 0x63, 0x6c, 0x65, 0x74, 0x75, 0x72,
-  0x6e, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x3e, 0x3c, 0x61, 0x20, 0x68,
-  0x72, 0x65, 0x66, 0x3d, 0x22, 0x2f, 0x74, 0x68, 0x65, 0x20, 0x65, 0x63, 0x6f,
-  0x6e, 0x6f, 0x6d, 0x79, 0x69, 0x73, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f,
-  0x73, 0x74, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x77, 0x69, 0x64, 0x65, 0x6c, 0x79,
-  0x77, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x6c, 0x61, 0x74, 0x65, 0x72, 0x61, 0x6e,
-  0x64, 0x20, 0x70, 0x65, 0x72, 0x68, 0x61, 0x70, 0x73, 0x72, 0x69, 0x73, 0x65,
-  0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x63, 0x63, 0x75, 0x72, 0x73,
-  0x20, 0x77, 0x68, 0x65, 0x6e, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x20, 0x77, 0x68,
-  0x69, 0x63, 0x68, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73,
-  0x2e, 0x74, 0x68, 0x65, 0x20, 0x77, 0x65, 0x73, 0x74, 0x65, 0x72, 0x6e, 0x74,
-  0x68, 0x65, 0x6f, 0x72, 0x79, 0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x73, 0x20,
-  0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x65, 0x64, 0x74, 0x68, 0x65, 0x20, 0x63,
-  0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x20, 0x77, 0x68, 0x69, 0x63,
-  0x68, 0x20, 0x68, 0x65, 0x73, 0x65, 0x65, 0x6e, 0x20, 0x69, 0x6e, 0x20, 0x74,
-  0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x72, 0x61, 0x6c,
-  0x62, 0x75, 0x69, 0x6c, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x6d, 0x61,
-  0x6e, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x68, 0x69, 0x73, 0x61, 0x72, 0x65, 0x61,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x69, 0x73, 0x20, 0x74, 0x68, 0x65,
-  0x20, 0x6f, 0x6e, 0x6c, 0x79, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20,
-  0x74, 0x68, 0x65, 0x6d, 0x61, 0x6e, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
-  0x65, 0x74, 0x68, 0x65, 0x20, 0x57, 0x65, 0x73, 0x74, 0x65, 0x72, 0x6e, 0x54,
-  0x68, 0x65, 0x72, 0x65, 0x20, 0x69, 0x73, 0x20, 0x6e, 0x6f, 0x65, 0x78, 0x74,
-  0x65, 0x6e, 0x64, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x53, 0x74, 0x61, 0x74, 0x69,
-  0x73, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x63, 0x6f, 0x6c, 0x73, 0x70, 0x61, 0x6e,
-  0x3d, 0x32, 0x20, 0x7c, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x20, 0x73, 0x74, 0x6f,
-  0x72, 0x79, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f,
-  0x74, 0x6f, 0x70, 0x6f, 0x6c, 0x6f, 0x67, 0x69, 0x63, 0x61, 0x6c, 0x63, 0x72,
-  0x69, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x70, 0x6f,
-  0x72, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x61, 0x20, 0x43, 0x68, 0x72, 0x69,
-  0x73, 0x74, 0x69, 0x61, 0x6e, 0x64, 0x65, 0x63, 0x69, 0x73, 0x69, 0x6f, 0x6e,
-  0x20, 0x74, 0x6f, 0x69, 0x73, 0x20, 0x65, 0x71, 0x75, 0x61, 0x6c, 0x20, 0x74,
-  0x6f, 0x70, 0x72, 0x6f, 0x62, 0x6c, 0x65, 0x6d, 0x73, 0x20, 0x6f, 0x66, 0x54,
-  0x68, 0x69, 0x73, 0x20, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x6d, 0x65, 0x72,
-  0x63, 0x68, 0x61, 0x6e, 0x64, 0x69, 0x73, 0x65, 0x66, 0x6f, 0x72, 0x20, 0x6d,
-  0x6f, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x6e, 0x6f, 0x20, 0x65, 0x76, 0x69, 0x64,
-  0x65, 0x6e, 0x63, 0x65, 0x65, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20,
-  0x6f, 0x66, 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x20, 0x69, 0x6e,
-  0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x2e, 0x20, 0x54, 0x68, 0x65, 0x63, 0x6f,
-  0x6d, 0x2f, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x73, 0x2f, 0x77, 0x68, 0x69, 0x63,
-  0x68, 0x20, 0x6d, 0x61, 0x6b, 0x65, 0x73, 0x74, 0x68, 0x65, 0x20, 0x70, 0x72,
-  0x6f, 0x63, 0x65, 0x73, 0x73, 0x72, 0x65, 0x6d, 0x61, 0x69, 0x6e, 0x73, 0x20,
-  0x74, 0x68, 0x65, 0x6c, 0x69, 0x74, 0x65, 0x72, 0x61, 0x74, 0x75, 0x72, 0x65,
-  0x2c, 0x69, 0x73, 0x20, 0x61, 0x20, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x74,
-  0x68, 0x65, 0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x74, 0x68, 0x65,
-  0x20, 0x61, 0x6e, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x70, 0x72, 0x6f, 0x62, 0x6c,
-  0x65, 0x6d, 0x73, 0x20, 0x69, 0x6e, 0x74, 0x69, 0x6d, 0x65, 0x20, 0x6f, 0x66,
-  0x20, 0x74, 0x68, 0x65, 0x64, 0x65, 0x66, 0x65, 0x61, 0x74, 0x65, 0x64, 0x20,
-  0x62, 0x79, 0x62, 0x6f, 0x64, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
-  0x61, 0x20, 0x66, 0x65, 0x77, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73, 0x6d, 0x75,
-  0x63, 0x68, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20,
-  0x77, 0x6f, 0x72, 0x6b, 0x20, 0x6f, 0x66, 0x43, 0x61, 0x6c, 0x69, 0x66, 0x6f,
-  0x72, 0x6e, 0x69, 0x61, 0x2c, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x20, 0x61,
-  0x73, 0x20, 0x61, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74,
-  0x2e, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x70, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x6d,
-  0x6f, 0x76, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x69, 0x6e, 0x09, 0x09, 0x3c,
-  0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x69, 0x74, 0x22, 0x20, 0x76,
-  0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67,
-  0x65, 0x20, 0x6f, 0x66, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x79, 0x20, 0x61,
-  0x72, 0x65, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x65, 0x64, 0x20, 0x69, 0x6e,
-  0x69, 0x73, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x65, 0x78,
-  0x70, 0x6c, 0x61, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x64, 0x69, 0x76, 0x3e,
-  0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x48, 0x6f, 0x77, 0x65, 0x76, 0x65,
-  0x72, 0x20, 0x74, 0x68, 0x65, 0x6c, 0x65, 0x61, 0x64, 0x20, 0x74, 0x6f, 0x20,
-  0x74, 0x68, 0x65, 0x09, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22,
-  0x2f, 0x77, 0x61, 0x73, 0x20, 0x67, 0x72, 0x61, 0x6e, 0x74, 0x65, 0x64, 0x70,
-  0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x68, 0x61, 0x76, 0x65, 0x63, 0x6f, 0x6e,
-  0x74, 0x69, 0x6e, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x77, 0x61, 0x73, 0x20, 0x73,
-  0x65, 0x65, 0x6e, 0x20, 0x61, 0x73, 0x61, 0x6e, 0x64, 0x20, 0x72, 0x65, 0x6c,
-  0x61, 0x74, 0x65, 0x64, 0x74, 0x68, 0x65, 0x20, 0x72, 0x6f, 0x6c, 0x65, 0x20,
-  0x6f, 0x66, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x20, 0x62, 0x79,
-  0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x62, 0x65, 0x73, 0x74, 0x65, 0x61,
-  0x63, 0x68, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x2e, 0x43, 0x6f, 0x6e, 0x73,
-  0x74, 0x61, 0x6e, 0x74, 0x69, 0x6e, 0x65, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65,
-  0x20, 0x66, 0x72, 0x6f, 0x6d, 0x64, 0x69, 0x61, 0x6c, 0x65, 0x63, 0x74, 0x73,
-  0x20, 0x6f, 0x66, 0x74, 0x6f, 0x20, 0x72, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f,
-  0x6e, 0x77, 0x61, 0x73, 0x20, 0x72, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x61,
-  0x20, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65,
-  0x20, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x61, 0x6c, 0x6c, 0x61, 0x75, 0x6e, 0x63,
-  0x68, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65,
-  0x20, 0x74, 0x68, 0x65, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77, 0x65,
-  0x73, 0x74, 0x77, 0x68, 0x65, 0x72, 0x65, 0x20, 0x74, 0x68, 0x65, 0x72, 0x65,
-  0x61, 0x6e, 0x64, 0x20, 0x73, 0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x62, 0x65,
-  0x74, 0x77, 0x65, 0x65, 0x6e, 0x20, 0x74, 0x77, 0x6f, 0x69, 0x73, 0x20, 0x61,
-  0x6c, 0x73, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x45, 0x6e, 0x67, 0x6c, 0x69, 0x73,
-  0x68, 0x20, 0x61, 0x6e, 0x64, 0x63, 0x6f, 0x6e, 0x64, 0x69, 0x74, 0x69, 0x6f,
-  0x6e, 0x73, 0x2c, 0x74, 0x68, 0x61, 0x74, 0x20, 0x69, 0x74, 0x20, 0x77, 0x61,
-  0x73, 0x65, 0x6e, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x74,
-  0x68, 0x65, 0x6d, 0x73, 0x65, 0x6c, 0x76, 0x65, 0x73, 0x2e, 0x71, 0x75, 0x61,
-  0x6e, 0x74, 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x72, 0x61, 0x6e, 0x73, 0x70,
-  0x61, 0x72, 0x65, 0x6e, 0x63, 0x79, 0x74, 0x68, 0x65, 0x20, 0x73, 0x61, 0x6d,
-  0x65, 0x20, 0x61, 0x73, 0x74, 0x6f, 0x20, 0x6a, 0x6f, 0x69, 0x6e, 0x20, 0x74,
-  0x68, 0x65, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x72, 0x79, 0x20, 0x61, 0x6e, 0x64,
-  0x74, 0x68, 0x69, 0x73, 0x20, 0x69, 0x73, 0x20, 0x74, 0x68, 0x65, 0x54, 0x68,
-  0x69, 0x73, 0x20, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x61, 0x20, 0x73, 0x74,
-  0x61, 0x74, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x61,
-  0x73, 0x74, 0x20, 0x74, 0x6f, 0x6c, 0x61, 0x73, 0x74, 0x49, 0x6e, 0x64, 0x65,
-  0x78, 0x4f, 0x66, 0x74, 0x68, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x68, 0x69,
-  0x73, 0x69, 0x73, 0x20, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x74,
-  0x68, 0x65, 0x20, 0x74, 0x65, 0x72, 0x6d, 0x20, 0x69, 0x73, 0x69, 0x73, 0x20,
-  0x70, 0x72, 0x6f, 0x76, 0x69, 0x64, 0x65, 0x64, 0x70, 0x72, 0x6f, 0x74, 0x65,
-  0x63, 0x74, 0x20, 0x74, 0x68, 0x65, 0x6e, 0x67, 0x3c, 0x2f, 0x61, 0x3e, 0x3c,
-  0x2f, 0x6c, 0x69, 0x3e, 0x54, 0x68, 0x65, 0x20, 0x63, 0x75, 0x72, 0x72, 0x65,
-  0x6e, 0x74, 0x74, 0x68, 0x65, 0x20, 0x73, 0x69, 0x74, 0x65, 0x20, 0x6f, 0x66,
-  0x73, 0x75, 0x62, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x69, 0x61, 0x6c, 0x65, 0x78,
-  0x70, 0x65, 0x72, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x2c, 0x69, 0x6e, 0x20, 0x74,
-  0x68, 0x65, 0x20, 0x57, 0x65, 0x73, 0x74, 0x74, 0x68, 0x65, 0x79, 0x20, 0x73,
-  0x68, 0x6f, 0x75, 0x6c, 0x64, 0x73, 0x6c, 0x6f, 0x76, 0x65, 0x6e, 0xc4, 0x8d,
-  0x69, 0x6e, 0x61, 0x63, 0x6f, 0x6d, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x69, 0x6f,
-  0x73, 0x75, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x64, 0x61, 0x64, 0x63,
-  0x6f, 0x6e, 0x64, 0x69, 0x63, 0x69, 0x6f, 0x6e, 0x65, 0x73, 0x61, 0x63, 0x74,
-  0x69, 0x76, 0x69, 0x64, 0x61, 0x64, 0x65, 0x73, 0x65, 0x78, 0x70, 0x65, 0x72,
-  0x69, 0x65, 0x6e, 0x63, 0x69, 0x61, 0x74, 0x65, 0x63, 0x6e, 0x6f, 0x6c, 0x6f,
-  0x67, 0xc3, 0xad, 0x61, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x63, 0x69, 0xc3,
-  0xb3, 0x6e, 0x70, 0x75, 0x6e, 0x74, 0x75, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e,
-  0x61, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x6f,
-  0x6e, 0x74, 0x72, 0x61, 0x73, 0x65, 0xc3, 0xb1, 0x61, 0x63, 0x61, 0x74, 0x65,
-  0x67, 0x6f, 0x72, 0xc3, 0xad, 0x61, 0x73, 0x72, 0x65, 0x67, 0x69, 0x73, 0x74,
-  0x72, 0x61, 0x72, 0x73, 0x65, 0x70, 0x72, 0x6f, 0x66, 0x65, 0x73, 0x69, 0x6f,
-  0x6e, 0x61, 0x6c, 0x74, 0x72, 0x61, 0x74, 0x61, 0x6d, 0x69, 0x65, 0x6e, 0x74,
-  0x6f, 0x72, 0x65, 0x67, 0xc3, 0xad, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, 0x73,
-  0x65, 0x63, 0x72, 0x65, 0x74, 0x61, 0x72, 0xc3, 0xad, 0x61, 0x70, 0x72, 0x69,
-  0x6e, 0x63, 0x69, 0x70, 0x61, 0x6c, 0x65, 0x73, 0x70, 0x72, 0x6f, 0x74, 0x65,
-  0x63, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61,
-  0x6e, 0x74, 0x65, 0x73, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x63,
-  0x69, 0x61, 0x70, 0x6f, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x64, 0x61, 0x64,
-  0x69, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x61, 0x6e, 0x74, 0x65, 0x63, 0x72,
-  0x65, 0x63, 0x69, 0x6d, 0x69, 0x65, 0x6e, 0x74, 0x6f, 0x6e, 0x65, 0x63, 0x65,
-  0x73, 0x69, 0x64, 0x61, 0x64, 0x65, 0x73, 0x73, 0x75, 0x73, 0x63, 0x72, 0x69,
-  0x62, 0x69, 0x72, 0x73, 0x65, 0x61, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x63, 0x69,
-  0xc3, 0xb3, 0x6e, 0x64, 0x69, 0x73, 0x70, 0x6f, 0x6e, 0x69, 0x62, 0x6c, 0x65,
-  0x73, 0x65, 0x76, 0x61, 0x6c, 0x75, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x65,
-  0x73, 0x74, 0x75, 0x64, 0x69, 0x61, 0x6e, 0x74, 0x65, 0x73, 0x72, 0x65, 0x73,
-  0x70, 0x6f, 0x6e, 0x73, 0x61, 0x62, 0x6c, 0x65, 0x72, 0x65, 0x73, 0x6f, 0x6c,
-  0x75, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x67, 0x75, 0x61, 0x64, 0x61, 0x6c, 0x61,
-  0x6a, 0x61, 0x72, 0x61, 0x72, 0x65, 0x67, 0x69, 0x73, 0x74, 0x72, 0x61, 0x64,
-  0x6f, 0x73, 0x6f, 0x70, 0x6f, 0x72, 0x74, 0x75, 0x6e, 0x69, 0x64, 0x61, 0x64,
-  0x63, 0x6f, 0x6d, 0x65, 0x72, 0x63, 0x69, 0x61, 0x6c, 0x65, 0x73, 0x66, 0x6f,
-  0x74, 0x6f, 0x67, 0x72, 0x61, 0x66, 0xc3, 0xad, 0x61, 0x61, 0x75, 0x74, 0x6f,
-  0x72, 0x69, 0x64, 0x61, 0x64, 0x65, 0x73, 0x69, 0x6e, 0x67, 0x65, 0x6e, 0x69,
-  0x65, 0x72, 0xc3, 0xad, 0x61, 0x74, 0x65, 0x6c, 0x65, 0x76, 0x69, 0x73, 0x69,
-  0xc3, 0xb3, 0x6e, 0x63, 0x6f, 0x6d, 0x70, 0x65, 0x74, 0x65, 0x6e, 0x63, 0x69,
-  0x61, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x63, 0x69, 0x6f, 0x6e, 0x65, 0x73, 0x65,
-  0x73, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x63, 0x69, 0x64, 0x6f, 0x73, 0x69, 0x6d,
-  0x70, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x65, 0x61, 0x63, 0x74, 0x75, 0x61,
-  0x6c, 0x6d, 0x65, 0x6e, 0x74, 0x65, 0x6e, 0x61, 0x76, 0x65, 0x67, 0x61, 0x63,
-  0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x6f, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x69, 0x64,
-  0x61, 0x64, 0x6c, 0x69, 0x6e, 0x65, 0x2d, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74,
-  0x3a, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x79, 0x3a,
-  0x22, 0x20, 0x3a, 0x20, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x61,
-  0x70, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x6c, 0x69,
-  0x6e, 0x6b, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x73, 0x70, 0x65,
-  0x63, 0x69, 0x66, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x2f, 0x2f, 0x3c, 0x21,
-  0x5b, 0x43, 0x44, 0x41, 0x54, 0x41, 0x5b, 0x0a, 0x4f, 0x72, 0x67, 0x61, 0x6e,
-  0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x64, 0x69, 0x73, 0x74, 0x72, 0x69,
-  0x62, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x30, 0x70, 0x78, 0x3b, 0x20, 0x68, 0x65,
-  0x69, 0x67, 0x68, 0x74, 0x3a, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x68, 0x69, 0x70, 0x64, 0x65, 0x76, 0x69, 0x63, 0x65, 0x2d, 0x77, 0x69,
-  0x64, 0x74, 0x68, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
-  0x3d, 0x22, 0x3c, 0x6c, 0x61, 0x62, 0x65, 0x6c, 0x20, 0x66, 0x6f, 0x72, 0x3d,
-  0x22, 0x72, 0x65, 0x67, 0x69, 0x73, 0x74, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x3c, 0x2f, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x2f,
-  0x69, 0x6e, 0x64, 0x65, 0x78, 0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x22, 0x77, 0x69,
-  0x6e, 0x64, 0x6f, 0x77, 0x2e, 0x6f, 0x70, 0x65, 0x6e, 0x28, 0x20, 0x21, 0x69,
-  0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x3b, 0x61, 0x70, 0x70, 0x6c,
-  0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2f, 0x69, 0x6e, 0x64, 0x65, 0x70,
-  0x65, 0x6e, 0x64, 0x65, 0x6e, 0x63, 0x65, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e,
-  0x67, 0x6f, 0x6f, 0x67, 0x6c, 0x65, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x75, 0x74, 0x6f, 0x63, 0x6f, 0x6d, 0x70,
-  0x6c, 0x65, 0x74, 0x65, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65, 0x6d, 0x65,
-  0x6e, 0x74, 0x73, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x72, 0x76, 0x61, 0x74, 0x69,
-  0x76, 0x65, 0x3c, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d,
-  0x22, 0x69, 0x6e, 0x74, 0x65, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x75, 0x61, 0x6c,
-  0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x6c, 0x65, 0x66, 0x74, 0x3a, 0x31,
-  0x38, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x79, 0x61, 0x6e,
-  0x20, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x69, 0x6e, 0x73,
-  0x74, 0x69, 0x74, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x61, 0x62, 0x62, 0x72,
-  0x65, 0x76, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3c, 0x69, 0x6d, 0x67, 0x20,
-  0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69,
-  0x73, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x69, 0x76, 0x69, 0x6c, 0x69, 0x7a,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x31, 0x39, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e,
-  0x74, 0x75, 0x72, 0x79, 0x61, 0x72, 0x63, 0x68, 0x69, 0x74, 0x65, 0x63, 0x74,
-  0x75, 0x72, 0x65, 0x69, 0x6e, 0x63, 0x6f, 0x72, 0x70, 0x6f, 0x72, 0x61, 0x74,
-  0x65, 0x64, 0x32, 0x30, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x75, 0x72,
-  0x79, 0x2d, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65, 0x72, 0x22, 0x3e,
-  0x6d, 0x6f, 0x73, 0x74, 0x20, 0x6e, 0x6f, 0x74, 0x61, 0x62, 0x6c, 0x79, 0x2f,
-  0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x6e, 0x6f,
-  0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x27, 0x75, 0x6e,
-  0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x27, 0x29, 0x46, 0x75, 0x72, 0x74,
-  0x68, 0x65, 0x72, 0x6d, 0x6f, 0x72, 0x65, 0x2c, 0x62, 0x65, 0x6c, 0x69, 0x65,
-  0x76, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x6e, 0x6e, 0x65, 0x72, 0x48,
-  0x54, 0x4d, 0x4c, 0x20, 0x3d, 0x20, 0x70, 0x72, 0x69, 0x6f, 0x72, 0x20, 0x74,
-  0x6f, 0x20, 0x74, 0x68, 0x65, 0x64, 0x72, 0x61, 0x6d, 0x61, 0x74, 0x69, 0x63,
-  0x61, 0x6c, 0x6c, 0x79, 0x72, 0x65, 0x66, 0x65, 0x72, 0x72, 0x69, 0x6e, 0x67,
-  0x20, 0x74, 0x6f, 0x6e, 0x65, 0x67, 0x6f, 0x74, 0x69, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x73, 0x68, 0x65, 0x61, 0x64, 0x71, 0x75, 0x61, 0x72, 0x74, 0x65, 0x72,
-  0x73, 0x53, 0x6f, 0x75, 0x74, 0x68, 0x20, 0x41, 0x66, 0x72, 0x69, 0x63, 0x61,
-  0x75, 0x6e, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x66, 0x75, 0x6c, 0x50,
-  0x65, 0x6e, 0x6e, 0x73, 0x79, 0x6c, 0x76, 0x61, 0x6e, 0x69, 0x61, 0x41, 0x73,
-  0x20, 0x61, 0x20, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x2c, 0x3c, 0x68, 0x74,
-  0x6d, 0x6c, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x3d, 0x22, 0x26, 0x6c, 0x74, 0x3b,
-  0x2f, 0x73, 0x75, 0x70, 0x26, 0x67, 0x74, 0x3b, 0x64, 0x65, 0x61, 0x6c, 0x69,
-  0x6e, 0x67, 0x20, 0x77, 0x69, 0x74, 0x68, 0x70, 0x68, 0x69, 0x6c, 0x61, 0x64,
-  0x65, 0x6c, 0x70, 0x68, 0x69, 0x61, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x69,
-  0x63, 0x61, 0x6c, 0x6c, 0x79, 0x29, 0x3b, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69,
-  0x70, 0x74, 0x3e, 0x0a, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x2d, 0x74,
-  0x6f, 0x70, 0x3a, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x6d, 0x65, 0x6e, 0x74,
-  0x61, 0x6c, 0x67, 0x65, 0x74, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74,
-  0x65, 0x69, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73,
-  0x74, 0x65, 0x63, 0x68, 0x6e, 0x6f, 0x6c, 0x6f, 0x67, 0x69, 0x65, 0x73, 0x70,
-  0x61, 0x72, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x3d, 0x66,
-  0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x29, 0x7b, 0x73, 0x75, 0x62,
-  0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x6c, 0x2e, 0x64, 0x74,
-  0x64, 0x22, 0x3e, 0x0d, 0x0a, 0x3c, 0x68, 0x74, 0x67, 0x65, 0x6f, 0x67, 0x72,
-  0x61, 0x70, 0x68, 0x69, 0x63, 0x61, 0x6c, 0x43, 0x6f, 0x6e, 0x73, 0x74, 0x69,
-  0x74, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x27, 0x2c, 0x20, 0x66, 0x75, 0x6e, 0x63,
-  0x74, 0x69, 0x6f, 0x6e, 0x28, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65,
-  0x64, 0x20, 0x62, 0x79, 0x61, 0x67, 0x72, 0x69, 0x63, 0x75, 0x6c, 0x74, 0x75,
-  0x72, 0x61, 0x6c, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x69,
-  0x6f, 0x6e, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69, 0x7a, 0x65, 0x3a, 0x20, 0x31,
-  0x61, 0x20, 0x76, 0x61, 0x72, 0x69, 0x65, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x3c,
-  0x64, 0x69, 0x76, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x45, 0x6e,
-  0x63, 0x79, 0x63, 0x6c, 0x6f, 0x70, 0x65, 0x64, 0x69, 0x61, 0x69, 0x66, 0x72,
-  0x61, 0x6d, 0x65, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x64, 0x65, 0x6d, 0x6f,
-  0x6e, 0x73, 0x74, 0x72, 0x61, 0x74, 0x65, 0x64, 0x61, 0x63, 0x63, 0x6f, 0x6d,
-  0x70, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x64, 0x75, 0x6e, 0x69, 0x76, 0x65, 0x72,
-  0x73, 0x69, 0x74, 0x69, 0x65, 0x73, 0x44, 0x65, 0x6d, 0x6f, 0x67, 0x72, 0x61,
-  0x70, 0x68, 0x69, 0x63, 0x73, 0x29, 0x3b, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69,
-  0x70, 0x74, 0x3e, 0x3c, 0x64, 0x65, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x64,
-  0x20, 0x74, 0x6f, 0x6b, 0x6e, 0x6f, 0x77, 0x6c, 0x65, 0x64, 0x67, 0x65, 0x20,
-  0x6f, 0x66, 0x73, 0x61, 0x74, 0x69, 0x73, 0x66, 0x61, 0x63, 0x74, 0x69, 0x6f,
-  0x6e, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c, 0x61, 0x72, 0x6c, 0x79,
-  0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x45,
-  0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68, 0x20, 0x28, 0x55, 0x53, 0x29, 0x61, 0x70,
-  0x70, 0x65, 0x6e, 0x64, 0x43, 0x68, 0x69, 0x6c, 0x64, 0x28, 0x74, 0x72, 0x61,
-  0x6e, 0x73, 0x6d, 0x69, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x2e, 0x20, 0x48,
-  0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x69, 0x6e, 0x74, 0x65, 0x6c,
-  0x6c, 0x69, 0x67, 0x65, 0x6e, 0x63, 0x65, 0x22, 0x20, 0x74, 0x61, 0x62, 0x69,
-  0x6e, 0x64, 0x65, 0x78, 0x3d, 0x22, 0x66, 0x6c, 0x6f, 0x61, 0x74, 0x3a, 0x72,
-  0x69, 0x67, 0x68, 0x74, 0x3b, 0x43, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x77, 0x65,
-  0x61, 0x6c, 0x74, 0x68, 0x72, 0x61, 0x6e, 0x67, 0x69, 0x6e, 0x67, 0x20, 0x66,
-  0x72, 0x6f, 0x6d, 0x69, 0x6e, 0x20, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x74,
-  0x68, 0x65, 0x61, 0x74, 0x20, 0x6c, 0x65, 0x61, 0x73, 0x74, 0x20, 0x6f, 0x6e,
-  0x65, 0x72, 0x65, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e,
-  0x65, 0x6e, 0x63, 0x79, 0x63, 0x6c, 0x6f, 0x70, 0x65, 0x64, 0x69, 0x61, 0x3b,
-  0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69, 0x7a, 0x65, 0x3a, 0x31, 0x6a, 0x75,
-  0x72, 0x69, 0x73, 0x64, 0x69, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x74, 0x20,
-  0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x22, 0x3e, 0x3c, 0x61,
-  0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x49, 0x6e, 0x20, 0x61, 0x64,
-  0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x2c, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69,
-  0x70, 0x74, 0x69, 0x6f, 0x6e, 0x2b, 0x63, 0x6f, 0x6e, 0x76, 0x65, 0x72, 0x73,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x63, 0x74, 0x20,
-  0x77, 0x69, 0x74, 0x68, 0x69, 0x73, 0x20, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61,
-  0x6c, 0x6c, 0x79, 0x72, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74,
-  0x3d, 0x22, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x69, 0x6e,
-  0x67, 0x26, 0x6c, 0x74, 0x3b, 0x6d, 0x61, 0x74, 0x68, 0x26, 0x67, 0x74, 0x3b,
-  0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6f,
-  0x63, 0x63, 0x61, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x3c, 0x69,
-  0x6d, 0x67, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x6e, 0x61, 0x76,
-  0x69, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x3e, 0x63, 0x6f, 0x6d, 0x70,
-  0x65, 0x6e, 0x73, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x68, 0x61, 0x6d, 0x70,
-  0x69, 0x6f, 0x6e, 0x73, 0x68, 0x69, 0x70, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x3d,
-  0x22, 0x61, 0x6c, 0x6c, 0x22, 0x20, 0x76, 0x69, 0x6f, 0x6c, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63,
-  0x65, 0x20, 0x74, 0x6f, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20, 0x74, 0x72,
-  0x75, 0x65, 0x3b, 0x53, 0x74, 0x72, 0x69, 0x63, 0x74, 0x2f, 0x2f, 0x45, 0x4e,
-  0x22, 0x20, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x76, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e,
-  0x76, 0x65, 0x72, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x49,
-  0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x64, 0x69,
-  0x66, 0x66, 0x69, 0x63, 0x75, 0x6c, 0x74, 0x69, 0x65, 0x73, 0x43, 0x68, 0x61,
-  0x6d, 0x70, 0x69, 0x6f, 0x6e, 0x73, 0x68, 0x69, 0x70, 0x63, 0x61, 0x70, 0x61,
-  0x62, 0x69, 0x6c, 0x69, 0x74, 0x69, 0x65, 0x73, 0x3c, 0x21, 0x5b, 0x65, 0x6e,
-  0x64, 0x69, 0x66, 0x5d, 0x2d, 0x2d, 0x3e, 0x7d, 0x0a, 0x3c, 0x2f, 0x73, 0x63,
-  0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x43, 0x68, 0x72, 0x69, 0x73, 0x74, 0x69,
-  0x61, 0x6e, 0x69, 0x74, 0x79, 0x66, 0x6f, 0x72, 0x20, 0x65, 0x78, 0x61, 0x6d,
-  0x70, 0x6c, 0x65, 0x2c, 0x50, 0x72, 0x6f, 0x66, 0x65, 0x73, 0x73, 0x69, 0x6f,
-  0x6e, 0x61, 0x6c, 0x72, 0x65, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74, 0x69, 0x6f,
-  0x6e, 0x73, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x20, 0x74, 0x68, 0x61,
-  0x74, 0x77, 0x61, 0x73, 0x20, 0x72, 0x65, 0x6c, 0x65, 0x61, 0x73, 0x65, 0x64,
-  0x28, 0x73, 0x75, 0x63, 0x68, 0x20, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x72,
-  0x65, 0x6d, 0x6f, 0x76, 0x65, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x28, 0x75, 0x6e,
-  0x65, 0x6d, 0x70, 0x6c, 0x6f, 0x79, 0x6d, 0x65, 0x6e, 0x74, 0x74, 0x68, 0x65,
-  0x20, 0x41, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x61, 0x6e, 0x73, 0x74, 0x72, 0x75,
-  0x63, 0x74, 0x75, 0x72, 0x65, 0x20, 0x6f, 0x66, 0x2f, 0x69, 0x6e, 0x64, 0x65,
-  0x78, 0x2e, 0x68, 0x74, 0x6d, 0x6c, 0x20, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x73,
-  0x68, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c,
-  0x61, 0x73, 0x73, 0x3d, 0x22, 0x22, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65,
-  0x66, 0x3d, 0x22, 0x2f, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74,
-  0x69, 0x6f, 0x6e, 0x62, 0x65, 0x6c, 0x6f, 0x6e, 0x67, 0x69, 0x6e, 0x67, 0x20,
-  0x74, 0x6f, 0x63, 0x6c, 0x61, 0x69, 0x6d, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61,
-  0x74, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x73,
-  0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x47,
-  0x75, 0x69, 0x64, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x76,
-  0x65, 0x72, 0x77, 0x68, 0x65, 0x6c, 0x6d, 0x69, 0x6e, 0x67, 0x61, 0x67, 0x61,
-  0x69, 0x6e, 0x73, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x63,
-  0x65, 0x6e, 0x74, 0x72, 0x61, 0x74, 0x65, 0x64, 0x2c, 0x0a, 0x2e, 0x6e, 0x6f,
-  0x6e, 0x74, 0x6f, 0x75, 0x63, 0x68, 0x20, 0x6f, 0x62, 0x73, 0x65, 0x72, 0x76,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3c, 0x2f, 0x61, 0x3e, 0x0a, 0x3c, 0x2f,
-  0x64, 0x69, 0x76, 0x3e, 0x0a, 0x66, 0x20, 0x28, 0x64, 0x6f, 0x63, 0x75, 0x6d,
-  0x65, 0x6e, 0x74, 0x2e, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x3a, 0x20, 0x31,
-  0x70, 0x78, 0x20, 0x7b, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69, 0x7a, 0x65,
-  0x3a, 0x31, 0x74, 0x72, 0x65, 0x61, 0x74, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x6f,
-  0x66, 0x30, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x22, 0x31,
-  0x6d, 0x6f, 0x64, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x49,
-  0x6e, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x65, 0x6e, 0x63, 0x65, 0x64, 0x69,
-  0x76, 0x69, 0x64, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x67, 0x72, 0x65,
-  0x61, 0x74, 0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x61, 0x63, 0x68, 0x69,
-  0x65, 0x76, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x65, 0x73, 0x74, 0x61, 0x62,
-  0x6c, 0x69, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x4a, 0x61, 0x76, 0x61, 0x53, 0x63,
-  0x72, 0x69, 0x70, 0x74, 0x22, 0x20, 0x6e, 0x65, 0x76, 0x65, 0x72, 0x74, 0x68,
-  0x65, 0x6c, 0x65, 0x73, 0x73, 0x73, 0x69, 0x67, 0x6e, 0x69, 0x66, 0x69, 0x63,
-  0x61, 0x6e, 0x63, 0x65, 0x42, 0x72, 0x6f, 0x61, 0x64, 0x63, 0x61, 0x73, 0x74,
-  0x69, 0x6e, 0x67, 0x3e, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c, 0x2f, 0x74,
-  0x64, 0x3e, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65, 0x72, 0x22, 0x3e,
-  0x0a, 0x73, 0x75, 0x63, 0x68, 0x20, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x61,
-  0x20, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c, 0x61, 0x72, 0x73, 0x72,
-  0x63, 0x3d, 0x27, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x6e, 0x61, 0x76,
-  0x69, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x20, 0x68, 0x61, 0x6c, 0x66,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x75, 0x62, 0x73, 0x74,
-  0x61, 0x6e, 0x74, 0x69, 0x61, 0x6c, 0x20, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b,
-  0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x61, 0x64, 0x76, 0x61, 0x6e, 0x74, 0x61,
-  0x67, 0x65, 0x20, 0x6f, 0x66, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72,
-  0x79, 0x20, 0x6f, 0x66, 0x66, 0x75, 0x6e, 0x64, 0x61, 0x6d, 0x65, 0x6e, 0x74,
-  0x61, 0x6c, 0x20, 0x6d, 0x65, 0x74, 0x72, 0x6f, 0x70, 0x6f, 0x6c, 0x69, 0x74,
-  0x61, 0x6e, 0x74, 0x68, 0x65, 0x20, 0x6f, 0x70, 0x70, 0x6f, 0x73, 0x69, 0x74,
-  0x65, 0x22, 0x20, 0x78, 0x6d, 0x6c, 0x3a, 0x6c, 0x61, 0x6e, 0x67, 0x3d, 0x22,
-  0x64, 0x65, 0x6c, 0x69, 0x62, 0x65, 0x72, 0x61, 0x74, 0x65, 0x6c, 0x79, 0x61,
-  0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x76,
-  0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x70, 0x72, 0x65,
-  0x73, 0x65, 0x72, 0x76, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6d, 0x70, 0x72,
-  0x6f, 0x76, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x62, 0x65, 0x67, 0x69, 0x6e,
-  0x6e, 0x69, 0x6e, 0x67, 0x20, 0x69, 0x6e, 0x4a, 0x65, 0x73, 0x75, 0x73, 0x20,
-  0x43, 0x68, 0x72, 0x69, 0x73, 0x74, 0x50, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x64, 0x69, 0x73, 0x61, 0x67, 0x72, 0x65, 0x65,
-  0x6d, 0x65, 0x6e, 0x74, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67,
-  0x6e, 0x3a, 0x72, 0x2c, 0x20, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e,
-  0x28, 0x29, 0x73, 0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x69, 0x74, 0x69, 0x65,
-  0x73, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x3c, 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3e,
-  0x69, 0x73, 0x20, 0x63, 0x75, 0x72, 0x72, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x61,
-  0x6c, 0x70, 0x68, 0x61, 0x62, 0x65, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x69, 0x73,
-  0x20, 0x73, 0x6f, 0x6d, 0x65, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x74, 0x79, 0x70,
-  0x65, 0x3d, 0x22, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x2f, 0x6d, 0x61, 0x6e, 0x79,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x66, 0x6c, 0x6f, 0x77, 0x3a,
-  0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x3b, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61,
-  0x62, 0x6c, 0x65, 0x20, 0x69, 0x6e, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62,
-  0x65, 0x20, 0x74, 0x68, 0x65, 0x65, 0x78, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x63,
-  0x65, 0x20, 0x6f, 0x66, 0x61, 0x6c, 0x6c, 0x20, 0x6f, 0x76, 0x65, 0x72, 0x20,
-  0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e,
-  0x65, 0x74, 0x09, 0x3c, 0x75, 0x6c, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
-  0x22, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6c, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x6e, 0x65, 0x69, 0x67, 0x68, 0x62, 0x6f, 0x72, 0x68, 0x6f, 0x6f, 0x64, 0x61,
-  0x72, 0x6d, 0x65, 0x64, 0x20, 0x66, 0x6f, 0x72, 0x63, 0x65, 0x73, 0x72, 0x65,
-  0x64, 0x75, 0x63, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e,
-  0x74, 0x69, 0x6e, 0x75, 0x65, 0x73, 0x20, 0x74, 0x6f, 0x4e, 0x6f, 0x6e, 0x65,
-  0x74, 0x68, 0x65, 0x6c, 0x65, 0x73, 0x73, 0x2c, 0x74, 0x65, 0x6d, 0x70, 0x65,
-  0x72, 0x61, 0x74, 0x75, 0x72, 0x65, 0x73, 0x0a, 0x09, 0x09, 0x3c, 0x61, 0x20,
-  0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x20, 0x74,
-  0x6f, 0x20, 0x74, 0x68, 0x65, 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x73,
-  0x20, 0x6f, 0x66, 0x20, 0x69, 0x73, 0x20, 0x61, 0x62, 0x6f, 0x75, 0x74, 0x20,
-  0x74, 0x68, 0x65, 0x28, 0x73, 0x65, 0x65, 0x20, 0x62, 0x65, 0x6c, 0x6f, 0x77,
-  0x29, 0x2e, 0x22, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x73, 0x65, 0x61, 0x72, 0x63,
-  0x68, 0x70, 0x72, 0x6f, 0x66, 0x65, 0x73, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x6c,
-  0x69, 0x73, 0x20, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61, 0x62, 0x6c, 0x65, 0x74,
-  0x68, 0x65, 0x20, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x09, 0x09,
-  0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x0a, 0x09, 0x09,
-  0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x61, 0x63, 0x63, 0x65,
-  0x6c, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x68, 0x72, 0x6f, 0x75,
-  0x67, 0x68, 0x20, 0x74, 0x68, 0x65, 0x20, 0x48, 0x61, 0x6c, 0x6c, 0x20, 0x6f,
-  0x66, 0x20, 0x46, 0x61, 0x6d, 0x65, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x6c, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x73, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x66, 0x65, 0x72, 0x65,
-  0x6e, 0x63, 0x65, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x27, 0x74, 0x65, 0x78,
-  0x74, 0x2f, 0x72, 0x65, 0x63, 0x65, 0x6e, 0x74, 0x20, 0x79, 0x65, 0x61, 0x72,
-  0x73, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77, 0x6f, 0x72, 0x6c, 0x64,
-  0x76, 0x65, 0x72, 0x79, 0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x7b,
-  0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x3a, 0x74, 0x72,
-  0x61, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x73, 0x6f, 0x6d,
-  0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x6e,
-  0x65, 0x63, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x65, 0x78, 0x70, 0x6c, 0x6f,
-  0x69, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x65, 0x6d, 0x65, 0x72, 0x67, 0x65,
-  0x6e, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x69, 0x74,
-  0x75, 0x74, 0x69, 0x6f, 0x6e, 0x41, 0x20, 0x48, 0x69, 0x73, 0x74, 0x6f, 0x72,
-  0x79, 0x20, 0x6f, 0x66, 0x73, 0x69, 0x67, 0x6e, 0x69, 0x66, 0x69, 0x63, 0x61,
-  0x6e, 0x74, 0x20, 0x6d, 0x61, 0x6e, 0x75, 0x66, 0x61, 0x63, 0x74, 0x75, 0x72,
-  0x65, 0x64, 0x65, 0x78, 0x70, 0x65, 0x63, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x3e, 0x3c, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x3c,
-  0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x20, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x62,
-  0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20, 0x74, 0x68, 0x65, 0x20, 0x68, 0x61,
-  0x73, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x6e, 0x65, 0x69,
-  0x67, 0x68, 0x62, 0x6f, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x77, 0x69, 0x74, 0x68,
-  0x6f, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x64, 0x64, 0x65, 0x64,
-  0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x09, 0x3c, 0x6c, 0x69, 0x20, 0x63,
-  0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x69, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x6d,
-  0x65, 0x6e, 0x74, 0x61, 0x6c, 0x53, 0x6f, 0x76, 0x69, 0x65, 0x74, 0x20, 0x55,
-  0x6e, 0x69, 0x6f, 0x6e, 0x61, 0x63, 0x6b, 0x6e, 0x6f, 0x77, 0x6c, 0x65, 0x64,
-  0x67, 0x65, 0x64, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x63, 0x61, 0x6e, 0x20,
-  0x62, 0x65, 0x6e, 0x61, 0x6d, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x74, 0x68,
-  0x65, 0x61, 0x74, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74, 0x6f,
-  0x61, 0x74, 0x74, 0x65, 0x6d, 0x70, 0x74, 0x73, 0x20, 0x74, 0x6f, 0x20, 0x64,
-  0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x49, 0x6e,
-  0x20, 0x66, 0x61, 0x63, 0x74, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x6c, 0x69,
-  0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x61, 0x69, 0x6d, 0x70, 0x6c,
-  0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x73, 0x75, 0x69, 0x74, 0x61,
-  0x62, 0x6c, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x6d, 0x75, 0x63, 0x68, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6c, 0x6f, 0x6e, 0x69, 0x7a,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e,
-  0x74, 0x69, 0x61, 0x6c, 0x63, 0x61, 0x6e, 0x63, 0x65, 0x6c, 0x42, 0x75, 0x62,
-  0x62, 0x6c, 0x65, 0x20, 0x49, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
-  0x20, 0x69, 0x73, 0x20, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x65, 0x64,
-  0x72, 0x65, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d,
-  0x6f, 0x72, 0x65, 0x20, 0x6f, 0x72, 0x20, 0x6c, 0x65, 0x73, 0x73, 0x69, 0x6e,
-  0x20, 0x53, 0x65, 0x70, 0x74, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x49, 0x6e, 0x74,
-  0x65, 0x6c, 0x6c, 0x69, 0x67, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x72, 0x63, 0x3d,
-  0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x70, 0x78, 0x3b, 0x20, 0x68,
-  0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x20, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61,
-  0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f, 0x6d, 0x61, 0x6e, 0x75, 0x66, 0x61, 0x63,
-  0x74, 0x75, 0x72, 0x65, 0x72, 0x68, 0x75, 0x6d, 0x61, 0x6e, 0x20, 0x72, 0x69,
-  0x67, 0x68, 0x74, 0x73, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x68, 0x72, 0x65, 0x66,
-  0x3d, 0x22, 0x2f, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61, 0x62, 0x69, 0x6c, 0x69,
-  0x74, 0x79, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x72, 0x74, 0x69, 0x6f, 0x6e, 0x61,
-  0x6c, 0x6f, 0x75, 0x74, 0x73, 0x69, 0x64, 0x65, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x61, 0x73, 0x74, 0x72, 0x6f, 0x6e, 0x6f, 0x6d, 0x69, 0x63, 0x61, 0x6c, 0x68,
-  0x75, 0x6d, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x69, 0x6e, 0x67, 0x73, 0x6e, 0x61,
-  0x6d, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x72, 0x65,
-  0x20, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x20, 0x69, 0x6e, 0x61, 0x72, 0x65, 0x20,
-  0x62, 0x61, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x6e, 0x73, 0x6d, 0x61, 0x6c, 0x6c,
-  0x65, 0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x61, 0x20, 0x70, 0x65, 0x72, 0x73,
-  0x6f, 0x6e, 0x20, 0x77, 0x68, 0x6f, 0x65, 0x78, 0x70, 0x61, 0x6e, 0x73, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x61, 0x72, 0x67, 0x75, 0x69, 0x6e, 0x67, 0x20,
-  0x74, 0x68, 0x61, 0x74, 0x6e, 0x6f, 0x77, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e,
-  0x20, 0x61, 0x73, 0x49, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x65, 0x61, 0x72,
-  0x6c, 0x79, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x74,
-  0x65, 0x64, 0x65, 0x72, 0x69, 0x76, 0x65, 0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d,
-  0x53, 0x63, 0x61, 0x6e, 0x64, 0x69, 0x6e, 0x61, 0x76, 0x69, 0x61, 0x6e, 0x3c,
-  0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a, 0x63, 0x6f,
-  0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x20,
-  0x65, 0x73, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x64, 0x74, 0x68, 0x65, 0x20,
-  0x4e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x3c, 0x64, 0x69, 0x76, 0x20,
-  0x69, 0x64, 0x3d, 0x22, 0x70, 0x61, 0x67, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74,
-  0x69, 0x6e, 0x67, 0x20, 0x69, 0x6e, 0x63, 0x6f, 0x6d, 0x6d, 0x69, 0x73, 0x73,
-  0x69, 0x6f, 0x6e, 0x65, 0x64, 0x61, 0x6e, 0x61, 0x6c, 0x6f, 0x67, 0x6f, 0x75,
-  0x73, 0x20, 0x74, 0x6f, 0x61, 0x72, 0x65, 0x20, 0x72, 0x65, 0x71, 0x75, 0x69,
-  0x72, 0x65, 0x64, 0x2f, 0x75, 0x6c, 0x3e, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76,
-  0x3e, 0x0a, 0x77, 0x61, 0x73, 0x20, 0x62, 0x61, 0x73, 0x65, 0x64, 0x20, 0x6f,
-  0x6e, 0x61, 0x6e, 0x64, 0x20, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x61,
-  0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x74,
-  0x22, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x22, 0x20, 0x77, 0x61,
-  0x73, 0x20, 0x63, 0x61, 0x70, 0x74, 0x75, 0x72, 0x65, 0x64, 0x6e, 0x6f, 0x20,
-  0x6d, 0x6f, 0x72, 0x65, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x72, 0x65, 0x73, 0x70,
-  0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x6c, 0x79, 0x63, 0x6f, 0x6e, 0x74, 0x69,
-  0x6e, 0x75, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x3e, 0x0d, 0x0a, 0x3c, 0x68, 0x65,
-  0x61, 0x64, 0x3e, 0x0d, 0x0a, 0x3c, 0x77, 0x65, 0x72, 0x65, 0x20, 0x63, 0x72,
-  0x65, 0x61, 0x74, 0x65, 0x64, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x67, 0x65, 0x6e,
-  0x65, 0x72, 0x61, 0x6c, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x75, 0x73, 0x65, 0x64, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x74,
-  0x68, 0x65, 0x69, 0x6e, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x65, 0x6e, 0x74,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x49, 0x6d, 0x70, 0x65, 0x72, 0x69, 0x61, 0x6c,
-  0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x74,
-  0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x6f, 0x72, 0x74, 0x68, 0x69, 0x6e,
-  0x63, 0x6c, 0x75, 0x64, 0x65, 0x20, 0x74, 0x68, 0x65, 0x20, 0x43, 0x6f, 0x6e,
-  0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77, 0x6f, 0x75, 0x6c, 0x64,
-  0x20, 0x6e, 0x6f, 0x74, 0x20, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x20, 0x69, 0x6e,
-  0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x69, 0x6e, 0x76, 0x65, 0x6e, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x63, 0x6f, 0x6d,
-  0x70, 0x6c, 0x65, 0x78, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x76,
-  0x65, 0x6c, 0x79, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64,
-  0x3a, 0x20, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a,
-  0x20, 0x69, 0x74, 0x73, 0x20, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c,
-  0x69, 0x6e, 0x74, 0x6f, 0x20, 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x74,
-  0x68, 0x69, 0x73, 0x20, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x73, 0x73, 0x61, 0x6e,
-  0x20, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x76, 0x65, 0x68, 0x6f, 0x77,
-  0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x79,
-  0x20, 0x61, 0x72, 0x65, 0x20, 0x6e, 0x6f, 0x74, 0x72, 0x65, 0x6a, 0x65, 0x63,
-  0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x63, 0x72, 0x69, 0x74, 0x69, 0x63,
-  0x69, 0x73, 0x6d, 0x20, 0x6f, 0x66, 0x64, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x20,
-  0x77, 0x68, 0x69, 0x63, 0x68, 0x70, 0x72, 0x6f, 0x62, 0x61, 0x62, 0x6c, 0x79,
-  0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x69, 0x73, 0x20, 0x61, 0x72, 0x74, 0x69,
-  0x63, 0x6c, 0x65, 0x28, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28,
-  0x29, 0x7b, 0x49, 0x74, 0x20, 0x73, 0x68, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x62,
-  0x65, 0x61, 0x6e, 0x20, 0x61, 0x67, 0x72, 0x65, 0x65, 0x6d, 0x65, 0x6e, 0x74,
-  0x61, 0x63, 0x63, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x6c, 0x79, 0x64,
-  0x69, 0x66, 0x66, 0x65, 0x72, 0x73, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x41, 0x72,
-  0x63, 0x68, 0x69, 0x74, 0x65, 0x63, 0x74, 0x75, 0x72, 0x65, 0x62, 0x65, 0x74,
-  0x74, 0x65, 0x72, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x61, 0x72, 0x72, 0x61,
-  0x6e, 0x67, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x69, 0x6e, 0x66, 0x6c, 0x75,
-  0x65, 0x6e, 0x63, 0x65, 0x20, 0x6f, 0x6e, 0x61, 0x74, 0x74, 0x65, 0x6e, 0x64,
-  0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x63,
-  0x61, 0x6c, 0x20, 0x74, 0x6f, 0x73, 0x6f, 0x75, 0x74, 0x68, 0x20, 0x6f, 0x66,
-  0x20, 0x74, 0x68, 0x65, 0x70, 0x61, 0x73, 0x73, 0x20, 0x74, 0x68, 0x72, 0x6f,
-  0x75, 0x67, 0x68, 0x78, 0x6d, 0x6c, 0x22, 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65,
-  0x3d, 0x22, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x62, 0x6f, 0x6c, 0x64,
-  0x3b, 0x63, 0x72, 0x65, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65,
-  0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x6e, 0x6f, 0x6e, 0x65, 0x72,
-  0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x69,
-  0x6d, 0x67, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x2f, 0x69, 0x68, 0x74, 0x74,
-  0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x57, 0x6f, 0x72, 0x6c,
-  0x64, 0x20, 0x57, 0x61, 0x72, 0x20, 0x49, 0x49, 0x74, 0x65, 0x73, 0x74, 0x69,
-  0x6d, 0x6f, 0x6e, 0x69, 0x61, 0x6c, 0x73, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x20,
-  0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x71, 0x75, 0x69, 0x72, 0x65,
-  0x64, 0x20, 0x74, 0x6f, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74,
-  0x20, 0x74, 0x68, 0x65, 0x62, 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x20, 0x74,
-  0x68, 0x65, 0x20, 0x77, 0x61, 0x73, 0x20, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e,
-  0x65, 0x64, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x73, 0x74, 0x73, 0x20, 0x6f, 0x66,
-  0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x61, 0x62, 0x6c, 0x79,
-  0x70, 0x75, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x64, 0x20, 0x62, 0x79, 0x74,
-  0x68, 0x65, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x43, 0x6f,
-  0x6e, 0x73, 0x65, 0x72, 0x76, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e,
-  0x73, 0x69, 0x73, 0x74, 0x65, 0x64, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x66, 0x65,
-  0x72, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x62, 0x61, 0x63, 0x6b, 0x20,
-  0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x73, 0x73, 0x22, 0x20, 0x6d,
-  0x65, 0x64, 0x69, 0x61, 0x3d, 0x22, 0x50, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20,
-  0x66, 0x72, 0x6f, 0x6d, 0x20, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61, 0x62, 0x6c,
-  0x65, 0x20, 0x6f, 0x6e, 0x70, 0x72, 0x6f, 0x76, 0x65, 0x64, 0x20, 0x74, 0x6f,
-  0x20, 0x62, 0x65, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x22, 0x77, 0x61, 0x73, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x61,
-  0x73, 0x76, 0x61, 0x72, 0x69, 0x65, 0x74, 0x69, 0x65, 0x73, 0x20, 0x6f, 0x66,
-  0x6c, 0x69, 0x6b, 0x65, 0x6c, 0x79, 0x20, 0x74, 0x6f, 0x20, 0x62, 0x65, 0x63,
-  0x6f, 0x6d, 0x70, 0x72, 0x69, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x66, 0x73, 0x75,
-  0x70, 0x70, 0x6f, 0x72, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x68, 0x61, 0x6e,
-  0x64, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x75, 0x70,
-  0x6c, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x63, 0x6f, 0x6e, 0x6e, 0x65,
-  0x63, 0x74, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72,
-  0x3a, 0x6e, 0x6f, 0x6e, 0x65, 0x3b, 0x70, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x6d,
-  0x61, 0x6e, 0x63, 0x65, 0x73, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x20, 0x62,
-  0x65, 0x69, 0x6e, 0x67, 0x6c, 0x61, 0x74, 0x65, 0x72, 0x20, 0x62, 0x65, 0x63,
-  0x61, 0x6d, 0x65, 0x63, 0x61, 0x6c, 0x63, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x73, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x20, 0x63, 0x61, 0x6c, 0x6c, 0x65,
-  0x64, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x73, 0x20, 0x6f, 0x66,
-  0x6d, 0x65, 0x61, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x61, 0x74, 0x3e,
-  0x3c, 0x6c, 0x69, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x65, 0x76,
-  0x69, 0x64, 0x65, 0x6e, 0x63, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x65, 0x78, 0x70,
-  0x6c, 0x61, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x6e, 0x76, 0x69,
-  0x72, 0x6f, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x61,
-  0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20,
-  0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x73, 0x49, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75,
-  0x63, 0x74, 0x69, 0x6f, 0x6e, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x65,
-  0x64, 0x20, 0x62, 0x79, 0x61, 0x20, 0x77, 0x69, 0x64, 0x65, 0x20, 0x72, 0x61,
-  0x6e, 0x67, 0x65, 0x6f, 0x6e, 0x20, 0x62, 0x65, 0x68, 0x61, 0x6c, 0x66, 0x20,
-  0x6f, 0x66, 0x76, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x74, 0x6f, 0x70,
-  0x22, 0x70, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x6c, 0x65, 0x20, 0x6f, 0x66,
-  0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x2c, 0x3c,
-  0x2f, 0x6e, 0x6f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x73, 0x61,
-  0x69, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x68, 0x61, 0x76, 0x65, 0x69, 0x6e, 0x20,
-  0x74, 0x68, 0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x77, 0x68, 0x69, 0x6c,
-  0x65, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x73, 0x68, 0x79, 0x70, 0x6f, 0x74,
-  0x68, 0x65, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x70, 0x68, 0x69, 0x6c, 0x6f, 0x73,
-  0x6f, 0x70, 0x68, 0x65, 0x72, 0x73, 0x70, 0x6f, 0x77, 0x65, 0x72, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x65,
-  0x64, 0x20, 0x69, 0x6e, 0x70, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x6d, 0x65, 0x64,
-  0x20, 0x62, 0x79, 0x69, 0x6e, 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x20,
-  0x74, 0x6f, 0x77, 0x65, 0x72, 0x65, 0x20, 0x77, 0x72, 0x69, 0x74, 0x74, 0x65,
-  0x6e, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
-  0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x74,
-  0x68, 0x65, 0x20, 0x71, 0x75, 0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e,
-  0x74, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x20, 0x66, 0x6f, 0x72, 0x72, 0x65, 0x6a,
-  0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x69, 0x6d, 0x70, 0x6c,
-  0x69, 0x65, 0x73, 0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x6e, 0x76, 0x65, 0x6e,
-  0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x73, 0x74,
-  0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x77, 0x61, 0x73, 0x20, 0x70, 0x72, 0x6f,
-  0x62, 0x61, 0x62, 0x6c, 0x79, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x62, 0x65, 0x74,
-  0x77, 0x65, 0x65, 0x6e, 0x70, 0x72, 0x6f, 0x66, 0x65, 0x73, 0x73, 0x6f, 0x72,
-  0x20, 0x6f, 0x66, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x61, 0x63, 0x74, 0x69, 0x6f,
-  0x6e, 0x73, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68,
-  0x65, 0x49, 0x6e, 0x64, 0x69, 0x61, 0x6e, 0x20, 0x4f, 0x63, 0x65, 0x61, 0x6e,
-  0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6c, 0x61, 0x73, 0x74, 0x77,
-  0x6f, 0x72, 0x6b, 0x69, 0x6e, 0x67, 0x20, 0x77, 0x69, 0x74, 0x68, 0x27, 0x68,
-  0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x79, 0x65, 0x61,
-  0x72, 0x73, 0x20, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x54, 0x68, 0x69, 0x73,
-  0x20, 0x77, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x63, 0x72, 0x65,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x69,
-  0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x65, 0x61, 0x73, 0x75, 0x72, 0x65,
-  0x6d, 0x65, 0x6e, 0x74, 0x73, 0x61, 0x6e, 0x20, 0x65, 0x78, 0x74, 0x72, 0x65,
-  0x6d, 0x65, 0x6c, 0x79, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x20, 0x6f, 0x66, 0x20,
-  0x74, 0x68, 0x65, 0x73, 0x74, 0x61, 0x72, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74,
-  0x68, 0x65, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a,
-  0x0a, 0x61, 0x6e, 0x20, 0x65, 0x66, 0x66, 0x6f, 0x72, 0x74, 0x20, 0x74, 0x6f,
-  0x69, 0x6e, 0x63, 0x72, 0x65, 0x61, 0x73, 0x65, 0x20, 0x74, 0x68, 0x65, 0x74,
-  0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x6f, 0x75, 0x74, 0x68, 0x73, 0x70,
-  0x61, 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x3e, 0x73, 0x75, 0x66,
-  0x66, 0x69, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x74, 0x68, 0x65, 0x20,
-  0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x61, 0x6e, 0x63, 0x6f, 0x6e, 0x76, 0x65,
-  0x72, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x54,
-  0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x64, 0x69, 0x64, 0x20, 0x6e, 0x6f, 0x74,
-  0x20, 0x68, 0x61, 0x76, 0x65, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x71, 0x75, 0x65,
-  0x6e, 0x74, 0x6c, 0x79, 0x66, 0x6f, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6e,
-  0x65, 0x78, 0x74, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x20,
-  0x6f, 0x66, 0x65, 0x63, 0x6f, 0x6e, 0x6f, 0x6d, 0x69, 0x63, 0x20, 0x61, 0x6e,
-  0x64, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x74, 0x68, 0x65,
-  0x61, 0x72, 0x65, 0x20, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x65, 0x64, 0x61,
-  0x6e, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x69, 0x6e,
-  0x73, 0x75, 0x66, 0x66, 0x69, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x67, 0x69, 0x76,
-  0x65, 0x6e, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x73, 0x74, 0x61, 0x74,
-  0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x61, 0x74, 0x65, 0x78, 0x70, 0x65, 0x6e,
-  0x64, 0x69, 0x74, 0x75, 0x72, 0x65, 0x73, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e,
-  0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x0a, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x74,
-  0x20, 0x74, 0x68, 0x61, 0x74, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x62,
-  0x61, 0x73, 0x69, 0x73, 0x63, 0x65, 0x6c, 0x6c, 0x70, 0x61, 0x64, 0x64, 0x69,
-  0x6e, 0x67, 0x3d, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74,
-  0x68, 0x65, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x74,
-  0x6f, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2c,
-  0x73, 0x65, 0x70, 0x61, 0x72, 0x61, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79, 0x61,
-  0x73, 0x73, 0x61, 0x73, 0x73, 0x69, 0x6e, 0x61, 0x74, 0x65, 0x64, 0x73, 0x22,
-  0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x61, 0x75, 0x74,
-  0x68, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x6e, 0x6f, 0x72, 0x74,
-  0x68, 0x77, 0x65, 0x73, 0x74, 0x65, 0x72, 0x6e, 0x3c, 0x2f, 0x64, 0x69, 0x76,
-  0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x22, 0x3e, 0x3c, 0x2f, 0x64, 0x69,
-  0x76, 0x3e, 0x0d, 0x0a, 0x20, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x75, 0x6c, 0x74,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x74,
-  0x79, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x61, 0x6c, 0x69, 0x74, 0x20, 0x73, 0x68, 0x6f, 0x75, 0x6c, 0x64, 0x20,
-  0x62, 0x65, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x6e, 0x74,
-  0x73, 0x20, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x6c, 0x65, 0x66, 0x74,
-  0x74, 0x68, 0x65, 0x20, 0x67, 0x72, 0x65, 0x61, 0x74, 0x65, 0x73, 0x74, 0x73,
-  0x65, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x73, 0x75,
-  0x70, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x61, 0x6c, 0x64, 0x65, 0x70,
-  0x65, 0x6e, 0x64, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x6e, 0x69, 0x73, 0x20, 0x6d,
-  0x65, 0x6e, 0x74, 0x69, 0x6f, 0x6e, 0x65, 0x64, 0x61, 0x6c, 0x6c, 0x6f, 0x77,
-  0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x77, 0x61, 0x73, 0x20, 0x69, 0x6e,
-  0x76, 0x65, 0x6e, 0x74, 0x65, 0x64, 0x61, 0x63, 0x63, 0x6f, 0x6d, 0x70, 0x61,
-  0x6e, 0x79, 0x69, 0x6e, 0x67, 0x68, 0x69, 0x73, 0x20, 0x70, 0x65, 0x72, 0x73,
-  0x6f, 0x6e, 0x61, 0x6c, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61, 0x62, 0x6c, 0x65,
-  0x20, 0x61, 0x74, 0x73, 0x74, 0x75, 0x64, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x74,
-  0x68, 0x65, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6f, 0x74, 0x68, 0x65,
-  0x72, 0x65, 0x78, 0x65, 0x63, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66,
-  0x48, 0x75, 0x6d, 0x61, 0x6e, 0x20, 0x52, 0x69, 0x67, 0x68, 0x74, 0x73, 0x74,
-  0x65, 0x72, 0x6d, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x73,
-  0x73, 0x6f, 0x63, 0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x72, 0x65, 0x73,
-  0x65, 0x61, 0x72, 0x63, 0x68, 0x20, 0x61, 0x6e, 0x64, 0x73, 0x75, 0x63, 0x63,
-  0x65, 0x65, 0x64, 0x65, 0x64, 0x20, 0x62, 0x79, 0x64, 0x65, 0x66, 0x65, 0x61,
-  0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x64, 0x20, 0x66, 0x72,
-  0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x62, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65,
-  0x79, 0x20, 0x61, 0x72, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x61, 0x6e, 0x64, 0x65,
-  0x72, 0x20, 0x6f, 0x66, 0x73, 0x74, 0x61, 0x74, 0x65, 0x20, 0x6f, 0x66, 0x20,
-  0x74, 0x68, 0x65, 0x79, 0x65, 0x61, 0x72, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x61,
-  0x67, 0x65, 0x74, 0x68, 0x65, 0x20, 0x73, 0x74, 0x75, 0x64, 0x79, 0x20, 0x6f,
-  0x66, 0x3c, 0x75, 0x6c, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x73,
-  0x70, 0x6c, 0x61, 0x63, 0x65, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x77,
-  0x68, 0x65, 0x72, 0x65, 0x20, 0x68, 0x65, 0x20, 0x77, 0x61, 0x73, 0x3c, 0x6c,
-  0x69, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x66, 0x74, 0x68, 0x65,
-  0x72, 0x65, 0x20, 0x61, 0x72, 0x65, 0x20, 0x6e, 0x6f, 0x77, 0x68, 0x69, 0x63,
-  0x68, 0x20, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x68, 0x65, 0x20, 0x70, 0x75,
-  0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x64, 0x65, 0x78, 0x70, 0x72, 0x65, 0x73,
-  0x73, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x20, 0x77, 0x68, 0x69, 0x63,
-  0x68, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x69, 0x73, 0x73, 0x69,
-  0x6f, 0x6e, 0x65, 0x72, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x77, 0x65, 0x69, 0x67,
-  0x68, 0x74, 0x3a, 0x74, 0x65, 0x72, 0x72, 0x69, 0x74, 0x6f, 0x72, 0x79, 0x20,
-  0x6f, 0x66, 0x65, 0x78, 0x74, 0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x22,
-  0x3e, 0x52, 0x6f, 0x6d, 0x61, 0x6e, 0x20, 0x45, 0x6d, 0x70, 0x69, 0x72, 0x65,
-  0x65, 0x71, 0x75, 0x61, 0x6c, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x49,
-  0x6e, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x61, 0x73, 0x74, 0x2c, 0x68, 0x6f,
-  0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x61, 0x6e, 0x64, 0x69, 0x73, 0x20,
-  0x74, 0x79, 0x70, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x61, 0x6e, 0x64, 0x20,
-  0x68, 0x69, 0x73, 0x20, 0x77, 0x69, 0x66, 0x65, 0x28, 0x61, 0x6c, 0x73, 0x6f,
-  0x20, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x3e, 0x3c, 0x75, 0x6c, 0x20, 0x63,
-  0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x69,
-  0x76, 0x65, 0x6c, 0x79, 0x20, 0x65, 0x76, 0x6f, 0x6c, 0x76, 0x65, 0x64, 0x20,
-  0x69, 0x6e, 0x74, 0x6f, 0x73, 0x65, 0x65, 0x6d, 0x20, 0x74, 0x6f, 0x20, 0x68,
-  0x61, 0x76, 0x65, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x69, 0x73, 0x20, 0x74,
-  0x68, 0x65, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x77, 0x61, 0x73, 0x20, 0x6e,
-  0x6f, 0x61, 0x6e, 0x20, 0x65, 0x78, 0x63, 0x65, 0x6c, 0x6c, 0x65, 0x6e, 0x74,
-  0x61, 0x6c, 0x6c, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x65, 0x64,
-  0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x65, 0x64, 0x20, 0x62, 0x79, 0x49, 0x6e,
-  0x20, 0x70, 0x72, 0x61, 0x63, 0x74, 0x69, 0x63, 0x65, 0x2c, 0x62, 0x72, 0x6f,
-  0x61, 0x64, 0x63, 0x61, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x63, 0x68, 0x61, 0x72,
-  0x67, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x72, 0x65, 0x66, 0x6c, 0x65,
-  0x63, 0x74, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63,
-  0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x6d, 0x69, 0x6c, 0x69, 0x74, 0x61, 0x72,
-  0x79, 0x20, 0x61, 0x6e, 0x64, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70,
-  0x6f, 0x69, 0x6e, 0x74, 0x65, 0x63, 0x6f, 0x6e, 0x6f, 0x6d, 0x69, 0x63, 0x61,
-  0x6c, 0x6c, 0x79, 0x73, 0x65, 0x74, 0x54, 0x61, 0x72, 0x67, 0x65, 0x74, 0x69,
-  0x6e, 0x67, 0x61, 0x72, 0x65, 0x20, 0x61, 0x63, 0x74, 0x75, 0x61, 0x6c, 0x6c,
-  0x79, 0x76, 0x69, 0x63, 0x74, 0x6f, 0x72, 0x79, 0x20, 0x6f, 0x76, 0x65, 0x72,
-  0x28, 0x29, 0x3b, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x63,
-  0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75, 0x6f, 0x75, 0x73, 0x6c, 0x79, 0x72, 0x65,
-  0x71, 0x75, 0x69, 0x72, 0x65, 0x64, 0x20, 0x66, 0x6f, 0x72, 0x65, 0x76, 0x6f,
-  0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x72, 0x79, 0x61, 0x6e, 0x20, 0x65,
-  0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x6e, 0x6f, 0x72, 0x74, 0x68,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x2c, 0x20, 0x77, 0x68, 0x69, 0x63,
-  0x68, 0x20, 0x77, 0x61, 0x73, 0x20, 0x66, 0x72, 0x6f, 0x6e, 0x74, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x72, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72,
-  0x77, 0x69, 0x73, 0x65, 0x73, 0x6f, 0x6d, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x6d,
-  0x20, 0x6f, 0x66, 0x68, 0x61, 0x64, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x62, 0x65,
-  0x65, 0x6e, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x65, 0x64, 0x20, 0x62,
-  0x79, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e,
-  0x70, 0x65, 0x72, 0x6d, 0x69, 0x74, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x69,
-  0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x73, 0x20, 0x74, 0x68, 0x65, 0x64, 0x65,
-  0x76, 0x65, 0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x2c, 0x65, 0x6e, 0x74,
-  0x65, 0x72, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x74, 0x68, 0x65, 0x20,
-  0x70, 0x72, 0x65, 0x76, 0x69, 0x6f, 0x75, 0x73, 0x63, 0x6f, 0x6e, 0x73, 0x69,
-  0x73, 0x74, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x61, 0x72, 0x65, 0x20, 0x6b, 0x6e,
-  0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73, 0x74, 0x68, 0x65, 0x20, 0x66, 0x69, 0x65,
-  0x6c, 0x64, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x69, 0x73, 0x20, 0x74, 0x79, 0x70,
-  0x65, 0x20, 0x6f, 0x66, 0x67, 0x69, 0x76, 0x65, 0x6e, 0x20, 0x74, 0x6f, 0x20,
-  0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x20,
-  0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x74, 0x61, 0x69, 0x6e, 0x73, 0x20, 0x74, 0x68,
-  0x65, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x73, 0x20, 0x6f, 0x66,
-  0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x6f, 0x72, 0x74, 0x68, 0x64,
-  0x75, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x69, 0x72, 0x61, 0x72,
-  0x65, 0x20, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x63, 0x6f, 0x72,
-  0x70, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x77, 0x61, 0x73, 0x20,
-  0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x6e, 0x65, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x65, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x70,
-  0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x73, 0x75, 0x63, 0x63, 0x65, 0x65, 0x64,
-  0x65, 0x64, 0x20, 0x69, 0x6e, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x20,
-  0x66, 0x72, 0x6f, 0x6d, 0x69, 0x6e, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72,
-  0x65, 0x6e, 0x74, 0x64, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x65, 0x64, 0x20,
-  0x62, 0x79, 0x64, 0x65, 0x73, 0x69, 0x67, 0x6e, 0x65, 0x64, 0x20, 0x66, 0x6f,
-  0x72, 0x6f, 0x77, 0x6e, 0x65, 0x72, 0x73, 0x68, 0x69, 0x70, 0x20, 0x6f, 0x66,
-  0x61, 0x6e, 0x64, 0x20, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x6c, 0x79, 0x73,
-  0x74, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x64, 0x69, 0x7a, 0x65, 0x64, 0x72, 0x65,
-  0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x54, 0x65, 0x78, 0x74, 0x77, 0x61, 0x73,
-  0x20, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x72, 0x65, 0x63, 0x65,
-  0x69, 0x76, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x61, 0x73, 0x73, 0x75, 0x6d,
-  0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x72, 0x65, 0x61, 0x73, 0x20,
-  0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x70, 0x72, 0x69, 0x6d, 0x61, 0x72, 0x69,
-  0x6c, 0x79, 0x20, 0x69, 0x6e, 0x74, 0x68, 0x65, 0x20, 0x62, 0x61, 0x73, 0x69,
-  0x73, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x65,
-  0x6e, 0x73, 0x65, 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x73, 0x20, 0x66,
-  0x6f, 0x72, 0x64, 0x65, 0x73, 0x74, 0x72, 0x6f, 0x79, 0x65, 0x64, 0x20, 0x62,
-  0x79, 0x61, 0x74, 0x20, 0x6c, 0x65, 0x61, 0x73, 0x74, 0x20, 0x74, 0x77, 0x6f,
-  0x77, 0x61, 0x73, 0x20, 0x64, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x65, 0x64, 0x63,
-  0x6f, 0x75, 0x6c, 0x64, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x62, 0x65, 0x53, 0x65,
-  0x63, 0x72, 0x65, 0x74, 0x61, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x61, 0x70, 0x70,
-  0x65, 0x61, 0x72, 0x20, 0x74, 0x6f, 0x20, 0x62, 0x65, 0x6d, 0x61, 0x72, 0x67,
-  0x69, 0x6e, 0x2d, 0x74, 0x6f, 0x70, 0x3a, 0x31, 0x2f, 0x5e, 0x5c, 0x73, 0x2b,
-  0x7c, 0x5c, 0x73, 0x2b, 0x24, 0x2f, 0x67, 0x65, 0x29, 0x7b, 0x74, 0x68, 0x72,
-  0x6f, 0x77, 0x20, 0x65, 0x7d, 0x3b, 0x74, 0x68, 0x65, 0x20, 0x73, 0x74, 0x61,
-  0x72, 0x74, 0x20, 0x6f, 0x66, 0x74, 0x77, 0x6f, 0x20, 0x73, 0x65, 0x70, 0x61,
-  0x72, 0x61, 0x74, 0x65, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x20,
-  0x61, 0x6e, 0x64, 0x77, 0x68, 0x6f, 0x20, 0x68, 0x61, 0x64, 0x20, 0x62, 0x65,
-  0x65, 0x6e, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f,
-  0x66, 0x64, 0x65, 0x61, 0x74, 0x68, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
-  0x72, 0x65, 0x61, 0x6c, 0x20, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x73, 0x09,
-  0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x70, 0x72,
-  0x6f, 0x76, 0x69, 0x64, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65,
-  0x20, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6d, 0x70,
-  0x65, 0x74, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x65, 0x6e, 0x67, 0x6c, 0x69,
-  0x73, 0x68, 0x20, 0x28, 0x55, 0x4b, 0x29, 0x65, 0x6e, 0x67, 0x6c, 0x69, 0x73,
-  0x68, 0x20, 0x28, 0x55, 0x53, 0x29, 0xd0, 0x9c, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0,
-  0xb3, 0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xa1, 0xd1, 0x80, 0xd0, 0xbf, 0xd1, 0x81,
-  0xd0, 0xba, 0xd0, 0xb8, 0xd1, 0x81, 0xd1, 0x80, 0xd0, 0xbf, 0xd1, 0x81, 0xd0,
-  0xba, 0xd0, 0xb8, 0xd1, 0x81, 0xd1, 0x80, 0xd0, 0xbf, 0xd1, 0x81, 0xd0, 0xba,
-  0xd0, 0xbe, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xa8, 0xd9, 0x8a, 0xd8,
-  0xa9, 0xe6, 0xad, 0xa3, 0xe9, 0xab, 0x94, 0xe4, 0xb8, 0xad, 0xe6, 0x96, 0x87,
-  0xe7, 0xae, 0x80, 0xe4, 0xbd, 0x93, 0xe4, 0xb8, 0xad, 0xe6, 0x96, 0x87, 0xe7,
-  0xb9, 0x81, 0xe4, 0xbd, 0x93, 0xe4, 0xb8, 0xad, 0xe6, 0x96, 0x87, 0xe6, 0x9c,
-  0x89, 0xe9, 0x99, 0x90, 0xe5, 0x85, 0xac, 0xe5, 0x8f, 0xb8, 0xe4, 0xba, 0xba,
-  0xe6, 0xb0, 0x91, 0xe6, 0x94, 0xbf, 0xe5, 0xba, 0x9c, 0xe9, 0x98, 0xbf, 0xe9,
-  0x87, 0x8c, 0xe5, 0xb7, 0xb4, 0xe5, 0xb7, 0xb4, 0xe7, 0xa4, 0xbe, 0xe4, 0xbc,
-  0x9a, 0xe4, 0xb8, 0xbb, 0xe4, 0xb9, 0x89, 0xe6, 0x93, 0x8d, 0xe4, 0xbd, 0x9c,
-  0xe7, 0xb3, 0xbb, 0xe7, 0xbb, 0x9f, 0xe6, 0x94, 0xbf, 0xe7, 0xad, 0x96, 0xe6,
-  0xb3, 0x95, 0xe8, 0xa7, 0x84, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x63,
-  0x69, 0xc3, 0xb3, 0x6e, 0x68, 0x65, 0x72, 0x72, 0x61, 0x6d, 0x69, 0x65, 0x6e,
-  0x74, 0x61, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72, 0xc3, 0xb3, 0x6e, 0x69,
-  0x63, 0x6f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x63, 0x69, 0xc3, 0xb3,
-  0x6e, 0x63, 0x6c, 0x61, 0x73, 0x69, 0x66, 0x69, 0x63, 0x61, 0x64, 0x6f, 0x73,
-  0x63, 0x6f, 0x6e, 0x6f, 0x63, 0x69, 0x6d, 0x69, 0x65, 0x6e, 0x74, 0x6f, 0x70,
-  0x75, 0x62, 0x6c, 0x69, 0x63, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x72, 0x65,
-  0x6c, 0x61, 0x63, 0x69, 0x6f, 0x6e, 0x61, 0x64, 0x61, 0x73, 0x69, 0x6e, 0x66,
-  0x6f, 0x72, 0x6d, 0xc3, 0xa1, 0x74, 0x69, 0x63, 0x61, 0x72, 0x65, 0x6c, 0x61,
-  0x63, 0x69, 0x6f, 0x6e, 0x61, 0x64, 0x6f, 0x73, 0x64, 0x65, 0x70, 0x61, 0x72,
-  0x74, 0x61, 0x6d, 0x65, 0x6e, 0x74, 0x6f, 0x74, 0x72, 0x61, 0x62, 0x61, 0x6a,
-  0x61, 0x64, 0x6f, 0x72, 0x65, 0x73, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x61,
-  0x6d, 0x65, 0x6e, 0x74, 0x65, 0x61, 0x79, 0x75, 0x6e, 0x74, 0x61, 0x6d, 0x69,
-  0x65, 0x6e, 0x74, 0x6f, 0x6d, 0x65, 0x72, 0x63, 0x61, 0x64, 0x6f, 0x4c, 0x69,
-  0x62, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0xc3, 0xa1, 0x63, 0x74, 0x65, 0x6e,
-  0x6f, 0x73, 0x68, 0x61, 0x62, 0x69, 0x74, 0x61, 0x63, 0x69, 0x6f, 0x6e, 0x65,
-  0x73, 0x63, 0x75, 0x6d, 0x70, 0x6c, 0x69, 0x6d, 0x69, 0x65, 0x6e, 0x74, 0x6f,
-  0x72, 0x65, 0x73, 0x74, 0x61, 0x75, 0x72, 0x61, 0x6e, 0x74, 0x65, 0x73, 0x64,
-  0x69, 0x73, 0x70, 0x6f, 0x73, 0x69, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x6f,
-  0x6e, 0x73, 0x65, 0x63, 0x75, 0x65, 0x6e, 0x63, 0x69, 0x61, 0x65, 0x6c, 0x65,
-  0x63, 0x74, 0x72, 0xc3, 0xb3, 0x6e, 0x69, 0x63, 0x61, 0x61, 0x70, 0x6c, 0x69,
-  0x63, 0x61, 0x63, 0x69, 0x6f, 0x6e, 0x65, 0x73, 0x64, 0x65, 0x73, 0x63, 0x6f,
-  0x6e, 0x65, 0x63, 0x74, 0x61, 0x64, 0x6f, 0x69, 0x6e, 0x73, 0x74, 0x61, 0x6c,
-  0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x72, 0x65, 0x61, 0x6c, 0x69, 0x7a, 0x61,
-  0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x75, 0x74, 0x69, 0x6c, 0x69, 0x7a, 0x61, 0x63,
-  0x69, 0xc3, 0xb3, 0x6e, 0x65, 0x6e, 0x63, 0x69, 0x63, 0x6c, 0x6f, 0x70, 0x65,
-  0x64, 0x69, 0x61, 0x65, 0x6e, 0x66, 0x65, 0x72, 0x6d, 0x65, 0x64, 0x61, 0x64,
-  0x65, 0x73, 0x69, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x6f,
-  0x73, 0x65, 0x78, 0x70, 0x65, 0x72, 0x69, 0x65, 0x6e, 0x63, 0x69, 0x61, 0x73,
-  0x69, 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x70,
-  0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c, 0x61, 0x72, 0x65, 0x73, 0x73, 0x75,
-  0x62, 0x63, 0x61, 0x74, 0x65, 0x67, 0x6f, 0x72, 0x69, 0x61, 0xd1, 0x82, 0xd0,
-  0xbe, 0xd0, 0xbb, 0xd1, 0x8c, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xa0, 0xd0, 0xbe,
-  0xd1, 0x81, 0xd1, 0x81, 0xd0, 0xb8, 0xd0, 0xb8, 0xd1, 0x80, 0xd0, 0xb0, 0xd0,
-  0xb1, 0xd0, 0xbe, 0xd1, 0x82, 0xd1, 0x8b, 0xd0, 0xb1, 0xd0, 0xbe, 0xd0, 0xbb,
-  0xd1, 0x8c, 0xd1, 0x88, 0xd0, 0xb5, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xbe, 0xd1,
-  0x81, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xb6, 0xd0, 0xb5,
-  0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xb4, 0xd1, 0x80, 0xd1, 0x83, 0xd0, 0xb3, 0xd0,
-  0xb8, 0xd1, 0x85, 0xd1, 0x81, 0xd0, 0xbb, 0xd1, 0x83, 0xd1, 0x87, 0xd0, 0xb0,
-  0xd0, 0xb5, 0xd1, 0x81, 0xd0, 0xb5, 0xd0, 0xb9, 0xd1, 0x87, 0xd0, 0xb0, 0xd1,
-  0x81, 0xd0, 0xb2, 0xd1, 0x81, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xb4, 0xd0, 0xb0,
-  0xd0, 0xa0, 0xd0, 0xbe, 0xd1, 0x81, 0xd1, 0x81, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0,
-  0x9c, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb2, 0xd0, 0xb5, 0xd0, 0xb4,
-  0xd1, 0x80, 0xd1, 0x83, 0xd0, 0xb3, 0xd0, 0xb8, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0,
-  0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb0, 0xd0, 0xb2, 0xd0, 0xbe,
-  0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xb4, 0xd0, 0xb0, 0xd0,
-  0xbd, 0xd0, 0xbd, 0xd1, 0x8b, 0xd1, 0x85, 0xd0, 0xb4, 0xd0, 0xbe, 0xd0, 0xbb,
-  0xd0, 0xb6, 0xd0, 0xbd, 0xd1, 0x8b, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0,
-  0xbd, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0x9c, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xba,
-  0xd0, 0xb2, 0xd1, 0x8b, 0xd1, 0x80, 0xd1, 0x83, 0xd0, 0xb1, 0xd0, 0xbb, 0xd0,
-  0xb5, 0xd0, 0xb9, 0xd0, 0x9c, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb2,
-  0xd0, 0xb0, 0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbd, 0xd1,
-  0x8b, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x87, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xbe,
-  0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb1, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xb5, 0xd0,
-  0xb4, 0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xb6, 0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x83,
-  0xd1, 0x81, 0xd0, 0xbb, 0xd1, 0x83, 0xd0, 0xb3, 0xd0, 0xb8, 0xd1, 0x82, 0xd0,
-  0xb5, 0xd0, 0xbf, 0xd0, 0xb5, 0xd1, 0x80, 0xd1, 0x8c, 0xd0, 0x9e, 0xd0, 0xb4,
-  0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xbf, 0xd0, 0xbe, 0xd1,
-  0x82, 0xd0, 0xbe, 0xd0, 0xbc, 0xd1, 0x83, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb1,
-  0xd0, 0xbe, 0xd1, 0x82, 0xd1, 0x83, 0xd0, 0xb0, 0xd0, 0xbf, 0xd1, 0x80, 0xd0,
-  0xb5, 0xd0, 0xbb, 0xd1, 0x8f, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xbe, 0xd0, 0xb1,
-  0xd1, 0x89, 0xd0, 0xb5, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0,
-  0xb3, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xb3,
-  0xd0, 0xbe, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb0, 0xd1, 0x82, 0xd1, 0x8c, 0xd0,
-  0xb8, 0xd0, 0xb4, 0xd1, 0x80, 0xd1, 0x83, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xb9,
-  0xd1, 0x84, 0xd0, 0xbe, 0xd1, 0x80, 0xd1, 0x83, 0xd0, 0xbc, 0xd0, 0xb5, 0xd1,
-  0x85, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd1, 0x88, 0xd0, 0xbe, 0xd0, 0xbf,
-  0xd1, 0x80, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xb2, 0xd1, 0x81, 0xd1,
-  0x81, 0xd1, 0x8b, 0xd0, 0xbb, 0xd0, 0xba, 0xd0, 0xb0, 0xd0, 0xba, 0xd0, 0xb0,
-  0xd0, 0xb6, 0xd0, 0xb4, 0xd1, 0x8b, 0xd0, 0xb9, 0xd0, 0xb2, 0xd0, 0xbb, 0xd0,
-  0xb0, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xb3, 0xd1, 0x80, 0xd1, 0x83,
-  0xd0, 0xbf, 0xd0, 0xbf, 0xd1, 0x8b, 0xd0, 0xb2, 0xd0, 0xbc, 0xd0, 0xb5, 0xd1,
-  0x81, 0xd1, 0x82, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb1, 0xd0, 0xbe,
-  0xd1, 0x82, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb0, 0xd0, 0xb7, 0xd0,
-  0xb0, 0xd0, 0xbb, 0xd0, 0xbf, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb2, 0xd1, 0x8b,
-  0xd0, 0xb9, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xb0, 0xd1, 0x82, 0xd1,
-  0x8c, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x8c, 0xd0, 0xb3, 0xd0, 0xb8,
-  0xd0, 0xbf, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0,
-  0xb1, 0xd0, 0xb8, 0xd0, 0xb7, 0xd0, 0xbd, 0xd0, 0xb5, 0xd1, 0x81, 0xd0, 0xbe,
-  0xd1, 0x81, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0,
-  0xbe, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x82, 0xd0, 0xba, 0xd1, 0x83,
-  0xd0, 0xbf, 0xd0, 0xb8, 0xd1, 0x82, 0xd1, 0x8c, 0xd0, 0xb4, 0xd0, 0xbe, 0xd0,
-  0xbb, 0xd0, 0xb6, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbc,
-  0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x85, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x87, 0xd0,
-  0xb0, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0, 0xa0, 0xd0, 0xb0, 0xd0, 0xb1, 0xd0, 0xbe,
-  0xd1, 0x82, 0xd0, 0xb0, 0xd0, 0xa2, 0xd0, 0xbe, 0xd0, 0xbb, 0xd1, 0x8c, 0xd0,
-  0xba, 0xd0, 0xbe, 0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xb2, 0xd1, 0x81, 0xd0, 0xb5,
-  0xd0, 0xbc, 0xd0, 0xb2, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd0,
-  0xb9, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x87, 0xd0, 0xb0, 0xd0, 0xbb, 0xd0, 0xb0,
-  0xd1, 0x81, 0xd0, 0xbf, 0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xba, 0xd1,
-  0x81, 0xd0, 0xbb, 0xd1, 0x83, 0xd0, 0xb6, 0xd0, 0xb1, 0xd1, 0x8b, 0xd1, 0x81,
-  0xd0, 0xb8, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0, 0xbf, 0xd0,
-  0xb5, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xbd, 0xd0, 0xbe,
-  0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xbf, 0xd0, 0xbe, 0xd0,
-  0xbc, 0xd0, 0xbe, 0xd1, 0x89, 0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xb0, 0xd0, 0xb9,
-  0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xbf, 0xd0, 0xbe, 0xd1, 0x87, 0xd0,
-  0xb5, 0xd0, 0xbc, 0xd1, 0x83, 0xd0, 0xbf, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xbe,
-  0xd1, 0x89, 0xd1, 0x8c, 0xd0, 0xb4, 0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xb6, 0xd0,
-  0xbd, 0xd0, 0xbe, 0xd1, 0x81, 0xd1, 0x81, 0xd1, 0x8b, 0xd0, 0xbb, 0xd0, 0xba,
-  0xd0, 0xb8, 0xd0, 0xb1, 0xd1, 0x8b, 0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x80, 0xd0,
-  0xbe, 0xd0, 0xb4, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xbd, 0xd1, 0x8b, 0xd0, 0xb5,
-  0xd0, 0xbc, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xb8, 0xd0, 0xb5, 0xd0,
-  0xbf, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xba, 0xd1, 0x82, 0xd0, 0xa1,
-  0xd0, 0xb5, 0xd0, 0xb9, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xbc, 0xd0,
-  0xbe, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xb0,
-  0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0,
-  0xbb, 0xd0, 0xb0, 0xd0, 0xb9, 0xd0, 0xbd, 0xd0, 0xb3, 0xd0, 0xbe, 0xd1, 0x80,
-  0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xb2, 0xd0, 0xb5, 0xd1, 0x80, 0xd1,
-  0x81, 0xd0, 0xb8, 0xd1, 0x8f, 0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x80, 0xd0, 0xb0,
-  0xd0, 0xbd, 0xd0, 0xb5, 0xd1, 0x84, 0xd0, 0xb8, 0xd0, 0xbb, 0xd1, 0x8c, 0xd0,
-  0xbc, 0xd1, 0x8b, 0xd1, 0x83, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xbd,
-  0xd1, 0x8f, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb7, 0xd0, 0xbd, 0xd1, 0x8b, 0xd1,
-  0x85, 0xd0, 0xb8, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x82, 0xd1, 0x8c,
-  0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb, 0xd1, 0x8e, 0xd1,
-  0x8f, 0xd0, 0xbd, 0xd0, 0xb2, 0xd0, 0xb0, 0xd1, 0x80, 0xd1, 0x8f, 0xd0, 0xbc,
-  0xd0, 0xb5, 0xd0, 0xbd, 0xd1, 0x8c, 0xd1, 0x88, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0,
-  0xbd, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xb8, 0xd1, 0x85, 0xd0, 0xb4, 0xd0, 0xb0,
-  0xd0, 0xbd, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb9, 0xd0, 0xb7, 0xd0, 0xbd, 0xd0,
-  0xb0, 0xd1, 0x87, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xbb,
-  0xd1, 0x8c, 0xd0, 0xb7, 0xd1, 0x8f, 0xd1, 0x84, 0xd0, 0xbe, 0xd1, 0x80, 0xd1,
-  0x83, 0xd0, 0xbc, 0xd0, 0xb0, 0xd0, 0xa2, 0xd0, 0xb5, 0xd0, 0xbf, 0xd0, 0xb5,
-  0xd1, 0x80, 0xd1, 0x8c, 0xd0, 0xbc, 0xd0, 0xb5, 0xd1, 0x81, 0xd1, 0x8f, 0xd1,
-  0x86, 0xd0, 0xb0, 0xd0, 0xb7, 0xd0, 0xb0, 0xd1, 0x89, 0xd0, 0xb8, 0xd1, 0x82,
-  0xd1, 0x8b, 0xd0, 0x9b, 0xd1, 0x83, 0xd1, 0x87, 0xd1, 0x88, 0xd0, 0xb8, 0xd0,
-  0xb5, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x82,
-  0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0,
-  0xa4, 0x85, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
-  0x95, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x95,
-  0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x85, 0xe0,
-  0xa4, 0xa8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0x95, 0xe0, 0xa5,
-  0x8d, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
-  0xb8, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaf,
-  0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xb2, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x82, 0xe0, 0xa4,
-  0xb9, 0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4,
-  0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x80, 0xe0,
-  0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
-  0xb8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x95,
-  0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xae, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5,
-  0x8b, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95,
-  0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xb9, 0xe0,
-  0xa5, 0x81, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0x87, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x97,
-  0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
-  0x9f, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0x89, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
-  0xaf, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x81, 0xe0, 0xa4, 0xb8,
-  0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xad, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0xb7, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x86, 0xe0, 0xa4,
-  0xaa, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbf,
-  0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb6, 0xe0, 0xa5, 0x81, 0xe0,
-  0xa4, 0xb0, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4,
-  0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x98, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x9f,
-  0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa4, 0x85, 0xe0, 0xa4, 0xa7, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
-  0x85, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8,
-  0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xae, 0xe0,
-  0xa5, 0x81, 0xe0, 0xa4, 0x9d, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa3, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b,
-  0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xa1, 0xe0,
-  0xa4, 0xbc, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x9f,
-  0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x8d, 0xe0,
-  0xa4, 0xa6, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xa8,
-  0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0x95, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
-  0x86, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb5,
-  0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa6, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5,
-  0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xb8, 0xe0,
-  0xa4, 0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4,
-  0x97, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0xa0,
-  0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0x95, 0xe0,
-  0xa5, 0x80, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
-  0xb7, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb5,
-  0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8b, 0xe0,
-  0xa4, 0x9c, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0x9c, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8,
-  0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb9, 0xe0,
-  0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x89, 0xe0, 0xa4,
-  0xa8, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa5, 0x8d, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x82, 0xe0, 0xa4,
-  0x9a, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82,
-  0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0xb2, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x80,
-  0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0,
-  0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4,
-  0x9c, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8,
-  0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x98, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbf,
-  0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x80, 0xe0,
-  0xa4, 0x9a, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0x82, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x97, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x97, 0xe0,
-  0xa4, 0xb2, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5,
-  0x87, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xb0,
-  0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0,
-  0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
-  0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8,
-  0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa4, 0xb9, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x87, 0xe0, 0xa4,
-  0xb8, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xb9,
-  0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa1, 0xe0,
-  0xa4, 0xbc, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x98, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4,
-  0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x82, 0xe0,
-  0xa4, 0x9a, 0xe0, 0xa4, 0xb6, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5,
-  0x80, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xbc, 0xe0, 0xa5, 0x80,
-  0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x87, 0xe0,
-  0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x88, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4,
-  0xb6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xb8,
-  0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x9c, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0x9c,
-  0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0x9f, 0xe0,
-  0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x96, 0xe0, 0xa4,
-  0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xbc,
-  0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0, 0xa5,
-  0x80, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xb2,
-  0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0x96, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0x85, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0x9c,
-  0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa6, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0x96, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4,
-  0xb9, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbf,
-  0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xbf, 0xe0,
-  0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x88, 0xe0, 0xa4,
-  0x82, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x80,
-  0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xa8, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87,
-  0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xab, 0xe0, 0xa5, 0x80, 0xe0,
-  0xa4, 0x9c, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
-  0xa4, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xae,
-  0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb5, 0xe0,
-  0xa4, 0xb9, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5,
-  0x8b, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbc, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbf,
-  0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa5, 0x8b, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
-  0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6,
-  0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa8, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0x96, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xac,
-  0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0x9c, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xac, 0xe0, 0xa4,
-  0xaa, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xac,
-  0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xbc, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0,
-  0xa5, 0x8c, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb6, 0xe0, 0xa5,
-  0x87, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbf,
-  0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb9, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
-  0xb8, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0x8f, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0x82, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa5, 0xe0, 0xa4,
-  0xb2, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87,
-  0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x96, 0xe0, 0xa4, 0x95, 0xe0,
-  0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb7, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4,
-  0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb8,
-  0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xa5, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xd8, 0xaa, 0xd8, 0xb3, 0xd8,
-  0xaa, 0xd8, 0xb7, 0xd9, 0x8a, 0xd8, 0xb9, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7,
-  0xd8, 0xb1, 0xd9, 0x83, 0xd8, 0xa9, 0xd8, 0xa8, 0xd9, 0x88, 0xd8, 0xa7, 0xd8,
-  0xb3, 0xd8, 0xb7, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb5, 0xd9, 0x81,
-  0xd8, 0xad, 0xd8, 0xa9, 0xd9, 0x85, 0xd9, 0x88, 0xd8, 0xa7, 0xd8, 0xb6, 0xd9,
-  0x8a, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xae, 0xd8, 0xa7, 0xd8, 0xb5,
-  0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb2, 0xd9, 0x8a, 0xd8,
-  0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xa9,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa8, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8, 0xaf, 0xd9, 0x88, 0xd8, 0xaf, 0xd8, 0xa8,
-  0xd8, 0xb1, 0xd9, 0x86, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xac, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd8, 0xaf, 0xd9, 0x88, 0xd9, 0x84, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84,
-  0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd9,
-  0x85, 0xd9, 0x88, 0xd9, 0x82, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9,
-  0xd8, 0xb1, 0xd8, 0xa8, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb3, 0xd8,
-  0xb1, 0xd9, 0x8a, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xac, 0xd9, 0x88,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb0, 0xd9, 0x87, 0xd8,
-  0xa7, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xad, 0xd9, 0x8a, 0xd8, 0xa7,
-  0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xad, 0xd9, 0x82, 0xd9, 0x88, 0xd9,
-  0x82, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd8, 0xb1, 0xd9, 0x8a, 0xd9, 0x85,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x82, 0xd9,
-  0x85, 0xd8, 0xad, 0xd9, 0x81, 0xd9, 0x88, 0xd8, 0xb8, 0xd8, 0xa9, 0xd8, 0xa7,
-  0xd9, 0x84, 0xd8, 0xab, 0xd8, 0xa7, 0xd9, 0x86, 0xd9, 0x8a, 0xd9, 0x85, 0xd8,
-  0xb4, 0xd8, 0xa7, 0xd9, 0x87, 0xd8, 0xaf, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84,
-  0xd9, 0x85, 0xd8, 0xb1, 0xd8, 0xa3, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd9,
-  0x82, 0xd8, 0xb1, 0xd8, 0xa2, 0xd9, 0x86, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb4,
-  0xd8, 0xa8, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xad, 0xd9,
-  0x88, 0xd8, 0xa7, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xac, 0xd8, 0xaf,
-  0xd9, 0x8a, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd8, 0xb3, 0xd8,
-  0xb1, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x88,
-  0xd9, 0x85, 0xd9, 0x85, 0xd8, 0xac, 0xd9, 0x85, 0xd9, 0x88, 0xd8, 0xb9, 0xd8,
-  0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8, 0xad, 0xd9, 0x85, 0xd9, 0x86,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x86, 0xd9, 0x82, 0xd8, 0xa7, 0xd8, 0xb7, 0xd9,
-  0x81, 0xd9, 0x84, 0xd8, 0xb3, 0xd8, 0xb7, 0xd9, 0x8a, 0xd9, 0x86, 0xd8, 0xa7,
-  0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x88, 0xd9, 0x8a, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd8, 0xaf, 0xd9, 0x86, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xb1,
-  0xd9, 0x83, 0xd8, 0xa7, 0xd8, 0xaa, 0xd9, 0x87, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
-  0xb1, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xb6, 0xd8, 0xaa, 0xd8, 0xad, 0xd9, 0x8a,
-  0xd8, 0xa7, 0xd8, 0xaa, 0xd9, 0x8a, 0xd8, 0xa8, 0xd8, 0xaa, 0xd9, 0x88, 0xd9,
-  0x82, 0xd9, 0x8a, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd9, 0x88,
-  0xd9, 0x84, 0xd9, 0x89, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa8, 0xd8, 0xb1, 0xd9,
-  0x8a, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x84, 0xd8, 0xa7,
-  0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8,
-  0xb7, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb4, 0xd8, 0xae, 0xd8, 0xb5, 0xd9, 0x8a,
-  0xd8, 0xb3, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xb1, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd8, 0xab, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xab, 0xd8, 0xa7,
-  0xd9, 0x84, 0xd8, 0xb5, 0xd9, 0x84, 0xd8, 0xa7, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd8, 0xad, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xab, 0xd8, 0xa7, 0xd9, 0x84,
-  0xd8, 0xb2, 0xd9, 0x88, 0xd8, 0xa7, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
-  0xae, 0xd9, 0x84, 0xd9, 0x8a, 0xd8, 0xac, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xac,
-  0xd9, 0x85, 0xd9, 0x8a, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8,
-  0xa7, 0xd9, 0x85, 0xd9, 0x87, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xac, 0xd9, 0x85,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb3, 0xd8, 0xa7, 0xd8,
-  0xb9, 0xd8, 0xa9, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7, 0xd9, 0x87, 0xd8, 0xaf,
-  0xd9, 0x87, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8, 0xa6, 0xd9, 0x8a, 0xd8,
-  0xb3, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xaf, 0xd8, 0xae, 0xd9, 0x88, 0xd9, 0x84,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x81, 0xd9, 0x86, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd8, 0xaa, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xa7,
-  0xd9, 0x84, 0xd8, 0xaf, 0xd9, 0x88, 0xd8, 0xb1, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd8, 0xaf, 0xd8, 0xb1, 0xd9, 0x88, 0xd8, 0xb3, 0xd8, 0xa7, 0xd8, 0xb3,
-  0xd8, 0xaa, 0xd8, 0xba, 0xd8, 0xb1, 0xd9, 0x82, 0xd8, 0xaa, 0xd8, 0xb5, 0xd8,
-  0xa7, 0xd9, 0x85, 0xd9, 0x8a, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa8,
-  0xd9, 0x86, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8,
-  0xb8, 0xd9, 0x8a, 0xd9, 0x85, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x74, 0x61, 0x69,
-  0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x74, 0x61,
-  0x6e, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x3d, 0x20, 0x66, 0x75, 0x6e, 0x63, 0x74,
-  0x69, 0x6f, 0x6e, 0x28, 0x29, 0x2e, 0x6a, 0x70, 0x67, 0x22, 0x20, 0x77, 0x69,
-  0x64, 0x74, 0x68, 0x3d, 0x22, 0x63, 0x6f, 0x6e, 0x66, 0x69, 0x67, 0x75, 0x72,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x70, 0x6e, 0x67, 0x22, 0x20, 0x77, 0x69,
-  0x64, 0x74, 0x68, 0x3d, 0x22, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x20, 0x63, 0x6c,
-  0x61, 0x73, 0x73, 0x3d, 0x22, 0x4d, 0x61, 0x74, 0x68, 0x2e, 0x72, 0x61, 0x6e,
-  0x64, 0x6f, 0x6d, 0x28, 0x29, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6d, 0x70, 0x6f,
-  0x72, 0x61, 0x72, 0x79, 0x20, 0x55, 0x6e, 0x69, 0x74, 0x65, 0x64, 0x20, 0x53,
-  0x74, 0x61, 0x74, 0x65, 0x73, 0x63, 0x69, 0x72, 0x63, 0x75, 0x6d, 0x73, 0x74,
-  0x61, 0x6e, 0x63, 0x65, 0x73, 0x2e, 0x61, 0x70, 0x70, 0x65, 0x6e, 0x64, 0x43,
-  0x68, 0x69, 0x6c, 0x64, 0x28, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c,
-  0x61, 0x73, 0x73, 0x3d, 0x22, 0x22, 0x3e, 0x3c, 0x69, 0x6d, 0x67, 0x20, 0x73,
-  0x72, 0x63, 0x3d, 0x22, 0x2f, 0x64, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x67, 0x75,
-  0x69, 0x73, 0x68, 0x65, 0x64, 0x74, 0x68, 0x6f, 0x75, 0x73, 0x61, 0x6e, 0x64,
-  0x73, 0x20, 0x6f, 0x66, 0x20, 0x63, 0x6f, 0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x63,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x22, 0x3e, 0x3c,
-  0x2f, 0x64, 0x69, 0x76, 0x3e, 0x69, 0x6e, 0x76, 0x65, 0x73, 0x74, 0x69, 0x67,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x61, 0x76, 0x69, 0x63, 0x6f, 0x6e, 0x2e,
-  0x69, 0x63, 0x6f, 0x22, 0x20, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x72,
-  0x69, 0x67, 0x68, 0x74, 0x3a, 0x62, 0x61, 0x73, 0x65, 0x64, 0x20, 0x6f, 0x6e,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x4d, 0x61, 0x73, 0x73, 0x61, 0x63, 0x68, 0x75,
-  0x73, 0x65, 0x74, 0x74, 0x73, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x62, 0x6f,
-  0x72, 0x64, 0x65, 0x72, 0x3d, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x6b, 0x6e, 0x6f,
-  0x77, 0x6e, 0x20, 0x61, 0x73, 0x70, 0x72, 0x6f, 0x6e, 0x75, 0x6e, 0x63, 0x69,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75,
-  0x6e, 0x64, 0x3a, 0x23, 0x66, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x2d,
-  0x6c, 0x65, 0x66, 0x74, 0x3a, 0x46, 0x6f, 0x72, 0x20, 0x65, 0x78, 0x61, 0x6d,
-  0x70, 0x6c, 0x65, 0x2c, 0x20, 0x6d, 0x69, 0x73, 0x63, 0x65, 0x6c, 0x6c, 0x61,
-  0x6e, 0x65, 0x6f, 0x75, 0x73, 0x26, 0x6c, 0x74, 0x3b, 0x2f, 0x6d, 0x61, 0x74,
-  0x68, 0x26, 0x67, 0x74, 0x3b, 0x70, 0x73, 0x79, 0x63, 0x68, 0x6f, 0x6c, 0x6f,
-  0x67, 0x69, 0x63, 0x61, 0x6c, 0x69, 0x6e, 0x20, 0x70, 0x61, 0x72, 0x74, 0x69,
-  0x63, 0x75, 0x6c, 0x61, 0x72, 0x65, 0x61, 0x72, 0x63, 0x68, 0x22, 0x20, 0x74,
-  0x79, 0x70, 0x65, 0x3d, 0x22, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x6d, 0x65, 0x74,
-  0x68, 0x6f, 0x64, 0x3d, 0x22, 0x61, 0x73, 0x20, 0x6f, 0x70, 0x70, 0x6f, 0x73,
-  0x65, 0x64, 0x20, 0x74, 0x6f, 0x53, 0x75, 0x70, 0x72, 0x65, 0x6d, 0x65, 0x20,
-  0x43, 0x6f, 0x75, 0x72, 0x74, 0x6f, 0x63, 0x63, 0x61, 0x73, 0x69, 0x6f, 0x6e,
-  0x61, 0x6c, 0x6c, 0x79, 0x20, 0x41, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e,
-  0x61, 0x6c, 0x6c, 0x79, 0x2c, 0x4e, 0x6f, 0x72, 0x74, 0x68, 0x20, 0x41, 0x6d,
-  0x65, 0x72, 0x69, 0x63, 0x61, 0x70, 0x78, 0x3b, 0x62, 0x61, 0x63, 0x6b, 0x67,
-  0x72, 0x6f, 0x75, 0x6e, 0x64, 0x6f, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x75, 0x6e,
-  0x69, 0x74, 0x69, 0x65, 0x73, 0x45, 0x6e, 0x74, 0x65, 0x72, 0x74, 0x61, 0x69,
-  0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x74, 0x6f, 0x4c, 0x6f, 0x77, 0x65, 0x72,
-  0x43, 0x61, 0x73, 0x65, 0x28, 0x6d, 0x61, 0x6e, 0x75, 0x66, 0x61, 0x63, 0x74,
-  0x75, 0x72, 0x69, 0x6e, 0x67, 0x70, 0x72, 0x6f, 0x66, 0x65, 0x73, 0x73, 0x69,
-  0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x63, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x65, 0x64,
-  0x20, 0x77, 0x69, 0x74, 0x68, 0x46, 0x6f, 0x72, 0x20, 0x69, 0x6e, 0x73, 0x74,
-  0x61, 0x6e, 0x63, 0x65, 0x2c, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x73, 0x74, 0x69,
-  0x6e, 0x67, 0x20, 0x6f, 0x66, 0x22, 0x20, 0x6d, 0x61, 0x78, 0x6c, 0x65, 0x6e,
-  0x67, 0x74, 0x68, 0x3d, 0x22, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20, 0x66,
-  0x61, 0x6c, 0x73, 0x65, 0x3b, 0x63, 0x6f, 0x6e, 0x73, 0x63, 0x69, 0x6f, 0x75,
-  0x73, 0x6e, 0x65, 0x73, 0x73, 0x4d, 0x65, 0x64, 0x69, 0x74, 0x65, 0x72, 0x72,
-  0x61, 0x6e, 0x65, 0x61, 0x6e, 0x65, 0x78, 0x74, 0x72, 0x61, 0x6f, 0x72, 0x64,
-  0x69, 0x6e, 0x61, 0x72, 0x79, 0x61, 0x73, 0x73, 0x61, 0x73, 0x73, 0x69, 0x6e,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x75, 0x62, 0x73, 0x65, 0x71, 0x75, 0x65,
-  0x6e, 0x74, 0x6c, 0x79, 0x20, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x20, 0x74,
-  0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x75, 0x6d, 0x62,
-  0x65, 0x72, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20, 0x6f, 0x72, 0x69, 0x67,
-  0x69, 0x6e, 0x61, 0x6c, 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x72, 0x65, 0x68, 0x65,
-  0x6e, 0x73, 0x69, 0x76, 0x65, 0x72, 0x65, 0x66, 0x65, 0x72, 0x73, 0x20, 0x74,
-  0x6f, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x2f, 0x75, 0x6c, 0x3e, 0x0a, 0x3c, 0x2f,
-  0x64, 0x69, 0x76, 0x3e, 0x0a, 0x70, 0x68, 0x69, 0x6c, 0x6f, 0x73, 0x6f, 0x70,
-  0x68, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x2e, 0x68, 0x72, 0x65, 0x66, 0x77, 0x61, 0x73, 0x20, 0x70, 0x75, 0x62, 0x6c,
-  0x69, 0x73, 0x68, 0x65, 0x64, 0x53, 0x61, 0x6e, 0x20, 0x46, 0x72, 0x61, 0x6e,
-  0x63, 0x69, 0x73, 0x63, 0x6f, 0x28, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f,
-  0x6e, 0x28, 0x29, 0x7b, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d,
-  0x22, 0x6d, 0x61, 0x69, 0x6e, 0x73, 0x6f, 0x70, 0x68, 0x69, 0x73, 0x74, 0x69,
-  0x63, 0x61, 0x74, 0x65, 0x64, 0x6d, 0x61, 0x74, 0x68, 0x65, 0x6d, 0x61, 0x74,
-  0x69, 0x63, 0x61, 0x6c, 0x20, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0d, 0x0a,
-  0x3c, 0x62, 0x6f, 0x64, 0x79, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x73,
-  0x20, 0x74, 0x68, 0x61, 0x74, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x6e, 0x74, 0x72,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x68, 0x69, 0x70, 0x73, 0x6d, 0x61, 0x79, 0x20, 0x68, 0x61, 0x76, 0x65,
-  0x20, 0x62, 0x65, 0x65, 0x6e, 0x28, 0x66, 0x6f, 0x72, 0x20, 0x65, 0x78, 0x61,
-  0x6d, 0x70, 0x6c, 0x65, 0x2c, 0x54, 0x68, 0x69, 0x73, 0x20, 0x61, 0x72, 0x74,
-  0x69, 0x63, 0x6c, 0x65, 0x20, 0x69, 0x6e, 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x20,
-  0x63, 0x61, 0x73, 0x65, 0x73, 0x70, 0x61, 0x72, 0x74, 0x73, 0x20, 0x6f, 0x66,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x69, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x47, 0x72, 0x65, 0x61, 0x74, 0x20, 0x42, 0x72,
-  0x69, 0x74, 0x61, 0x69, 0x6e, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x70, 0x61, 0x64,
-  0x64, 0x69, 0x6e, 0x67, 0x3d, 0x65, 0x71, 0x75, 0x69, 0x76, 0x61, 0x6c, 0x65,
-  0x6e, 0x74, 0x20, 0x74, 0x6f, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x68, 0x6f, 0x6c,
-  0x64, 0x65, 0x72, 0x3d, 0x22, 0x3b, 0x20, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73,
-  0x69, 0x7a, 0x65, 0x3a, 0x20, 0x6a, 0x75, 0x73, 0x74, 0x69, 0x66, 0x69, 0x63,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x76, 0x65, 0x64,
-  0x20, 0x74, 0x68, 0x61, 0x74, 0x73, 0x75, 0x66, 0x66, 0x65, 0x72, 0x65, 0x64,
-  0x20, 0x66, 0x72, 0x6f, 0x6d, 0x61, 0x74, 0x74, 0x65, 0x6d, 0x70, 0x74, 0x65,
-  0x64, 0x20, 0x74, 0x6f, 0x20, 0x6c, 0x65, 0x61, 0x64, 0x65, 0x72, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x63, 0x72, 0x69, 0x70, 0x74, 0x22, 0x20, 0x73,
-  0x72, 0x63, 0x3d, 0x22, 0x2f, 0x28, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f,
-  0x6e, 0x28, 0x29, 0x20, 0x7b, 0x61, 0x72, 0x65, 0x20, 0x61, 0x76, 0x61, 0x69,
-  0x6c, 0x61, 0x62, 0x6c, 0x65, 0x0a, 0x09, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20,
-  0x72, 0x65, 0x6c, 0x3d, 0x22, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x27, 0x68, 0x74,
-  0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x74,
-  0x65, 0x64, 0x20, 0x69, 0x6e, 0x63, 0x6f, 0x6e, 0x76, 0x65, 0x6e, 0x74, 0x69,
-  0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x22, 0x20, 0x61, 0x6c, 0x74, 0x3d, 0x22, 0x22,
-  0x20, 0x2f, 0x3e, 0x3c, 0x2f, 0x61, 0x72, 0x65, 0x20, 0x67, 0x65, 0x6e, 0x65,
-  0x72, 0x61, 0x6c, 0x6c, 0x79, 0x68, 0x61, 0x73, 0x20, 0x61, 0x6c, 0x73, 0x6f,
-  0x20, 0x62, 0x65, 0x65, 0x6e, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x70, 0x6f, 0x70,
-  0x75, 0x6c, 0x61, 0x72, 0x20, 0x63, 0x6f, 0x72, 0x72, 0x65, 0x73, 0x70, 0x6f,
-  0x6e, 0x64, 0x69, 0x6e, 0x67, 0x63, 0x72, 0x65, 0x64, 0x69, 0x74, 0x65, 0x64,
-  0x20, 0x77, 0x69, 0x74, 0x68, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x62, 0x6f,
-  0x72, 0x64, 0x65, 0x72, 0x3a, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x73, 0x70,
-  0x61, 0x6e, 0x3e, 0x3c, 0x2f, 0x2e, 0x67, 0x69, 0x66, 0x22, 0x20, 0x77, 0x69,
-  0x64, 0x74, 0x68, 0x3d, 0x22, 0x3c, 0x69, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x20,
-  0x73, 0x72, 0x63, 0x3d, 0x22, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x63, 0x6c,
-  0x61, 0x73, 0x73, 0x3d, 0x22, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x2d, 0x62,
-  0x6c, 0x6f, 0x63, 0x6b, 0x3b, 0x61, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x69, 0x6e,
-  0x67, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x6f, 0x67, 0x65, 0x74, 0x68, 0x65, 0x72,
-  0x20, 0x77, 0x69, 0x74, 0x68, 0x61, 0x70, 0x70, 0x72, 0x6f, 0x78, 0x69, 0x6d,
-  0x61, 0x74, 0x65, 0x6c, 0x79, 0x70, 0x61, 0x72, 0x6c, 0x69, 0x61, 0x6d, 0x65,
-  0x6e, 0x74, 0x61, 0x72, 0x79, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x61, 0x6e, 0x64,
-  0x20, 0x6d, 0x6f, 0x72, 0x65, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a,
-  0x6e, 0x6f, 0x6e, 0x65, 0x3b, 0x74, 0x72, 0x61, 0x64, 0x69, 0x74, 0x69, 0x6f,
-  0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x70, 0x72, 0x65, 0x64, 0x6f, 0x6d, 0x69, 0x6e,
-  0x61, 0x6e, 0x74, 0x6c, 0x79, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x7c, 0x26,
-  0x6e, 0x62, 0x73, 0x70, 0x3b, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c, 0x2f,
-  0x73, 0x70, 0x61, 0x6e, 0x3e, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x73, 0x70, 0x61,
-  0x63, 0x69, 0x6e, 0x67, 0x3d, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x6e,
-  0x61, 0x6d, 0x65, 0x3d, 0x22, 0x6f, 0x72, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74,
-  0x65, 0x6e, 0x74, 0x3d, 0x22, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x76, 0x65,
-  0x72, 0x73, 0x69, 0x61, 0x6c, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x74, 0x79,
-  0x3d, 0x22, 0x6f, 0x67, 0x3a, 0x2f, 0x78, 0x2d, 0x73, 0x68, 0x6f, 0x63, 0x6b,
-  0x77, 0x61, 0x76, 0x65, 0x2d, 0x64, 0x65, 0x6d, 0x6f, 0x6e, 0x73, 0x74, 0x72,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x75, 0x72, 0x72, 0x6f, 0x75, 0x6e, 0x64,
-  0x65, 0x64, 0x20, 0x62, 0x79, 0x4e, 0x65, 0x76, 0x65, 0x72, 0x74, 0x68, 0x65,
-  0x6c, 0x65, 0x73, 0x73, 0x2c, 0x77, 0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x66, 0x69, 0x72, 0x73, 0x74, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72,
-  0x61, 0x62, 0x6c, 0x65, 0x20, 0x41, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f, 0x72,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x68, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x6e,
-  0x6f, 0x74, 0x20, 0x62, 0x65, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x72, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x73, 0x74,
-  0x79, 0x6c, 0x65, 0x3d, 0x22, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x6c, 0x79, 0x20,
-  0x61, 0x66, 0x74, 0x65, 0x72, 0x66, 0x6f, 0x72, 0x20, 0x69, 0x6e, 0x73, 0x74,
-  0x61, 0x6e, 0x63, 0x65, 0x2c, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x65,
-  0x64, 0x20, 0x61, 0x73, 0x20, 0x2f, 0x68, 0x65, 0x61, 0x64, 0x3e, 0x0a, 0x3c,
-  0x62, 0x6f, 0x64, 0x79, 0x20, 0x73, 0x74, 0x61, 0x72, 0x74, 0x69, 0x6e, 0x67,
-  0x20, 0x77, 0x69, 0x74, 0x68, 0x69, 0x6e, 0x63, 0x72, 0x65, 0x61, 0x73, 0x69,
-  0x6e, 0x67, 0x6c, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x66, 0x61, 0x63, 0x74,
-  0x20, 0x74, 0x68, 0x61, 0x74, 0x64, 0x69, 0x73, 0x63, 0x75, 0x73, 0x73, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6d, 0x69, 0x64, 0x64, 0x6c, 0x65, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x20, 0x69, 0x6e, 0x64, 0x69, 0x76,
-  0x69, 0x64, 0x75, 0x61, 0x6c, 0x64, 0x69, 0x66, 0x66, 0x69, 0x63, 0x75, 0x6c,
-  0x74, 0x20, 0x74, 0x6f, 0x20, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x20, 0x6f, 0x66,
-  0x20, 0x76, 0x69, 0x65, 0x77, 0x68, 0x6f, 0x6d, 0x6f, 0x73, 0x65, 0x78, 0x75,
-  0x61, 0x6c, 0x69, 0x74, 0x79, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x61, 0x6e,
-  0x63, 0x65, 0x20, 0x6f, 0x66, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c,
-  0x2f, 0x64, 0x69, 0x76, 0x3e, 0x6d, 0x61, 0x6e, 0x75, 0x66, 0x61, 0x63, 0x74,
-  0x75, 0x72, 0x65, 0x72, 0x73, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x6c, 0x79,
-  0x20, 0x75, 0x73, 0x65, 0x64, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e,
-  0x63, 0x65, 0x20, 0x6f, 0x66, 0x64, 0x65, 0x6e, 0x6f, 0x6d, 0x69, 0x6e, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75,
-  0x6e, 0x64, 0x3a, 0x20, 0x23, 0x6c, 0x65, 0x6e, 0x67, 0x74, 0x68, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x64, 0x65, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x20, 0x73, 0x69, 0x67, 0x6e, 0x69, 0x66,
-  0x69, 0x63, 0x61, 0x6e, 0x74, 0x22, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72,
-  0x3d, 0x22, 0x30, 0x22, 0x3e, 0x72, 0x65, 0x76, 0x6f, 0x6c, 0x75, 0x74, 0x69,
-  0x6f, 0x6e, 0x61, 0x72, 0x79, 0x70, 0x72, 0x69, 0x6e, 0x63, 0x69, 0x70, 0x6c,
-  0x65, 0x73, 0x20, 0x6f, 0x66, 0x69, 0x73, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69,
-  0x64, 0x65, 0x72, 0x65, 0x64, 0x77, 0x61, 0x73, 0x20, 0x64, 0x65, 0x76, 0x65,
-  0x6c, 0x6f, 0x70, 0x65, 0x64, 0x49, 0x6e, 0x64, 0x6f, 0x2d, 0x45, 0x75, 0x72,
-  0x6f, 0x70, 0x65, 0x61, 0x6e, 0x76, 0x75, 0x6c, 0x6e, 0x65, 0x72, 0x61, 0x62,
-  0x6c, 0x65, 0x20, 0x74, 0x6f, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x6e, 0x65, 0x6e,
-  0x74, 0x73, 0x20, 0x6f, 0x66, 0x61, 0x72, 0x65, 0x20, 0x73, 0x6f, 0x6d, 0x65,
-  0x74, 0x69, 0x6d, 0x65, 0x73, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x72, 0x20, 0x74,
-  0x6f, 0x20, 0x74, 0x68, 0x65, 0x4e, 0x65, 0x77, 0x20, 0x59, 0x6f, 0x72, 0x6b,
-  0x20, 0x43, 0x69, 0x74, 0x79, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x73,
-  0x65, 0x61, 0x72, 0x63, 0x68, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74,
-  0x65, 0x64, 0x20, 0x74, 0x6f, 0x63, 0x6f, 0x75, 0x72, 0x73, 0x65, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x61, 0x74, 0x68, 0x65, 0x6d, 0x61, 0x74,
-  0x69, 0x63, 0x69, 0x61, 0x6e, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x65,
-  0x6e, 0x64, 0x20, 0x6f, 0x66, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x65,
-  0x6e, 0x64, 0x20, 0x6f, 0x66, 0x22, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72,
-  0x3d, 0x22, 0x30, 0x22, 0x20, 0x74, 0x65, 0x63, 0x68, 0x6e, 0x6f, 0x6c, 0x6f,
-  0x67, 0x69, 0x63, 0x61, 0x6c, 0x2e, 0x72, 0x65, 0x6d, 0x6f, 0x76, 0x65, 0x43,
-  0x6c, 0x61, 0x73, 0x73, 0x28, 0x62, 0x72, 0x61, 0x6e, 0x63, 0x68, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x76, 0x69, 0x64, 0x65, 0x6e, 0x63, 0x65,
-  0x20, 0x74, 0x68, 0x61, 0x74, 0x21, 0x5b, 0x65, 0x6e, 0x64, 0x69, 0x66, 0x5d,
-  0x2d, 0x2d, 0x3e, 0x0d, 0x0a, 0x49, 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x74,
-  0x65, 0x20, 0x6f, 0x66, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x20, 0x61, 0x20, 0x73,
-  0x69, 0x6e, 0x67, 0x6c, 0x65, 0x72, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74, 0x69,
-  0x76, 0x65, 0x6c, 0x79, 0x2e, 0x61, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x72,
-  0x65, 0x66, 0x6f, 0x72, 0x65, 0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x74, 0x69,
-  0x65, 0x73, 0x20, 0x6f, 0x66, 0x69, 0x73, 0x20, 0x6c, 0x6f, 0x63, 0x61, 0x74,
-  0x65, 0x64, 0x20, 0x69, 0x6e, 0x73, 0x6f, 0x6d, 0x65, 0x20, 0x6f, 0x66, 0x20,
-  0x77, 0x68, 0x69, 0x63, 0x68, 0x54, 0x68, 0x65, 0x72, 0x65, 0x20, 0x69, 0x73,
-  0x20, 0x61, 0x6c, 0x73, 0x6f, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75, 0x65,
-  0x64, 0x20, 0x74, 0x6f, 0x20, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x61, 0x6e,
-  0x63, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x6e, 0x64,
-  0x61, 0x73, 0x68, 0x3b, 0x20, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x65,
-  0x73, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x69, 0x6e, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64,
-  0x65, 0x6e, 0x74, 0x6c, 0x79, 0x65, 0x71, 0x75, 0x69, 0x70, 0x70, 0x65, 0x64,
-  0x20, 0x77, 0x69, 0x74, 0x68, 0x64, 0x6f, 0x65, 0x73, 0x20, 0x6e, 0x6f, 0x74,
-  0x20, 0x68, 0x61, 0x76, 0x65, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x61, 0x20, 0x68,
-  0x72, 0x65, 0x66, 0x3d, 0x22, 0x63, 0x6f, 0x6e, 0x66, 0x75, 0x73, 0x65, 0x64,
-  0x20, 0x77, 0x69, 0x74, 0x68, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x68, 0x72,
-  0x65, 0x66, 0x3d, 0x22, 0x2f, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61,
-  0x67, 0x65, 0x20, 0x6f, 0x66, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x20, 0x69,
-  0x6e, 0x20, 0x74, 0x68, 0x65, 0x54, 0x68, 0x65, 0x73, 0x65, 0x20, 0x69, 0x6e,
-  0x63, 0x6c, 0x75, 0x64, 0x65, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64, 0x6c, 0x65,
-  0x73, 0x73, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x62, 0x65,
-  0x20, 0x75, 0x73, 0x65, 0x64, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x26,
-  0x71, 0x75, 0x6f, 0x74, 0x3b, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x20,
-  0x74, 0x69, 0x6d, 0x65, 0x73, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e,
-  0x74, 0x20, 0x74, 0x68, 0x65, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0a, 0x3c, 0x2f,
-  0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x74, 0x20,
-  0x74, 0x6f, 0x20, 0x62, 0x65, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x69, 0x6c,
-  0x69, 0x74, 0x69, 0x65, 0x73, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x61,
-  0x67, 0x65, 0x20, 0x6f, 0x66, 0x61, 0x63, 0x63, 0x65, 0x73, 0x73, 0x20, 0x74,
-  0x6f, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x20, 0x61, 0x74, 0x74, 0x65, 0x6d,
-  0x70, 0x74, 0x20, 0x74, 0x6f, 0x70, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x2f, 0x6a,
-  0x71, 0x75, 0x65, 0x72, 0x79, 0x74, 0x77, 0x6f, 0x20, 0x64, 0x69, 0x66, 0x66,
-  0x65, 0x72, 0x65, 0x6e, 0x74, 0x62, 0x65, 0x6c, 0x6f, 0x6e, 0x67, 0x20, 0x74,
-  0x6f, 0x20, 0x74, 0x68, 0x65, 0x65, 0x73, 0x74, 0x61, 0x62, 0x6c, 0x69, 0x73,
-  0x68, 0x6d, 0x65, 0x6e, 0x74, 0x72, 0x65, 0x70, 0x6c, 0x61, 0x63, 0x69, 0x6e,
-  0x67, 0x20, 0x74, 0x68, 0x65, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x69, 0x6f, 0x6e, 0x22, 0x20, 0x64, 0x65, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e,
-  0x65, 0x20, 0x74, 0x68, 0x65, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61, 0x62, 0x6c,
-  0x65, 0x20, 0x66, 0x6f, 0x72, 0x41, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x69, 0x6e,
-  0x67, 0x20, 0x74, 0x6f, 0x20, 0x77, 0x69, 0x64, 0x65, 0x20, 0x72, 0x61, 0x6e,
-  0x67, 0x65, 0x20, 0x6f, 0x66, 0x09, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c,
-  0x61, 0x73, 0x73, 0x3d, 0x22, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x63, 0x6f, 0x6d,
-  0x6d, 0x6f, 0x6e, 0x6c, 0x79, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x73, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e,
-  0x61, 0x6c, 0x69, 0x74, 0x79, 0x77, 0x61, 0x73, 0x20, 0x63, 0x6f, 0x6d, 0x70,
-  0x6c, 0x65, 0x74, 0x65, 0x64, 0x20, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x6d, 0x64,
-  0x61, 0x73, 0x68, 0x3b, 0x20, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x68, 0x65, 0x20, 0x63, 0x68, 0x61, 0x72,
-  0x61, 0x63, 0x74, 0x65, 0x72, 0x61, 0x6e, 0x20, 0x61, 0x64, 0x64, 0x69, 0x74,
-  0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x73, 0x20,
-  0x74, 0x6f, 0x20, 0x62, 0x65, 0x66, 0x61, 0x63, 0x74, 0x20, 0x74, 0x68, 0x61,
-  0x74, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x20, 0x65, 0x78, 0x61, 0x6d, 0x70,
-  0x6c, 0x65, 0x20, 0x6f, 0x66, 0x73, 0x69, 0x67, 0x6e, 0x69, 0x66, 0x69, 0x63,
-  0x61, 0x6e, 0x74, 0x6c, 0x79, 0x6f, 0x6e, 0x6d, 0x6f, 0x75, 0x73, 0x65, 0x6f,
-  0x76, 0x65, 0x72, 0x3d, 0x22, 0x62, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20,
-  0x74, 0x68, 0x65, 0x79, 0x20, 0x61, 0x73, 0x79, 0x6e, 0x63, 0x20, 0x3d, 0x20,
-  0x74, 0x72, 0x75, 0x65, 0x3b, 0x70, 0x72, 0x6f, 0x62, 0x6c, 0x65, 0x6d, 0x73,
-  0x20, 0x77, 0x69, 0x74, 0x68, 0x73, 0x65, 0x65, 0x6d, 0x73, 0x20, 0x74, 0x6f,
-  0x20, 0x68, 0x61, 0x76, 0x65, 0x74, 0x68, 0x65, 0x20, 0x72, 0x65, 0x73, 0x75,
-  0x6c, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74,
-  0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x69, 0x61, 0x72,
-  0x20, 0x77, 0x69, 0x74, 0x68, 0x70, 0x6f, 0x73, 0x73, 0x65, 0x73, 0x73, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e,
-  0x20, 0x28, 0x29, 0x20, 0x7b, 0x74, 0x6f, 0x6f, 0x6b, 0x20, 0x70, 0x6c, 0x61,
-  0x63, 0x65, 0x20, 0x69, 0x6e, 0x61, 0x6e, 0x64, 0x20, 0x73, 0x6f, 0x6d, 0x65,
-  0x74, 0x69, 0x6d, 0x65, 0x73, 0x73, 0x75, 0x62, 0x73, 0x74, 0x61, 0x6e, 0x74,
-  0x69, 0x61, 0x6c, 0x6c, 0x79, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x2f,
-  0x73, 0x70, 0x61, 0x6e, 0x3e, 0x69, 0x73, 0x20, 0x6f, 0x66, 0x74, 0x65, 0x6e,
-  0x20, 0x75, 0x73, 0x65, 0x64, 0x69, 0x6e, 0x20, 0x61, 0x6e, 0x20, 0x61, 0x74,
-  0x74, 0x65, 0x6d, 0x70, 0x74, 0x67, 0x72, 0x65, 0x61, 0x74, 0x20, 0x64, 0x65,
-  0x61, 0x6c, 0x20, 0x6f, 0x66, 0x45, 0x6e, 0x76, 0x69, 0x72, 0x6f, 0x6e, 0x6d,
-  0x65, 0x6e, 0x74, 0x61, 0x6c, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x66,
-  0x75, 0x6c, 0x6c, 0x79, 0x20, 0x76, 0x69, 0x72, 0x74, 0x75, 0x61, 0x6c, 0x6c,
-  0x79, 0x20, 0x61, 0x6c, 0x6c, 0x32, 0x30, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e,
-  0x74, 0x75, 0x72, 0x79, 0x2c, 0x70, 0x72, 0x6f, 0x66, 0x65, 0x73, 0x73, 0x69,
-  0x6f, 0x6e, 0x61, 0x6c, 0x73, 0x6e, 0x65, 0x63, 0x65, 0x73, 0x73, 0x61, 0x72,
-  0x79, 0x20, 0x74, 0x6f, 0x20, 0x64, 0x65, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e,
-  0x65, 0x64, 0x20, 0x62, 0x79, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x74, 0x69, 0x62,
-  0x69, 0x6c, 0x69, 0x74, 0x79, 0x62, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20,
-  0x69, 0x74, 0x20, 0x69, 0x73, 0x44, 0x69, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61,
-  0x72, 0x79, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x64, 0x69, 0x66, 0x69, 0x63, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x54, 0x68, 0x65, 0x20, 0x66, 0x6f, 0x6c, 0x6c,
-  0x6f, 0x77, 0x69, 0x6e, 0x67, 0x6d, 0x61, 0x79, 0x20, 0x72, 0x65, 0x66, 0x65,
-  0x72, 0x20, 0x74, 0x6f, 0x3a, 0x43, 0x6f, 0x6e, 0x73, 0x65, 0x71, 0x75, 0x65,
-  0x6e, 0x74, 0x6c, 0x79, 0x2c, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68,
-  0x20, 0x73, 0x6f, 0x6d, 0x65, 0x74, 0x68, 0x61, 0x74, 0x20, 0x77, 0x6f, 0x75,
-  0x6c, 0x64, 0x20, 0x62, 0x65, 0x77, 0x6f, 0x72, 0x6c, 0x64, 0x27, 0x73, 0x20,
-  0x66, 0x69, 0x72, 0x73, 0x74, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x69, 0x66, 0x69,
-  0x65, 0x64, 0x20, 0x61, 0x73, 0x62, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x28, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75,
-  0x6c, 0x61, 0x72, 0x6c, 0x79, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x6c,
-  0x65, 0x66, 0x74, 0x22, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x63, 0x6f, 0x6d,
-  0x6d, 0x6f, 0x6e, 0x6c, 0x79, 0x62, 0x61, 0x73, 0x69, 0x73, 0x20, 0x66, 0x6f,
-  0x72, 0x20, 0x74, 0x68, 0x65, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x69, 0x62, 0x75,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x69,
-  0x74, 0x79, 0x20, 0x6f, 0x66, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x74, 0x6f, 0x20, 0x72, 0x65, 0x64, 0x75, 0x63,
-  0x65, 0x20, 0x74, 0x68, 0x65, 0x6a, 0x75, 0x72, 0x69, 0x73, 0x64, 0x69, 0x63,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x61, 0x70, 0x70, 0x72, 0x6f, 0x78, 0x69, 0x6d,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x6e, 0x6d, 0x6f, 0x75, 0x73, 0x65,
-  0x6f, 0x75, 0x74, 0x3d, 0x22, 0x4e, 0x65, 0x77, 0x20, 0x54, 0x65, 0x73, 0x74,
-  0x61, 0x6d, 0x65, 0x6e, 0x74, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c,
-  0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x55,
-  0x6e, 0x69, 0x74, 0x65, 0x64, 0x66, 0x69, 0x6c, 0x6d, 0x20, 0x64, 0x69, 0x72,
-  0x65, 0x63, 0x74, 0x6f, 0x72, 0x2d, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74, 0x2e,
-  0x64, 0x74, 0x64, 0x22, 0x3e, 0x68, 0x61, 0x73, 0x20, 0x62, 0x65, 0x65, 0x6e,
-  0x20, 0x75, 0x73, 0x65, 0x64, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20, 0x74,
-  0x6f, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68,
-  0x20, 0x74, 0x68, 0x69, 0x73, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x20, 0x69,
-  0x6e, 0x20, 0x74, 0x68, 0x65, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x20,
-  0x6f, 0x74, 0x68, 0x65, 0x72, 0x62, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x72,
-  0x65, 0x20, 0x61, 0x72, 0x65, 0x75, 0x6e, 0x70, 0x72, 0x65, 0x63, 0x65, 0x64,
-  0x65, 0x6e, 0x74, 0x65, 0x64, 0x69, 0x73, 0x20, 0x73, 0x69, 0x6d, 0x69, 0x6c,
-  0x61, 0x72, 0x20, 0x74, 0x6f, 0x65, 0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c,
-  0x6c, 0x79, 0x20, 0x69, 0x6e, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x20,
-  0x62, 0x6f, 0x6c, 0x64, 0x3b, 0x69, 0x73, 0x20, 0x63, 0x61, 0x6c, 0x6c, 0x65,
-  0x64, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6d, 0x70, 0x75, 0x74, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x69, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65,
-  0x20, 0x74, 0x68, 0x61, 0x74, 0x72, 0x65, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74,
-  0x65, 0x64, 0x20, 0x74, 0x6f, 0x09, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e,
-  0x61, 0x6d, 0x65, 0x3d, 0x22, 0x61, 0x72, 0x65, 0x20, 0x74, 0x79, 0x70, 0x69,
-  0x63, 0x61, 0x6c, 0x6c, 0x79, 0x63, 0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74,
-  0x20, 0x77, 0x69, 0x74, 0x68, 0x48, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x41, 0x6e, 0x20, 0x65, 0x78, 0x61, 0x6d, 0x70,
-  0x6c, 0x65, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x65, 0x64,
-  0x20, 0x77, 0x69, 0x74, 0x68, 0x71, 0x75, 0x61, 0x6e, 0x74, 0x69, 0x74, 0x69,
-  0x65, 0x73, 0x20, 0x6f, 0x66, 0x72, 0x61, 0x74, 0x68, 0x65, 0x72, 0x20, 0x74,
-  0x68, 0x61, 0x6e, 0x20, 0x61, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x65, 0x6c, 0x6c,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x65, 0x73, 0x73, 0x61, 0x72,
-  0x79, 0x20, 0x66, 0x6f, 0x72, 0x72, 0x65, 0x70, 0x6f, 0x72, 0x74, 0x65, 0x64,
-  0x20, 0x74, 0x68, 0x61, 0x74, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69, 0x63,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63, 0x61,
-  0x6c, 0x20, 0x61, 0x6e, 0x64, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x26, 0x6e,
-  0x62, 0x73, 0x70, 0x3b, 0x3c, 0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63,
-  0x65, 0x73, 0x20, 0x74, 0x6f, 0x74, 0x68, 0x65, 0x20, 0x73, 0x61, 0x6d, 0x65,
-  0x20, 0x79, 0x65, 0x61, 0x72, 0x47, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65,
-  0x6e, 0x74, 0x20, 0x6f, 0x66, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x68, 0x61, 0x76, 0x65, 0x20, 0x6e, 0x6f, 0x74,
-  0x20, 0x62, 0x65, 0x65, 0x6e, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61, 0x6c, 0x20,
-  0x79, 0x65, 0x61, 0x72, 0x73, 0x63, 0x6f, 0x6d, 0x6d, 0x69, 0x74, 0x6d, 0x65,
-  0x6e, 0x74, 0x20, 0x74, 0x6f, 0x09, 0x09, 0x3c, 0x75, 0x6c, 0x20, 0x63, 0x6c,
-  0x61, 0x73, 0x73, 0x3d, 0x22, 0x76, 0x69, 0x73, 0x75, 0x61, 0x6c, 0x69, 0x7a,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x31, 0x39, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e,
-  0x74, 0x75, 0x72, 0x79, 0x2c, 0x70, 0x72, 0x61, 0x63, 0x74, 0x69, 0x74, 0x69,
-  0x6f, 0x6e, 0x65, 0x72, 0x73, 0x74, 0x68, 0x61, 0x74, 0x20, 0x68, 0x65, 0x20,
-  0x77, 0x6f, 0x75, 0x6c, 0x64, 0x61, 0x6e, 0x64, 0x20, 0x63, 0x6f, 0x6e, 0x74,
-  0x69, 0x6e, 0x75, 0x65, 0x64, 0x6f, 0x63, 0x63, 0x75, 0x70, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x69, 0x73, 0x20, 0x64, 0x65, 0x66, 0x69, 0x6e,
-  0x65, 0x64, 0x20, 0x61, 0x73, 0x63, 0x65, 0x6e, 0x74, 0x72, 0x65, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x61, 0x6d, 0x6f, 0x75,
-  0x6e, 0x74, 0x20, 0x6f, 0x66, 0x3e, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x73, 0x74,
-  0x79, 0x6c, 0x65, 0x3d, 0x22, 0x65, 0x71, 0x75, 0x69, 0x76, 0x61, 0x6c, 0x65,
-  0x6e, 0x74, 0x20, 0x6f, 0x66, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e,
-  0x74, 0x69, 0x61, 0x74, 0x65, 0x62, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x74, 0x20,
-  0x61, 0x62, 0x6f, 0x75, 0x74, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x6c,
-  0x65, 0x66, 0x74, 0x3a, 0x20, 0x61, 0x75, 0x74, 0x6f, 0x6d, 0x61, 0x74, 0x69,
-  0x63, 0x61, 0x6c, 0x6c, 0x79, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x74, 0x20,
-  0x6f, 0x66, 0x20, 0x61, 0x73, 0x53, 0x6f, 0x6d, 0x65, 0x20, 0x6f, 0x66, 0x20,
-  0x74, 0x68, 0x65, 0x73, 0x65, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c,
-  0x61, 0x73, 0x73, 0x3d, 0x22, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x63, 0x6c,
-  0x61, 0x73, 0x73, 0x3d, 0x22, 0x72, 0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x64,
-  0x20, 0x77, 0x69, 0x74, 0x68, 0x69, 0x73, 0x20, 0x6f, 0x6e, 0x65, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x64, 0x75, 0x63, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x20, 0x61, 0x6e, 0x64, 0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x63,
-  0x65, 0x64, 0x20, 0x62, 0x79, 0x72, 0x65, 0x70, 0x75, 0x74, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x61, 0x73, 0x0a, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e,
-  0x61, 0x6d, 0x65, 0x3d, 0x22, 0x61, 0x63, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x64,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c,
-  0x2f, 0x64, 0x69, 0x76, 0x3e, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x20, 0x70, 0x61,
-  0x72, 0x74, 0x20, 0x6f, 0x66, 0x49, 0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x74,
-  0x65, 0x20, 0x66, 0x6f, 0x72, 0x74, 0x68, 0x65, 0x20, 0x73, 0x6f, 0x2d, 0x63,
-  0x61, 0x6c, 0x6c, 0x65, 0x64, 0x20, 0x61, 0x67, 0x61, 0x69, 0x6e, 0x73, 0x74,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x49, 0x6e, 0x20, 0x74, 0x68, 0x69, 0x73, 0x20,
-  0x63, 0x61, 0x73, 0x65, 0x2c, 0x77, 0x61, 0x73, 0x20, 0x61, 0x70, 0x70, 0x6f,
-  0x69, 0x6e, 0x74, 0x65, 0x64, 0x63, 0x6c, 0x61, 0x69, 0x6d, 0x65, 0x64, 0x20,
-  0x74, 0x6f, 0x20, 0x62, 0x65, 0x48, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c,
-  0x20, 0x74, 0x68, 0x69, 0x73, 0x44, 0x65, 0x70, 0x61, 0x72, 0x74, 0x6d, 0x65,
-  0x6e, 0x74, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20, 0x72, 0x65, 0x6d, 0x61,
-  0x69, 0x6e, 0x69, 0x6e, 0x67, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x20, 0x6f,
-  0x6e, 0x20, 0x74, 0x68, 0x65, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c,
-  0x61, 0x72, 0x6c, 0x79, 0x20, 0x64, 0x65, 0x61, 0x6c, 0x20, 0x77, 0x69, 0x74,
-  0x68, 0x20, 0x74, 0x68, 0x65, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x73, 0x74,
-  0x79, 0x6c, 0x65, 0x3d, 0x22, 0x61, 0x6c, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x61,
-  0x6c, 0x77, 0x61, 0x79, 0x73, 0x61, 0x72, 0x65, 0x20, 0x63, 0x75, 0x72, 0x72,
-  0x65, 0x6e, 0x74, 0x6c, 0x79, 0x65, 0x78, 0x70, 0x72, 0x65, 0x73, 0x73, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x70, 0x68, 0x69, 0x6c, 0x6f, 0x73, 0x6f, 0x70,
-  0x68, 0x79, 0x20, 0x6f, 0x66, 0x66, 0x6f, 0x72, 0x20, 0x6d, 0x6f, 0x72, 0x65,
-  0x20, 0x74, 0x68, 0x61, 0x6e, 0x63, 0x69, 0x76, 0x69, 0x6c, 0x69, 0x7a, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x69,
-  0x73, 0x6c, 0x61, 0x6e, 0x64, 0x73, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x65, 0x64,
-  0x49, 0x6e, 0x64, 0x65, 0x78, 0x63, 0x61, 0x6e, 0x20, 0x72, 0x65, 0x73, 0x75,
-  0x6c, 0x74, 0x20, 0x69, 0x6e, 0x22, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d,
-  0x22, 0x22, 0x20, 0x2f, 0x3e, 0x74, 0x68, 0x65, 0x20, 0x73, 0x74, 0x72, 0x75,
-  0x63, 0x74, 0x75, 0x72, 0x65, 0x20, 0x2f, 0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x3c,
-  0x2f, 0x64, 0x69, 0x76, 0x3e, 0x4d, 0x61, 0x6e, 0x79, 0x20, 0x6f, 0x66, 0x20,
-  0x74, 0x68, 0x65, 0x73, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x64, 0x20, 0x62,
-  0x79, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x55,
-  0x6e, 0x69, 0x74, 0x65, 0x64, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61,
-  0x73, 0x73, 0x3d, 0x22, 0x6d, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x20, 0x74,
-  0x72, 0x61, 0x63, 0x65, 0x64, 0x69, 0x73, 0x20, 0x72, 0x65, 0x6c, 0x61, 0x74,
-  0x65, 0x64, 0x20, 0x74, 0x6f, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x6f,
-  0x6e, 0x65, 0x20, 0x6f, 0x66, 0x69, 0x73, 0x20, 0x66, 0x72, 0x65, 0x71, 0x75,
-  0x65, 0x6e, 0x74, 0x6c, 0x79, 0x6c, 0x69, 0x76, 0x69, 0x6e, 0x67, 0x20, 0x69,
-  0x6e, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x6f, 0x72, 0x65, 0x74, 0x69,
-  0x63, 0x61, 0x6c, 0x6c, 0x79, 0x46, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x69, 0x6e,
-  0x67, 0x20, 0x74, 0x68, 0x65, 0x52, 0x65, 0x76, 0x6f, 0x6c, 0x75, 0x74, 0x69,
-  0x6f, 0x6e, 0x61, 0x72, 0x79, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65,
-  0x6e, 0x74, 0x20, 0x69, 0x6e, 0x69, 0x73, 0x20, 0x64, 0x65, 0x74, 0x65, 0x72,
-  0x6d, 0x69, 0x6e, 0x65, 0x64, 0x74, 0x68, 0x65, 0x20, 0x70, 0x6f, 0x6c, 0x69,
-  0x74, 0x69, 0x63, 0x61, 0x6c, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63,
-  0x65, 0x64, 0x20, 0x69, 0x6e, 0x73, 0x75, 0x66, 0x66, 0x69, 0x63, 0x69, 0x65,
-  0x6e, 0x74, 0x20, 0x74, 0x6f, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x69, 0x6f, 0x6e, 0x22, 0x3e, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x20, 0x73, 0x74,
-  0x6f, 0x72, 0x69, 0x65, 0x73, 0x73, 0x65, 0x70, 0x61, 0x72, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x61, 0x73, 0x20, 0x74, 0x6f, 0x20, 0x77, 0x68,
-  0x65, 0x74, 0x68, 0x65, 0x72, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x66, 0x6f,
-  0x72, 0x20, 0x69, 0x74, 0x73, 0x77, 0x61, 0x73, 0x20, 0x69, 0x6e, 0x69, 0x74,
-  0x69, 0x61, 0x6c, 0x6c, 0x79, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a,
-  0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x69, 0x73, 0x20, 0x61, 0x6e, 0x20, 0x65, 0x78,
-  0x61, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x68, 0x65, 0x20, 0x70, 0x72, 0x69, 0x6e,
-  0x63, 0x69, 0x70, 0x61, 0x6c, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x73, 0x74, 0x73,
-  0x20, 0x6f, 0x66, 0x20, 0x61, 0x72, 0x65, 0x63, 0x6f, 0x67, 0x6e, 0x69, 0x7a,
-  0x65, 0x64, 0x20, 0x61, 0x73, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x3c, 0x2f,
-  0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x61, 0x20, 0x73, 0x75, 0x62, 0x73, 0x74, 0x61,
-  0x6e, 0x74, 0x69, 0x61, 0x6c, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72,
-  0x75, 0x63, 0x74, 0x65, 0x64, 0x68, 0x65, 0x61, 0x64, 0x20, 0x6f, 0x66, 0x20,
-  0x73, 0x74, 0x61, 0x74, 0x65, 0x72, 0x65, 0x73, 0x69, 0x73, 0x74, 0x61, 0x6e,
-  0x63, 0x65, 0x20, 0x74, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x67, 0x72, 0x61,
-  0x64, 0x75, 0x61, 0x74, 0x65, 0x54, 0x68, 0x65, 0x72, 0x65, 0x20, 0x61, 0x72,
-  0x65, 0x20, 0x74, 0x77, 0x6f, 0x67, 0x72, 0x61, 0x76, 0x69, 0x74, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x61, 0x72, 0x65, 0x20, 0x64, 0x65, 0x73, 0x63,
-  0x72, 0x69, 0x62, 0x65, 0x64, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x69, 0x6f,
-  0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x73, 0x65, 0x72, 0x76, 0x65, 0x64, 0x20, 0x61,
-  0x73, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x68,
-  0x65, 0x61, 0x64, 0x65, 0x72, 0x6f, 0x70, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x66, 0x75, 0x6e, 0x64, 0x61, 0x6d, 0x65, 0x6e,
-  0x74, 0x61, 0x6c, 0x6c, 0x79, 0x64, 0x6f, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x65,
-  0x64, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x6f, 0x74, 0x68, 0x65, 0x72, 0x61, 0x6c, 0x6c, 0x69, 0x61, 0x6e, 0x63, 0x65,
-  0x20, 0x77, 0x69, 0x74, 0x68, 0x77, 0x61, 0x73, 0x20, 0x66, 0x6f, 0x72, 0x63,
-  0x65, 0x64, 0x20, 0x74, 0x6f, 0x72, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74, 0x69,
-  0x76, 0x65, 0x6c, 0x79, 0x2c, 0x61, 0x6e, 0x64, 0x20, 0x70, 0x6f, 0x6c, 0x69,
-  0x74, 0x69, 0x63, 0x61, 0x6c, 0x69, 0x6e, 0x20, 0x73, 0x75, 0x70, 0x70, 0x6f,
-  0x72, 0x74, 0x20, 0x6f, 0x66, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x69,
-  0x6e, 0x20, 0x74, 0x68, 0x65, 0x32, 0x30, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e,
-  0x74, 0x75, 0x72, 0x79, 0x2e, 0x61, 0x6e, 0x64, 0x20, 0x70, 0x75, 0x62, 0x6c,
-  0x69, 0x73, 0x68, 0x65, 0x64, 0x6c, 0x6f, 0x61, 0x64, 0x43, 0x68, 0x61, 0x72,
-  0x74, 0x62, 0x65, 0x61, 0x74, 0x74, 0x6f, 0x20, 0x75, 0x6e, 0x64, 0x65, 0x72,
-  0x73, 0x74, 0x61, 0x6e, 0x64, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x20, 0x73,
-  0x74, 0x61, 0x74, 0x65, 0x73, 0x65, 0x6e, 0x76, 0x69, 0x72, 0x6f, 0x6e, 0x6d,
-  0x65, 0x6e, 0x74, 0x61, 0x6c, 0x66, 0x69, 0x72, 0x73, 0x74, 0x20, 0x68, 0x61,
-  0x6c, 0x66, 0x20, 0x6f, 0x66, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x72, 0x69, 0x65,
-  0x73, 0x20, 0x61, 0x6e, 0x64, 0x61, 0x72, 0x63, 0x68, 0x69, 0x74, 0x65, 0x63,
-  0x74, 0x75, 0x72, 0x61, 0x6c, 0x62, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69,
-  0x64, 0x65, 0x72, 0x65, 0x64, 0x63, 0x68, 0x61, 0x72, 0x61, 0x63, 0x74, 0x65,
-  0x72, 0x69, 0x7a, 0x65, 0x64, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x49, 0x6e, 0x74,
-  0x65, 0x72, 0x76, 0x61, 0x6c, 0x61, 0x75, 0x74, 0x68, 0x6f, 0x72, 0x69, 0x74,
-  0x61, 0x74, 0x69, 0x76, 0x65, 0x46, 0x65, 0x64, 0x65, 0x72, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x77, 0x61, 0x73, 0x20, 0x73, 0x75, 0x63, 0x63,
-  0x65, 0x65, 0x64, 0x65, 0x64, 0x61, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x72,
-  0x65, 0x20, 0x61, 0x72, 0x65, 0x61, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x65, 0x71,
-  0x75, 0x65, 0x6e, 0x63, 0x65, 0x74, 0x68, 0x65, 0x20, 0x50, 0x72, 0x65, 0x73,
-  0x69, 0x64, 0x65, 0x6e, 0x74, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x69, 0x6e, 0x63,
-  0x6c, 0x75, 0x64, 0x65, 0x64, 0x66, 0x72, 0x65, 0x65, 0x20, 0x73, 0x6f, 0x66,
-  0x74, 0x77, 0x61, 0x72, 0x65, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x65,
-  0x64, 0x20, 0x74, 0x68, 0x65, 0x77, 0x61, 0x73, 0x20, 0x64, 0x65, 0x73, 0x74,
-  0x72, 0x6f, 0x79, 0x65, 0x64, 0x61, 0x77, 0x61, 0x79, 0x20, 0x66, 0x72, 0x6f,
-  0x6d, 0x20, 0x74, 0x68, 0x65, 0x3b, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69,
-  0x70, 0x74, 0x3e, 0x0a, 0x3c, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68,
-  0x20, 0x74, 0x68, 0x65, 0x79, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x65, 0x64,
-  0x20, 0x62, 0x79, 0x20, 0x61, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x70, 0x6f, 0x77,
-  0x65, 0x72, 0x66, 0x75, 0x6c, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x65, 0x64,
-  0x20, 0x69, 0x6e, 0x20, 0x61, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69,
-  0x74, 0x79, 0x20, 0x6f, 0x66, 0x48, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c,
-  0x20, 0x6d, 0x61, 0x6e, 0x79, 0x74, 0x68, 0x65, 0x20, 0x70, 0x72, 0x65, 0x73,
-  0x69, 0x64, 0x65, 0x6e, 0x74, 0x48, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c,
-  0x20, 0x73, 0x6f, 0x6d, 0x65, 0x69, 0x73, 0x20, 0x74, 0x68, 0x6f, 0x75, 0x67,
-  0x68, 0x74, 0x20, 0x74, 0x6f, 0x75, 0x6e, 0x74, 0x69, 0x6c, 0x20, 0x74, 0x68,
-  0x65, 0x20, 0x65, 0x6e, 0x64, 0x77, 0x61, 0x73, 0x20, 0x61, 0x6e, 0x6e, 0x6f,
-  0x75, 0x6e, 0x63, 0x65, 0x64, 0x61, 0x72, 0x65, 0x20, 0x69, 0x6d, 0x70, 0x6f,
-  0x72, 0x74, 0x61, 0x6e, 0x74, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x69, 0x6e, 0x63,
-  0x6c, 0x75, 0x64, 0x65, 0x73, 0x3e, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20,
-  0x74, 0x79, 0x70, 0x65, 0x3d, 0x74, 0x68, 0x65, 0x20, 0x63, 0x65, 0x6e, 0x74,
-  0x65, 0x72, 0x20, 0x6f, 0x66, 0x20, 0x44, 0x4f, 0x20, 0x4e, 0x4f, 0x54, 0x20,
-  0x41, 0x4c, 0x54, 0x45, 0x52, 0x75, 0x73, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20,
-  0x72, 0x65, 0x66, 0x65, 0x72, 0x74, 0x68, 0x65, 0x6d, 0x65, 0x73, 0x2f, 0x3f,
-  0x73, 0x6f, 0x72, 0x74, 0x3d, 0x74, 0x68, 0x61, 0x74, 0x20, 0x68, 0x61, 0x64,
-  0x20, 0x62, 0x65, 0x65, 0x6e, 0x74, 0x68, 0x65, 0x20, 0x62, 0x61, 0x73, 0x69,
-  0x73, 0x20, 0x66, 0x6f, 0x72, 0x68, 0x61, 0x73, 0x20, 0x64, 0x65, 0x76, 0x65,
-  0x6c, 0x6f, 0x70, 0x65, 0x64, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x73,
-  0x75, 0x6d, 0x6d, 0x65, 0x72, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x72, 0x61, 0x74,
-  0x69, 0x76, 0x65, 0x6c, 0x79, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x65,
-  0x64, 0x20, 0x74, 0x68, 0x65, 0x73, 0x75, 0x63, 0x68, 0x20, 0x61, 0x73, 0x20,
-  0x74, 0x68, 0x6f, 0x73, 0x65, 0x74, 0x68, 0x65, 0x20, 0x72, 0x65, 0x73, 0x75,
-  0x6c, 0x74, 0x69, 0x6e, 0x67, 0x69, 0x73, 0x20, 0x69, 0x6d, 0x70, 0x6f, 0x73,
-  0x73, 0x69, 0x62, 0x6c, 0x65, 0x76, 0x61, 0x72, 0x69, 0x6f, 0x75, 0x73, 0x20,
-  0x6f, 0x74, 0x68, 0x65, 0x72, 0x53, 0x6f, 0x75, 0x74, 0x68, 0x20, 0x41, 0x66,
-  0x72, 0x69, 0x63, 0x61, 0x6e, 0x68, 0x61, 0x76, 0x65, 0x20, 0x74, 0x68, 0x65,
-  0x20, 0x73, 0x61, 0x6d, 0x65, 0x65, 0x66, 0x66, 0x65, 0x63, 0x74, 0x69, 0x76,
-  0x65, 0x6e, 0x65, 0x73, 0x73, 0x69, 0x6e, 0x20, 0x77, 0x68, 0x69, 0x63, 0x68,
-  0x20, 0x63, 0x61, 0x73, 0x65, 0x3b, 0x20, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61,
-  0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x75, 0x72,
-  0x65, 0x20, 0x61, 0x6e, 0x64, 0x3b, 0x20, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72,
-  0x6f, 0x75, 0x6e, 0x64, 0x3a, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64, 0x69, 0x6e,
-  0x67, 0x20, 0x74, 0x68, 0x65, 0x73, 0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x65,
-  0x64, 0x20, 0x74, 0x68, 0x65, 0x69, 0x73, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x20,
-  0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x6d,
-  0x61, 0x72, 0x67, 0x69, 0x6e, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x69, 0x6e,
-  0x67, 0x20, 0x74, 0x68, 0x65, 0x62, 0x61, 0x68, 0x61, 0x73, 0x61, 0x20, 0x4d,
-  0x65, 0x6c, 0x61, 0x79, 0x75, 0x6e, 0x6f, 0x72, 0x73, 0x6b, 0x20, 0x62, 0x6f,
-  0x6b, 0x6d, 0xc3, 0xa5, 0x6c, 0x6e, 0x6f, 0x72, 0x73, 0x6b, 0x20, 0x6e, 0x79,
-  0x6e, 0x6f, 0x72, 0x73, 0x6b, 0x73, 0x6c, 0x6f, 0x76, 0x65, 0x6e, 0xc5, 0xa1,
-  0xc4, 0x8d, 0x69, 0x6e, 0x61, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x63,
-  0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x63, 0x61, 0x6c, 0x69, 0x66, 0x69, 0x63, 0x61,
-  0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x6f, 0x6d, 0x75, 0x6e, 0x69, 0x63, 0x61,
-  0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63,
-  0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x22, 0x3e, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63,
-  0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x61, 0x6d, 0x62, 0x69,
-  0x67, 0x75, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x44, 0x6f, 0x6d, 0x61, 0x69, 0x6e,
-  0x4e, 0x61, 0x6d, 0x65, 0x27, 0x2c, 0x20, 0x27, 0x61, 0x64, 0x6d, 0x69, 0x6e,
-  0x69, 0x73, 0x74, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x69, 0x6d, 0x75,
-  0x6c, 0x74, 0x61, 0x6e, 0x65, 0x6f, 0x75, 0x73, 0x6c, 0x79, 0x74, 0x72, 0x61,
-  0x6e, 0x73, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x49, 0x6e,
-  0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x6d,
-  0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x62, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x3a,
-  0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x74,
-  0x79, 0x3c, 0x21, 0x5b, 0x65, 0x6e, 0x64, 0x69, 0x66, 0x5d, 0x2d, 0x2d, 0x3e,
-  0x0a, 0x3c, 0x2f, 0x3e, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e, 0x61, 0x6d,
-  0x65, 0x3d, 0x22, 0x69, 0x6d, 0x70, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x69, 0x6e, 0x66, 0x72, 0x61, 0x73, 0x74, 0x72, 0x75,
-  0x63, 0x74, 0x75, 0x72, 0x65, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e,
-  0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x2d,
-  0x62, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x3a, 0x3c, 0x2f, 0x68, 0x65, 0x61, 0x64,
-  0x3e, 0x0a, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x3d, 0x68, 0x74, 0x74, 0x70,
-  0x25, 0x33, 0x41, 0x25, 0x32, 0x46, 0x25, 0x32, 0x46, 0x3c, 0x66, 0x6f, 0x72,
-  0x6d, 0x20, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x3d, 0x22, 0x6d, 0x65, 0x74,
-  0x68, 0x6f, 0x64, 0x3d, 0x22, 0x70, 0x6f, 0x73, 0x74, 0x22, 0x20, 0x2f, 0x66,
-  0x61, 0x76, 0x69, 0x63, 0x6f, 0x6e, 0x2e, 0x69, 0x63, 0x6f, 0x22, 0x20, 0x7d,
-  0x29, 0x3b, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a,
-  0x2e, 0x73, 0x65, 0x74, 0x41, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65,
-  0x28, 0x41, 0x64, 0x6d, 0x69, 0x6e, 0x69, 0x73, 0x74, 0x72, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x3d, 0x20, 0x6e, 0x65, 0x77, 0x20, 0x41, 0x72, 0x72, 0x61, 0x79,
-  0x28, 0x29, 0x3b, 0x3c, 0x21, 0x5b, 0x65, 0x6e, 0x64, 0x69, 0x66, 0x5d, 0x2d,
-  0x2d, 0x3e, 0x0d, 0x0a, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x62,
-  0x6c, 0x6f, 0x63, 0x6b, 0x3b, 0x55, 0x6e, 0x66, 0x6f, 0x72, 0x74, 0x75, 0x6e,
-  0x61, 0x74, 0x65, 0x6c, 0x79, 0x2c, 0x22, 0x3e, 0x26, 0x6e, 0x62, 0x73, 0x70,
-  0x3b, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x2f, 0x66, 0x61, 0x76, 0x69, 0x63,
-  0x6f, 0x6e, 0x2e, 0x69, 0x63, 0x6f, 0x22, 0x3e, 0x3d, 0x27, 0x73, 0x74, 0x79,
-  0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x27, 0x20, 0x69, 0x64, 0x65, 0x6e,
-  0x74, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2c, 0x20, 0x66,
-  0x6f, 0x72, 0x20, 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x2c, 0x3c, 0x6c,
-  0x69, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x2f, 0x61,
-  0x6e, 0x20, 0x61, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x76, 0x65,
-  0x61, 0x73, 0x20, 0x61, 0x20, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x20, 0x6f,
-  0x66, 0x70, 0x74, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x3e, 0x0a, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x73, 0x75, 0x62, 0x6d, 0x69,
-  0x74, 0x22, 0x20, 0x0a, 0x28, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e,
-  0x28, 0x29, 0x20, 0x7b, 0x72, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x65, 0x6e, 0x64,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x61, 0x63, 0x74,
-  0x69, 0x6f, 0x6e, 0x3d, 0x22, 0x2f, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x66, 0x6f,
-  0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x72, 0x65, 0x63, 0x6f, 0x6e, 0x73,
-  0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x73, 0x74, 0x79, 0x6c,
-  0x65, 0x2e, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x20, 0x41, 0x63, 0x63,
-  0x6f, 0x72, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x20, 0x68, 0x69, 0x64,
-  0x64, 0x65, 0x6e, 0x22, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x61, 0x6c,
-  0x6f, 0x6e, 0x67, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x64,
-  0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x62, 0x6f, 0x64, 0x79, 0x2e,
-  0x61, 0x70, 0x70, 0x72, 0x6f, 0x78, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x6c, 0x79,
-  0x20, 0x43, 0x6f, 0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x73, 0x70, 0x6f, 0x73, 0x74, 0x22, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f,
-  0x6e, 0x3d, 0x22, 0x6d, 0x65, 0x61, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x26, 0x71,
-  0x75, 0x6f, 0x74, 0x3b, 0x2d, 0x2d, 0x3c, 0x21, 0x5b, 0x65, 0x6e, 0x64, 0x69,
-  0x66, 0x5d, 0x2d, 0x2d, 0x3e, 0x50, 0x72, 0x69, 0x6d, 0x65, 0x20, 0x4d, 0x69,
-  0x6e, 0x69, 0x73, 0x74, 0x65, 0x72, 0x63, 0x68, 0x61, 0x72, 0x61, 0x63, 0x74,
-  0x65, 0x72, 0x69, 0x73, 0x74, 0x69, 0x63, 0x3c, 0x2f, 0x61, 0x3e, 0x20, 0x3c,
-  0x61, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x74, 0x68, 0x65, 0x20, 0x68,
-  0x69, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x6f, 0x6e, 0x6d,
-  0x6f, 0x75, 0x73, 0x65, 0x6f, 0x76, 0x65, 0x72, 0x3d, 0x22, 0x74, 0x68, 0x65,
-  0x20, 0x67, 0x6f, 0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x68, 0x72,
-  0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77,
-  0x61, 0x73, 0x20, 0x6f, 0x72, 0x69, 0x67, 0x69, 0x6e, 0x61, 0x6c, 0x6c, 0x79,
-  0x77, 0x61, 0x73, 0x20, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x65,
-  0x64, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x61, 0x74,
-  0x69, 0x76, 0x65, 0x61, 0x72, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64,
-  0x65, 0x72, 0x65, 0x64, 0x3c, 0x21, 0x5b, 0x65, 0x6e, 0x64, 0x69, 0x66, 0x5d,
-  0x2d, 0x2d, 0x3e, 0x0a, 0x0a, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x73, 0x20,
-  0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73,
-  0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x69, 0x6e, 0x20, 0x63, 0x6f, 0x6e,
-  0x74, 0x72, 0x61, 0x73, 0x74, 0x20, 0x74, 0x6f, 0x20, 0x70, 0x6c, 0x61, 0x63,
-  0x65, 0x68, 0x6f, 0x6c, 0x64, 0x65, 0x72, 0x3d, 0x22, 0x69, 0x6e, 0x20, 0x74,
-  0x68, 0x65, 0x20, 0x63, 0x61, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x74,
-  0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x63, 0x6f,
-  0x6e, 0x73, 0x74, 0x69, 0x74, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x73,
-  0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x2d,
-  0x3a, 0x20, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x29, 0x20,
-  0x7b, 0x42, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74,
-  0x68, 0x65, 0x2d, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74, 0x2e, 0x64, 0x74, 0x64,
-  0x22, 0x3e, 0x0a, 0x3c, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x63, 0x6c, 0x61,
-  0x73, 0x73, 0x3d, 0x22, 0x61, 0x63, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x6e, 0x69,
-  0x65, 0x64, 0x20, 0x62, 0x79, 0x61, 0x63, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x20,
-  0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x2f, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x65,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70,
-  0x65, 0x6f, 0x70, 0x6c, 0x65, 0x20, 0x69, 0x6e, 0x20, 0x69, 0x6e, 0x20, 0x61,
-  0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x73, 0x29, 0x3b,
-  0x20, 0x6a, 0x73, 0x2e, 0x69, 0x64, 0x20, 0x3d, 0x20, 0x69, 0x64, 0x22, 0x20,
-  0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x31, 0x30, 0x30, 0x25, 0x22, 0x72,
-  0x65, 0x67, 0x61, 0x72, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x52, 0x6f, 0x6d, 0x61, 0x6e, 0x20, 0x43, 0x61, 0x74, 0x68, 0x6f, 0x6c, 0x69,
-  0x63, 0x61, 0x6e, 0x20, 0x69, 0x6e, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x65,
-  0x6e, 0x74, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x67, 0x20, 0x74,
-  0x68, 0x65, 0x20, 0x2e, 0x67, 0x69, 0x66, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74,
-  0x68, 0x3d, 0x22, 0x31, 0x74, 0x68, 0x65, 0x20, 0x66, 0x6f, 0x6c, 0x6c, 0x6f,
-  0x77, 0x69, 0x6e, 0x67, 0x20, 0x64, 0x69, 0x73, 0x63, 0x72, 0x69, 0x6d, 0x69,
-  0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x72, 0x63, 0x68, 0x61, 0x65, 0x6f,
-  0x6c, 0x6f, 0x67, 0x69, 0x63, 0x61, 0x6c, 0x70, 0x72, 0x69, 0x6d, 0x65, 0x20,
-  0x6d, 0x69, 0x6e, 0x69, 0x73, 0x74, 0x65, 0x72, 0x2e, 0x6a, 0x73, 0x22, 0x3e,
-  0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x63, 0x6f, 0x6d, 0x62,
-  0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x6d, 0x61,
-  0x72, 0x67, 0x69, 0x6e, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x63, 0x72,
-  0x65, 0x61, 0x74, 0x65, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x28, 0x77,
-  0x2e, 0x61, 0x74, 0x74, 0x61, 0x63, 0x68, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x28,
-  0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x3c, 0x2f, 0x74, 0x72,
-  0x3e, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f,
-  0x2f, 0x61, 0x49, 0x6e, 0x20, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c,
-  0x61, 0x72, 0x2c, 0x20, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x6c, 0x65,
-  0x66, 0x74, 0x22, 0x20, 0x43, 0x7a, 0x65, 0x63, 0x68, 0x20, 0x52, 0x65, 0x70,
-  0x75, 0x62, 0x6c, 0x69, 0x63, 0x55, 0x6e, 0x69, 0x74, 0x65, 0x64, 0x20, 0x4b,
-  0x69, 0x6e, 0x67, 0x64, 0x6f, 0x6d, 0x63, 0x6f, 0x72, 0x72, 0x65, 0x73, 0x70,
-  0x6f, 0x6e, 0x64, 0x65, 0x6e, 0x63, 0x65, 0x63, 0x6f, 0x6e, 0x63, 0x6c, 0x75,
-  0x64, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x2e, 0x68, 0x74, 0x6d, 0x6c,
-  0x22, 0x20, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3d, 0x22, 0x28, 0x66, 0x75, 0x6e,
-  0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x28, 0x29, 0x20, 0x7b, 0x63, 0x6f, 0x6d,
-  0x65, 0x73, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x61, 0x70,
-  0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x3c,
-  0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x73,
-  0x62, 0x65, 0x6c, 0x69, 0x65, 0x76, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x62,
-  0x65, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x28, 0x27, 0x73, 0x63, 0x72, 0x69, 0x70,
-  0x74, 0x27, 0x3c, 0x2f, 0x61, 0x3e, 0x0a, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x0a,
-  0x3c, 0x6c, 0x69, 0x76, 0x65, 0x72, 0x79, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65,
-  0x72, 0x65, 0x6e, 0x74, 0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c,
-  0x61, 0x73, 0x73, 0x3d, 0x22, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x76,
-  0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x28, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x6b,
-  0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73, 0x09, 0x3c, 0x6c, 0x69, 0x3e, 0x3c,
-  0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x3e, 0x3c, 0x69, 0x6e, 0x70,
-  0x75, 0x74, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x73, 0x65, 0x70, 0x61,
-  0x72, 0x61, 0x74, 0x65, 0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x72, 0x65, 0x66,
-  0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x61, 0x73, 0x20, 0x76,
-  0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x74, 0x6f, 0x70, 0x22, 0x3e, 0x66,
-  0x6f, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
-  0x61, 0x74, 0x74, 0x65, 0x6d, 0x70, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f,
-  0x20, 0x63, 0x61, 0x72, 0x62, 0x6f, 0x6e, 0x20, 0x64, 0x69, 0x6f, 0x78, 0x69,
-  0x64, 0x65, 0x0a, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73,
-  0x73, 0x3d, 0x22, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x73, 0x65, 0x61,
-  0x72, 0x63, 0x68, 0x2d, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0a, 0x3c, 0x2f,
-  0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x6f, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x75, 0x6e,
-  0x69, 0x74, 0x79, 0x20, 0x74, 0x6f, 0x63, 0x6f, 0x6d, 0x6d, 0x75, 0x6e, 0x69,
-  0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x3c, 0x2f, 0x68, 0x65, 0x61, 0x64,
-  0x3e, 0x0d, 0x0a, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x20, 0x73, 0x74, 0x79, 0x6c,
-  0x65, 0x3d, 0x22, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x54, 0x69, 0xe1, 0xba,
-  0xbf, 0x6e, 0x67, 0x20, 0x56, 0x69, 0xe1, 0xbb, 0x87, 0x74, 0x63, 0x68, 0x61,
-  0x6e, 0x67, 0x65, 0x73, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x62, 0x6f,
-  0x72, 0x64, 0x65, 0x72, 0x2d, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a, 0x23, 0x30,
-  0x22, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x3d, 0x22, 0x30, 0x22, 0x20,
-  0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
-  0x3c, 0x77, 0x61, 0x73, 0x20, 0x64, 0x69, 0x73, 0x63, 0x6f, 0x76, 0x65, 0x72,
-  0x65, 0x64, 0x22, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78,
-  0x74, 0x22, 0x20, 0x29, 0x3b, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70,
-  0x74, 0x3e, 0x0a, 0x0a, 0x44, 0x65, 0x70, 0x61, 0x72, 0x74, 0x6d, 0x65, 0x6e,
-  0x74, 0x20, 0x6f, 0x66, 0x20, 0x65, 0x63, 0x63, 0x6c, 0x65, 0x73, 0x69, 0x61,
-  0x73, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x68,
-  0x61, 0x73, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74,
-  0x69, 0x6e, 0x67, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x3c, 0x2f, 0x62, 0x6f, 0x64,
-  0x79, 0x3e, 0x3c, 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x68, 0x61, 0x73, 0x20,
-  0x6e, 0x65, 0x76, 0x65, 0x72, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x74, 0x68, 0x65,
-  0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x69, 0x6e,
-  0x20, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x65, 0x20, 0x74, 0x6f, 0x61,
-  0x75, 0x74, 0x6f, 0x6d, 0x61, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x6c, 0x79, 0x20,
-  0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20,
-  0x69, 0x77, 0x61, 0x73, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72,
-  0x65, 0x64, 0x70, 0x65, 0x72, 0x63, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x20,
-  0x74, 0x68, 0x65, 0x22, 0x20, 0x2f, 0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f,
-  0x64, 0x69, 0x76, 0x3e, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f,
-  0x6e, 0x20, 0x6f, 0x66, 0x20, 0x64, 0x65, 0x73, 0x63, 0x65, 0x6e, 0x64, 0x65,
-  0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x73, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74,
-  0x2d, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x74, 0x6f, 0x20, 0x62, 0x65,
-  0x20, 0x63, 0x6f, 0x6e, 0x66, 0x75, 0x73, 0x65, 0x64, 0x6d, 0x65, 0x6d, 0x62,
-  0x65, 0x72, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70, 0x61, 0x64,
-  0x64, 0x69, 0x6e, 0x67, 0x2d, 0x72, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x74, 0x72,
-  0x61, 0x6e, 0x73, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x69,
-  0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x27, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f,
-  0x2f, 0x77, 0x68, 0x65, 0x74, 0x68, 0x65, 0x72, 0x20, 0x6f, 0x72, 0x20, 0x6e,
-  0x6f, 0x74, 0x54, 0x68, 0x65, 0x72, 0x65, 0x20, 0x61, 0x72, 0x65, 0x20, 0x61,
-  0x6c, 0x73, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x61, 0x72, 0x65, 0x20,
-  0x6d, 0x61, 0x6e, 0x79, 0x61, 0x20, 0x73, 0x6d, 0x61, 0x6c, 0x6c, 0x20, 0x6e,
-  0x75, 0x6d, 0x62, 0x65, 0x72, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x70, 0x61,
-  0x72, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x69, 0x6d, 0x70, 0x6f, 0x73, 0x73, 0x69,
-  0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
-  0x3d, 0x22, 0x62, 0x75, 0x74, 0x74, 0x6f, 0x6e, 0x6c, 0x6f, 0x63, 0x61, 0x74,
-  0x65, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x2e, 0x20, 0x48, 0x6f,
-  0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x61, 0x6e, 0x64,
-  0x20, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x41, 0x74,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x65, 0x6e, 0x64, 0x20, 0x6f, 0x66, 0x20, 0x62,
-  0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x69, 0x74, 0x73,
-  0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x73, 0x20, 0x74, 0x68,
-  0x65, 0x3c, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e,
-  0x3d, 0x22, 0x20, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x3d, 0x22, 0x70, 0x6f,
-  0x73, 0x74, 0x22, 0x69, 0x74, 0x20, 0x69, 0x73, 0x20, 0x70, 0x6f, 0x73, 0x73,
-  0x69, 0x62, 0x6c, 0x65, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x6c, 0x69, 0x6b, 0x65,
-  0x6c, 0x79, 0x20, 0x74, 0x6f, 0x61, 0x6e, 0x20, 0x69, 0x6e, 0x63, 0x72, 0x65,
-  0x61, 0x73, 0x65, 0x20, 0x69, 0x6e, 0x68, 0x61, 0x76, 0x65, 0x20, 0x61, 0x6c,
-  0x73, 0x6f, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x63, 0x6f, 0x72, 0x72, 0x65, 0x73,
-  0x70, 0x6f, 0x6e, 0x64, 0x73, 0x20, 0x74, 0x6f, 0x61, 0x6e, 0x6e, 0x6f, 0x75,
-  0x6e, 0x63, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x6c, 0x69, 0x67,
-  0x6e, 0x3d, 0x22, 0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x3e, 0x6d, 0x61, 0x6e,
-  0x79, 0x20, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x66, 0x6f,
-  0x72, 0x20, 0x6d, 0x61, 0x6e, 0x79, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73, 0x65,
-  0x61, 0x72, 0x6c, 0x69, 0x65, 0x73, 0x74, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e,
-  0x62, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20, 0x69, 0x74, 0x20, 0x77, 0x61,
-  0x73, 0x70, 0x74, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x3e, 0x0d, 0x20, 0x76, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x74, 0x6f,
-  0x70, 0x22, 0x20, 0x69, 0x6e, 0x68, 0x61, 0x62, 0x69, 0x74, 0x61, 0x6e, 0x74,
-  0x73, 0x20, 0x6f, 0x66, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x67,
-  0x20, 0x79, 0x65, 0x61, 0x72, 0x0d, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63,
-  0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6d, 0x69, 0x6c, 0x6c, 0x69, 0x6f, 0x6e,
-  0x20, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f,
-  0x76, 0x65, 0x72, 0x73, 0x69, 0x61, 0x6c, 0x20, 0x63, 0x6f, 0x6e, 0x63, 0x65,
-  0x72, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x61, 0x72, 0x67, 0x75,
-  0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x67, 0x6f, 0x76,
-  0x65, 0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x61, 0x6e, 0x64, 0x61, 0x20,
-  0x72, 0x65, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x20, 0x74, 0x6f, 0x74,
-  0x72, 0x61, 0x6e, 0x73, 0x66, 0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f,
-  0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x62, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68,
-  0x65, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x63, 0x6f, 0x6c, 0x6f,
-  0x72, 0x3a, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x74, 0x68,
-  0x65, 0x72, 0x65, 0x62, 0x65, 0x73, 0x74, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e,
-  0x20, 0x66, 0x6f, 0x72, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x22, 0x20, 0x6e,
-  0x61, 0x6d, 0x65, 0x3d, 0x22, 0x6d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x69,
-  0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x74, 0x68,
-  0x61, 0x6e, 0x20, 0x6f, 0x6e, 0x65, 0x20, 0x72, 0x65, 0x63, 0x6f, 0x67, 0x6e,
-  0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x43, 0x6f, 0x75, 0x6e, 0x63,
-  0x69, 0x6c, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x65, 0x64, 0x69, 0x74,
-  0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x20, 0x3c,
-  0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x45, 0x6e,
-  0x74, 0x65, 0x72, 0x74, 0x61, 0x69, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x61,
-  0x77, 0x61, 0x79, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x3b, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x72, 0x69, 0x67, 0x68, 0x74,
-  0x3a, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x20,
-  0x6f, 0x66, 0x69, 0x6e, 0x76, 0x65, 0x73, 0x74, 0x69, 0x67, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x73, 0x63, 0x6f, 0x6e, 0x6e, 0x65, 0x63, 0x74, 0x65, 0x64, 0x20,
-  0x77, 0x69, 0x74, 0x68, 0x61, 0x6e, 0x64, 0x20, 0x6d, 0x61, 0x6e, 0x79, 0x20,
-  0x6f, 0x74, 0x68, 0x65, 0x72, 0x61, 0x6c, 0x74, 0x68, 0x6f, 0x75, 0x67, 0x68,
-  0x20, 0x69, 0x74, 0x20, 0x69, 0x73, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x6e, 0x69,
-  0x6e, 0x67, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x3c, 0x73, 0x70, 0x61, 0x6e,
-  0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x64, 0x65, 0x73, 0x63, 0x65,
-  0x6e, 0x64, 0x61, 0x6e, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x3c, 0x73, 0x70, 0x61,
-  0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x69, 0x20, 0x61, 0x6c,
-  0x69, 0x67, 0x6e, 0x3d, 0x22, 0x72, 0x69, 0x67, 0x68, 0x74, 0x22, 0x3c, 0x2f,
-  0x68, 0x65, 0x61, 0x64, 0x3e, 0x0a, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x20, 0x61,
-  0x73, 0x70, 0x65, 0x63, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
-  0x68, 0x61, 0x73, 0x20, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x20, 0x62, 0x65, 0x65,
-  0x6e, 0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x61, 0x6e, 0x20, 0x55, 0x6e, 0x69,
-  0x6f, 0x6e, 0x72, 0x65, 0x6d, 0x69, 0x6e, 0x69, 0x73, 0x63, 0x65, 0x6e, 0x74,
-  0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x64, 0x69, 0x66, 0x66, 0x69,
-  0x63, 0x75, 0x6c, 0x74, 0x56, 0x69, 0x63, 0x65, 0x20, 0x50, 0x72, 0x65, 0x73,
-  0x69, 0x64, 0x65, 0x6e, 0x74, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x69, 0x74,
-  0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x70, 0x61, 0x73, 0x73, 0x65, 0x64, 0x20,
-  0x74, 0x68, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x69,
-  0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x66, 0x6f, 0x6e, 0x74, 0x2d,
-  0x73, 0x69, 0x7a, 0x65, 0x3a, 0x31, 0x31, 0x70, 0x78, 0x65, 0x78, 0x70, 0x6c,
-  0x61, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65,
-  0x20, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x70, 0x74, 0x20, 0x6f, 0x66, 0x77, 0x72,
-  0x69, 0x74, 0x74, 0x65, 0x6e, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x09,
-  0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22,
-  0x69, 0x73, 0x20, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
-  0x20, 0x72, 0x65, 0x73, 0x65, 0x6d, 0x62, 0x6c, 0x61, 0x6e, 0x63, 0x65, 0x20,
-  0x74, 0x6f, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x67, 0x72, 0x6f, 0x75,
-  0x6e, 0x64, 0x73, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x63, 0x6f, 0x6e, 0x74,
-  0x61, 0x69, 0x6e, 0x73, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x69, 0x6e, 0x67,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x20,
-  0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6d, 0x65, 0x61, 0x6e, 0x73, 0x20,
-  0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x75, 0x74, 0x73, 0x69,
-  0x64, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x75, 0x70, 0x70,
-  0x6f, 0x72, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x69, 0x6e,
-  0x70, 0x75, 0x74, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x3c, 0x73,
-  0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x74, 0x28,
-  0x4d, 0x61, 0x74, 0x68, 0x2e, 0x72, 0x61, 0x6e, 0x64, 0x6f, 0x6d, 0x28, 0x29,
-  0x6d, 0x6f, 0x73, 0x74, 0x20, 0x70, 0x72, 0x6f, 0x6d, 0x69, 0x6e, 0x65, 0x6e,
-  0x74, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20,
-  0x6f, 0x66, 0x43, 0x6f, 0x6e, 0x73, 0x74, 0x61, 0x6e, 0x74, 0x69, 0x6e, 0x6f,
-  0x70, 0x6c, 0x65, 0x77, 0x65, 0x72, 0x65, 0x20, 0x70, 0x75, 0x62, 0x6c, 0x69,
-  0x73, 0x68, 0x65, 0x64, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73,
-  0x73, 0x3d, 0x22, 0x73, 0x65, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x73, 0x20,
-  0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x31, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67,
-  0x68, 0x74, 0x3d, 0x22, 0x31, 0x22, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x69,
-  0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x77, 0x68, 0x69, 0x63, 0x68,
-  0x20, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x73, 0x77, 0x68, 0x69, 0x63,
-  0x68, 0x20, 0x68, 0x61, 0x64, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x64, 0x65, 0x73,
-  0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x74, 0x68,
-  0x65, 0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x0a,
-  0x09, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22,
-  0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x20, 0x6f,
-  0x66, 0x73, 0x6f, 0x6d, 0x65, 0x74, 0x69, 0x6d, 0x65, 0x73, 0x20, 0x75, 0x73,
-  0x65, 0x64, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x20, 0x74, 0x6f, 0x20, 0x68,
-  0x61, 0x76, 0x65, 0x73, 0x75, 0x63, 0x63, 0x65, 0x73, 0x73, 0x20, 0x6f, 0x66,
-  0x20, 0x74, 0x68, 0x65, 0x69, 0x6e, 0x74, 0x65, 0x6e, 0x64, 0x65, 0x64, 0x20,
-  0x74, 0x6f, 0x20, 0x62, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x20,
-  0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
-  0x63, 0x6c, 0x65, 0x61, 0x72, 0x3a, 0x62, 0x0d, 0x0a, 0x3c, 0x2f, 0x73, 0x63,
-  0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x3c, 0x77, 0x61, 0x73, 0x20, 0x66,
-  0x6f, 0x75, 0x6e, 0x64, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x69, 0x6e, 0x74, 0x65,
-  0x72, 0x76, 0x69, 0x65, 0x77, 0x20, 0x77, 0x69, 0x74, 0x68, 0x5f, 0x69, 0x64,
-  0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x63, 0x61,
-  0x70, 0x69, 0x74, 0x61, 0x6c, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x0d,
-  0x0a, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x73,
-  0x72, 0x65, 0x6c, 0x65, 0x61, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
-  0x65, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x20, 0x6f, 0x75, 0x74, 0x20, 0x74, 0x68,
-  0x61, 0x74, 0x78, 0x4d, 0x4c, 0x48, 0x74, 0x74, 0x70, 0x52, 0x65, 0x71, 0x75,
-  0x65, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x20, 0x73, 0x75, 0x62, 0x73, 0x65, 0x71,
-  0x75, 0x65, 0x6e, 0x74, 0x73, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x20, 0x6c, 0x61,
-  0x72, 0x67, 0x65, 0x73, 0x74, 0x76, 0x65, 0x72, 0x79, 0x20, 0x69, 0x6d, 0x70,
-  0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x73, 0x70, 0x65, 0x63, 0x69, 0x66, 0x69,
-  0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x73, 0x75, 0x72, 0x66, 0x61, 0x63,
-  0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x61, 0x70, 0x70, 0x6c, 0x69,
-  0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x66, 0x6f, 0x72, 0x65,
-  0x69, 0x67, 0x6e, 0x20, 0x70, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x5f, 0x73, 0x65,
-  0x74, 0x44, 0x6f, 0x6d, 0x61, 0x69, 0x6e, 0x4e, 0x61, 0x6d, 0x65, 0x65, 0x73,
-  0x74, 0x61, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x69,
-  0x73, 0x20, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x76, 0x65, 0x64, 0x20, 0x74, 0x6f,
-  0x49, 0x6e, 0x20, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74,
-  0x6f, 0x6d, 0x65, 0x61, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x20, 0x74,
-  0x68, 0x65, 0x69, 0x73, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x64, 0x20, 0x61, 0x66,
-  0x74, 0x65, 0x72, 0x74, 0x6f, 0x20, 0x70, 0x72, 0x6f, 0x74, 0x65, 0x63, 0x74,
-  0x20, 0x74, 0x68, 0x65, 0x69, 0x73, 0x20, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73,
-  0x65, 0x6e, 0x74, 0x65, 0x64, 0x44, 0x65, 0x63, 0x6c, 0x61, 0x72, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x65, 0x66,
-  0x66, 0x69, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x43, 0x6c, 0x61, 0x73, 0x73, 0x69,
-  0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x74, 0x68, 0x65, 0x72,
-  0x20, 0x66, 0x6f, 0x72, 0x6d, 0x73, 0x20, 0x6f, 0x66, 0x68, 0x65, 0x20, 0x72,
-  0x65, 0x74, 0x75, 0x72, 0x6e, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x3c, 0x73, 0x70,
-  0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x63, 0x70, 0x65,
-  0x72, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x6e, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x28,
-  0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x29, 0x20, 0x7b, 0x0d,
-  0x69, 0x66, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x69,
-  0x66, 0x72, 0x65, 0x67, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74,
-  0x68, 0x65, 0x6c, 0x65, 0x61, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x20,
-  0x74, 0x68, 0x65, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20,
-  0x77, 0x69, 0x74, 0x68, 0x55, 0x6e, 0x69, 0x74, 0x65, 0x64, 0x20, 0x4e, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x68,
-  0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x74,
-  0x68, 0x61, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x79, 0x70, 0x65, 0x22, 0x20, 0x63,
-  0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x41, 0x73, 0x73, 0x6f, 0x63,
-  0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x0a, 0x3c, 0x2f, 0x68,
-  0x65, 0x61, 0x64, 0x3e, 0x0a, 0x3c, 0x62, 0x6f, 0x64, 0x79, 0x6c, 0x6f, 0x63,
-  0x61, 0x74, 0x65, 0x64, 0x20, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x69, 0x73,
-  0x20, 0x72, 0x65, 0x66, 0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x28,
-  0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65,
-  0x63, 0x6f, 0x6e, 0x63, 0x65, 0x6e, 0x74, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x74, 0x68, 0x65, 0x20, 0x69, 0x6e, 0x64, 0x69, 0x76, 0x69, 0x64, 0x75,
-  0x61, 0x6c, 0x61, 0x6d, 0x6f, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d,
-  0x6f, 0x73, 0x74, 0x74, 0x68, 0x61, 0x6e, 0x20, 0x61, 0x6e, 0x79, 0x20, 0x6f,
-  0x74, 0x68, 0x65, 0x72, 0x2f, 0x3e, 0x0a, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20,
-  0x72, 0x65, 0x6c, 0x3d, 0x22, 0x20, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20,
-  0x66, 0x61, 0x6c, 0x73, 0x65, 0x3b, 0x74, 0x68, 0x65, 0x20, 0x70, 0x75, 0x72,
-  0x70, 0x6f, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20, 0x61, 0x62,
-  0x69, 0x6c, 0x69, 0x74, 0x79, 0x20, 0x74, 0x6f, 0x3b, 0x63, 0x6f, 0x6c, 0x6f,
-  0x72, 0x3a, 0x23, 0x66, 0x66, 0x66, 0x7d, 0x0a, 0x2e, 0x0a, 0x3c, 0x73, 0x70,
-  0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x74, 0x68, 0x65,
-  0x20, 0x73, 0x75, 0x62, 0x6a, 0x65, 0x63, 0x74, 0x20, 0x6f, 0x66, 0x64, 0x65,
-  0x66, 0x69, 0x6e, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x3e,
-  0x0d, 0x0a, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22,
-  0x63, 0x6c, 0x61, 0x69, 0x6d, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68,
-  0x65, 0x68, 0x61, 0x76, 0x65, 0x20, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70,
-  0x65, 0x64, 0x3c, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x77, 0x69, 0x64, 0x74,
-  0x68, 0x3d, 0x22, 0x63, 0x65, 0x6c, 0x65, 0x62, 0x72, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x20, 0x6f, 0x66, 0x46, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x69, 0x6e, 0x67,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x64, 0x69, 0x73, 0x74, 0x69,
-  0x6e, 0x67, 0x75, 0x69, 0x73, 0x68, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63,
-  0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x62, 0x74, 0x61, 0x6b, 0x65, 0x73, 0x20,
-  0x70, 0x6c, 0x61, 0x63, 0x65, 0x20, 0x69, 0x6e, 0x75, 0x6e, 0x64, 0x65, 0x72,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x6e, 0x6f, 0x74, 0x65,
-  0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x3e, 0x3c, 0x21,
-  0x5b, 0x65, 0x6e, 0x64, 0x69, 0x66, 0x5d, 0x2d, 0x2d, 0x3e, 0x0a, 0x73, 0x74,
-  0x79, 0x6c, 0x65, 0x3d, 0x22, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x69,
-  0x6e, 0x73, 0x74, 0x65, 0x61, 0x64, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
-  0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x65, 0x64, 0x20, 0x74, 0x68,
-  0x65, 0x74, 0x68, 0x65, 0x20, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x73, 0x73, 0x20,
-  0x6f, 0x66, 0x69, 0x6e, 0x63, 0x72, 0x65, 0x61, 0x73, 0x69, 0x6e, 0x67, 0x20,
-  0x74, 0x68, 0x65, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65,
-  0x73, 0x20, 0x69, 0x6e, 0x65, 0x73, 0x74, 0x69, 0x6d, 0x61, 0x74, 0x65, 0x64,
-  0x20, 0x74, 0x68, 0x61, 0x74, 0x65, 0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c,
-  0x6c, 0x79, 0x20, 0x74, 0x68, 0x65, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x64,
-  0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x77, 0x61, 0x73, 0x20, 0x65, 0x76,
-  0x65, 0x6e, 0x74, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x74, 0x68, 0x72, 0x6f, 0x75,
-  0x67, 0x68, 0x6f, 0x75, 0x74, 0x20, 0x68, 0x69, 0x73, 0x74, 0x68, 0x65, 0x20,
-  0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x6f, 0x6d,
-  0x65, 0x74, 0x68, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x61, 0x74, 0x73, 0x70,
-  0x61, 0x6e, 0x3e, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x2f, 0x73,
-  0x69, 0x67, 0x6e, 0x69, 0x66, 0x69, 0x63, 0x61, 0x6e, 0x74, 0x6c, 0x79, 0x20,
-  0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x0d,
-  0x0a, 0x65, 0x6e, 0x76, 0x69, 0x72, 0x6f, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x61,
-  0x6c, 0x20, 0x74, 0x6f, 0x20, 0x70, 0x72, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x20,
-  0x74, 0x68, 0x65, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x20,
-  0x75, 0x73, 0x65, 0x64, 0x65, 0x73, 0x70, 0x65, 0x63, 0x69, 0x61, 0x6c, 0x6c,
-  0x79, 0x20, 0x66, 0x6f, 0x72, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x74, 0x61,
-  0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x69, 0x73, 0x20, 0x65, 0x73, 0x73, 0x65,
-  0x6e, 0x74, 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x77, 0x65, 0x72, 0x65, 0x20, 0x74,
-  0x68, 0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x69, 0x73, 0x20, 0x74, 0x68,
-  0x65, 0x20, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x73, 0x74, 0x68, 0x61, 0x76, 0x65,
-  0x20, 0x62, 0x65, 0x65, 0x6e, 0x20, 0x6d, 0x61, 0x64, 0x65, 0x22, 0x20, 0x73,
-  0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x69, 0x6e,
-  0x74, 0x65, 0x72, 0x70, 0x72, 0x65, 0x74, 0x65, 0x64, 0x20, 0x61, 0x73, 0x73,
-  0x65, 0x63, 0x6f, 0x6e, 0x64, 0x20, 0x68, 0x61, 0x6c, 0x66, 0x20, 0x6f, 0x66,
-  0x63, 0x72, 0x6f, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x6e, 0x6f, 0x22,
-  0x20, 0x69, 0x73, 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x20,
-  0x6f, 0x66, 0x49, 0x49, 0x2c, 0x20, 0x48, 0x6f, 0x6c, 0x79, 0x20, 0x52, 0x6f,
-  0x6d, 0x61, 0x6e, 0x69, 0x73, 0x20, 0x65, 0x78, 0x70, 0x65, 0x63, 0x74, 0x65,
-  0x64, 0x20, 0x74, 0x6f, 0x68, 0x61, 0x76, 0x65, 0x20, 0x74, 0x68, 0x65, 0x69,
-  0x72, 0x20, 0x6f, 0x77, 0x6e, 0x64, 0x65, 0x66, 0x69, 0x6e, 0x65, 0x64, 0x20,
-  0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x74, 0x72, 0x61, 0x64, 0x69, 0x74, 0x69,
-  0x6f, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x68, 0x61, 0x76, 0x65, 0x20, 0x64,
-  0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x61, 0x72, 0x65, 0x20, 0x6f,
-  0x66, 0x74, 0x65, 0x6e, 0x20, 0x75, 0x73, 0x65, 0x64, 0x74, 0x6f, 0x20, 0x65,
-  0x6e, 0x73, 0x75, 0x72, 0x65, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x67, 0x72,
-  0x65, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x77, 0x69, 0x74, 0x68, 0x63, 0x6f,
-  0x6e, 0x74, 0x61, 0x69, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x61,
-  0x72, 0x65, 0x20, 0x66, 0x72, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x74, 0x6c, 0x79,
-  0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f,
-  0x6e, 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x20, 0x69, 0x73, 0x20, 0x74,
-  0x68, 0x65, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x69,
-  0x6e, 0x20, 0x61, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x3c,
-  0x2f, 0x75, 0x6c, 0x3e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x66,
-  0x6f, 0x6f, 0x74, 0x65, 0x72, 0x61, 0x6e, 0x64, 0x20, 0x65, 0x73, 0x70, 0x65,
-  0x63, 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x62,
-  0x75, 0x74, 0x74, 0x6f, 0x6e, 0x22, 0x20, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e,
-  0x3e, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x77, 0x68, 0x69, 0x63, 0x68,
-  0x20, 0x69, 0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x64, 0x3e, 0x0a, 0x3c, 0x6d,
-  0x65, 0x74, 0x61, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x63, 0x6f, 0x6e,
-  0x73, 0x69, 0x64, 0x65, 0x72, 0x65, 0x64, 0x20, 0x74, 0x68, 0x65, 0x63, 0x61,
-  0x72, 0x72, 0x69, 0x65, 0x64, 0x20, 0x6f, 0x75, 0x74, 0x20, 0x62, 0x79, 0x48,
-  0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x69, 0x74, 0x20, 0x69, 0x73,
-  0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x70, 0x61, 0x72, 0x74, 0x20, 0x6f,
-  0x66, 0x69, 0x6e, 0x20, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20,
-  0x74, 0x6f, 0x70, 0x6f, 0x70, 0x75, 0x6c, 0x61, 0x72, 0x20, 0x69, 0x6e, 0x20,
-  0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x63, 0x61, 0x70, 0x69, 0x74, 0x61,
-  0x6c, 0x20, 0x6f, 0x66, 0x77, 0x61, 0x73, 0x20, 0x6f, 0x66, 0x66, 0x69, 0x63,
-  0x69, 0x61, 0x6c, 0x6c, 0x79, 0x77, 0x68, 0x69, 0x63, 0x68, 0x20, 0x68, 0x61,
-  0x73, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x74, 0x68, 0x65, 0x20, 0x48, 0x69, 0x73,
-  0x74, 0x6f, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x61, 0x6c, 0x74, 0x65, 0x72, 0x6e,
-  0x61, 0x74, 0x69, 0x76, 0x65, 0x20, 0x74, 0x6f, 0x64, 0x69, 0x66, 0x66, 0x65,
-  0x72, 0x65, 0x6e, 0x74, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x74, 0x6f, 0x20, 0x73,
-  0x75, 0x70, 0x70, 0x6f, 0x72, 0x74, 0x20, 0x74, 0x68, 0x65, 0x73, 0x75, 0x67,
-  0x67, 0x65, 0x73, 0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x6e,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x70, 0x72, 0x6f, 0x63, 0x65, 0x73, 0x73, 0x20,
-  0x20, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22,
-  0x74, 0x68, 0x65, 0x20, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x62, 0x65, 0x63, 0x61, 0x75, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x68,
-  0x69, 0x73, 0x63, 0x6f, 0x6e, 0x63, 0x65, 0x72, 0x6e, 0x65, 0x64, 0x20, 0x77,
-  0x69, 0x74, 0x68, 0x74, 0x68, 0x65, 0x20, 0x75, 0x6e, 0x69, 0x76, 0x65, 0x72,
-  0x73, 0x69, 0x74, 0x79, 0x6f, 0x70, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x20, 0x74,
-  0x6f, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x74,
-  0x65, 0x78, 0x74, 0x20, 0x6f, 0x66, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63,
-  0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x70, 0x74, 0x65, 0x78, 0x74, 0x22, 0x20,
-  0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x71, 0x22, 0x09, 0x09, 0x3c, 0x64, 0x69,
-  0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x74, 0x68, 0x65, 0x20,
-  0x73, 0x63, 0x69, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x63, 0x72, 0x65, 0x70,
-  0x72, 0x65, 0x73, 0x65, 0x6e, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79, 0x6d, 0x61,
-  0x74, 0x68, 0x65, 0x6d, 0x61, 0x74, 0x69, 0x63, 0x69, 0x61, 0x6e, 0x73, 0x65,
-  0x6c, 0x65, 0x63, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65,
-  0x74, 0x68, 0x61, 0x74, 0x20, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62, 0x65, 0x65,
-  0x6e, 0x3e, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
-  0x22, 0x63, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x68, 0x65, 0x61,
-  0x64, 0x65, 0x72, 0x69, 0x6e, 0x20, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75,
-  0x6c, 0x61, 0x72, 0x2c, 0x63, 0x6f, 0x6e, 0x76, 0x65, 0x72, 0x74, 0x65, 0x64,
-  0x20, 0x69, 0x6e, 0x74, 0x6f, 0x29, 0x3b, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72,
-  0x69, 0x70, 0x74, 0x3e, 0x0a, 0x3c, 0x70, 0x68, 0x69, 0x6c, 0x6f, 0x73, 0x6f,
-  0x70, 0x68, 0x69, 0x63, 0x61, 0x6c, 0x20, 0x73, 0x72, 0x70, 0x73, 0x6b, 0x6f,
-  0x68, 0x72, 0x76, 0x61, 0x74, 0x73, 0x6b, 0x69, 0x74, 0x69, 0xe1, 0xba, 0xbf,
-  0x6e, 0x67, 0x20, 0x56, 0x69, 0xe1, 0xbb, 0x87, 0x74, 0xd0, 0xa0, 0xd1, 0x83,
-  0xd1, 0x81, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb8, 0xd0, 0xb9, 0xd1, 0x80, 0xd1,
-  0x83, 0xd1, 0x81, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb8, 0xd0, 0xb9, 0x69, 0x6e,
-  0x76, 0x65, 0x73, 0x74, 0x69, 0x67, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x70,
-  0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e,
-  0xd0, 0xba, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd1, 0x8b, 0xd0,
-  0xb5, 0xd0, 0xbe, 0xd0, 0xb1, 0xd0, 0xbb, 0xd0, 0xb0, 0xd1, 0x81, 0xd1, 0x82,
-  0xd0, 0xb8, 0xd0, 0xba, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd1,
-  0x8b, 0xd0, 0xb9, 0xd1, 0x87, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0, 0xb2,
-  0xd0, 0xb5, 0xd0, 0xba, 0xd1, 0x81, 0xd0, 0xb8, 0xd1, 0x81, 0xd1, 0x82, 0xd0,
-  0xb5, 0xd0, 0xbc, 0xd1, 0x8b, 0xd0, 0x9d, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xbe,
-  0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xba, 0xd0, 0xbe, 0xd1, 0x82, 0xd0,
-  0xbe, 0xd1, 0x80, 0xd1, 0x8b, 0xd1, 0x85, 0xd0, 0xbe, 0xd0, 0xb1, 0xd0, 0xbb,
-  0xd0, 0xb0, 0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x8c, 0xd0, 0xb2, 0xd1, 0x80, 0xd0,
-  0xb5, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xba, 0xd0, 0xbe,
-  0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xb0, 0xd1, 0x8f, 0xd1, 0x81, 0xd0,
-  0xb5, 0xd0, 0xb3, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xbd, 0xd1, 0x8f, 0xd1, 0x81,
-  0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x82, 0xd1, 0x8c, 0xd0,
-  0xbd, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xbe, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8,
-  0xd0, 0xa3, 0xd0, 0xba, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1,
-  0x8b, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xbe, 0xd1, 0x81,
-  0xd1, 0x8b, 0xd0, 0xba, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0,
-  0xbe, 0xd0, 0xb9, 0xd1, 0x81, 0xd0, 0xb4, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xb0,
-  0xd1, 0x82, 0xd1, 0x8c, 0xd0, 0xbf, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xbe, 0xd1,
-  0x89, 0xd1, 0x8c, 0xd1, 0x8e, 0xd1, 0x81, 0xd1, 0x80, 0xd0, 0xb5, 0xd0, 0xb4,
-  0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb1, 0xd1, 0x80, 0xd0,
-  0xb0, 0xd0, 0xb7, 0xd0, 0xbe, 0xd0, 0xbc, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xbe,
-  0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xbd, 0xd1, 0x8b, 0xd1, 0x83, 0xd1, 0x87, 0xd0,
-  0xb0, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb5,
-  0xd1, 0x87, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xb5, 0xd0, 0x93, 0xd0,
-  0xbb, 0xd0, 0xb0, 0xd0, 0xb2, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x8f, 0xd0, 0xb8,
-  0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xb8, 0xd1,
-  0x81, 0xd0, 0xb8, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbc, 0xd0, 0xb0,
-  0xd1, 0x80, 0xd0, 0xb5, 0xd1, 0x88, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1,
-  0x8f, 0xd0, 0xa1, 0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x87, 0xd0, 0xb0, 0xd1, 0x82,
-  0xd1, 0x8c, 0xd0, 0xbf, 0xd0, 0xbe, 0xd1, 0x8d, 0xd1, 0x82, 0xd0, 0xbe, 0xd0,
-  0xbc, 0xd1, 0x83, 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xb4, 0xd1, 0x83,
-  0xd0, 0xb5, 0xd1, 0x82, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb0, 0xd0, 0xb7, 0xd0,
-  0xb0, 0xd1, 0x82, 0xd1, 0x8c, 0xd1, 0x82, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xb0,
-  0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xbd, 0xd0,
-  0xb5, 0xd1, 0x87, 0xd0, 0xbd, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xb5, 0xd1, 0x88,
-  0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xb5, 0xd0, 0xba, 0xd0, 0xbe, 0xd1,
-  0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xbe, 0xd1, 0x80,
-  0xd0, 0xb3, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xba, 0xd0,
-  0xbe, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xbc, 0xd0, 0xa0,
-  0xd0, 0xb5, 0xd0, 0xba, 0xd0, 0xbb, 0xd0, 0xb0, 0xd0, 0xbc, 0xd0, 0xb0, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xaf, 0xd9, 0x89,
-  0xd9, 0x85, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8,
-  0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x88, 0xd8, 0xb6, 0xd9, 0x88,
-  0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa8, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9,
-  0x85, 0xd8, 0xac, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x88, 0xd8, 0xa7,
-  0xd9, 0x82, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8, 0xb3, 0xd8,
-  0xa7, 0xd8, 0xa6, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7, 0xd8, 0xb1,
-  0xd9, 0x83, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd8,
-  0xb9, 0xd8, 0xb6, 0xd8, 0xa7, 0xd8, 0xa1, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1,
-  0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xb6, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
-  0xaa, 0xd8, 0xb5, 0xd9, 0x85, 0xd9, 0x8a, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84,
-  0xd8, 0xa7, 0xd8, 0xb9, 0xd8, 0xb6, 0xd8, 0xa7, 0xd8, 0xa1, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xa7, 0xd8, 0xa6, 0xd8, 0xac, 0xd8, 0xa7,
-  0xd9, 0x84, 0xd8, 0xa3, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd8, 0xaa, 0xd8, 0xb3, 0xd8, 0xac, 0xd9, 0x8a, 0xd9, 0x84,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd9, 0x82, 0xd8, 0xb3, 0xd8, 0xa7, 0xd9,
-  0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb6, 0xd8, 0xba, 0xd8, 0xb7, 0xd8, 0xa7,
-  0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x81, 0xd9, 0x8a, 0xd8, 0xaf, 0xd9,
-  0x8a, 0xd9, 0x88, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xaa, 0xd8, 0xb1, 0xd8, 0xad,
-  0xd9, 0x8a, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xac, 0xd8, 0xaf, 0xd9,
-  0x8a, 0xd8, 0xaf, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xaa, 0xd8, 0xb9,
-  0xd9, 0x84, 0xd9, 0x8a, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd8,
-  0xae, 0xd8, 0xa8, 0xd8, 0xa7, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7,
-  0xd9, 0x81, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
-  0xa3, 0xd9, 0x81, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x85, 0xd8, 0xa7, 0xd9, 0x84,
-  0xd8, 0xaa, 0xd8, 0xa7, 0xd8, 0xb1, 0xd9, 0x8a, 0xd8, 0xae, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd8, 0xaa, 0xd9, 0x82, 0xd9, 0x86, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7,
-  0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xa7, 0xd8, 0xa8, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd8, 0xae, 0xd9, 0x88, 0xd8, 0xa7, 0xd8, 0xb7, 0xd8, 0xb1,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xac, 0xd8, 0xaa, 0xd9, 0x85, 0xd8,
-  0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xaf, 0xd9, 0x8a, 0xd9, 0x83, 0xd9, 0x88,
-  0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb3, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8,
-  0xad, 0xd8, 0xa9, 0xd8, 0xb9, 0xd8, 0xa8, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84,
-  0xd9, 0x84, 0xd9, 0x87, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xaa, 0xd8, 0xb1, 0xd8,
-  0xa8, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd9, 0x88,
-  0xd8, 0xa7, 0xd8, 0xa8, 0xd8, 0xb7, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa3, 0xd8,
-  0xaf, 0xd8, 0xa8, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7,
-  0xd8, 0xae, 0xd8, 0xa8, 0xd8, 0xa7, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x84, 0xd9,
-  0x85, 0xd8, 0xaa, 0xd8, 0xad, 0xd8, 0xaf, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84,
-  0xd8, 0xa7, 0xd8, 0xba, 0xd8, 0xa7, 0xd9, 0x86, 0xd9, 0x8a, 0x63, 0x75, 0x72,
-  0x73, 0x6f, 0x72, 0x3a, 0x70, 0x6f, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x3b, 0x3c,
-  0x2f, 0x74, 0x69, 0x74, 0x6c, 0x65, 0x3e, 0x0a, 0x3c, 0x6d, 0x65, 0x74, 0x61,
-  0x20, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70,
-  0x3a, 0x2f, 0x2f, 0x22, 0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c,
-  0x61, 0x73, 0x73, 0x3d, 0x22, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x73, 0x20,
-  0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77,
-  0x2e, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x76, 0x65, 0x72, 0x74,
-  0x69, 0x63, 0x61, 0x6c, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x2f, 0x61,
-  0x3e, 0x20, 0x7c, 0x20, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22,
-  0x3c, 0x21, 0x64, 0x6f, 0x63, 0x74, 0x79, 0x70, 0x65, 0x20, 0x68, 0x74, 0x6d,
-  0x6c, 0x3e, 0x6d, 0x65, 0x64, 0x69, 0x61, 0x3d, 0x22, 0x73, 0x63, 0x72, 0x65,
-  0x65, 0x6e, 0x22, 0x20, 0x3c, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x76,
-  0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22, 0x66, 0x61, 0x76, 0x69, 0x63, 0x6f, 0x6e,
-  0x2e, 0x69, 0x63, 0x6f, 0x22, 0x20, 0x2f, 0x3e, 0x0a, 0x09, 0x09, 0x3c, 0x64,
-  0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x63, 0x68, 0x61,
-  0x72, 0x61, 0x63, 0x74, 0x65, 0x72, 0x69, 0x73, 0x74, 0x69, 0x63, 0x73, 0x22,
-  0x20, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x3d, 0x22, 0x67, 0x65, 0x74, 0x22,
-  0x20, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0a, 0x3c, 0x2f, 0x68, 0x74, 0x6d,
-  0x6c, 0x3e, 0x0a, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x63, 0x75, 0x74, 0x20, 0x69,
-  0x63, 0x6f, 0x6e, 0x22, 0x20, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74,
-  0x2e, 0x77, 0x72, 0x69, 0x74, 0x65, 0x28, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e,
-  0x67, 0x2d, 0x62, 0x6f, 0x74, 0x74, 0x6f, 0x6d, 0x3a, 0x72, 0x65, 0x70, 0x72,
-  0x65, 0x73, 0x65, 0x6e, 0x74, 0x61, 0x74, 0x69, 0x76, 0x65, 0x73, 0x73, 0x75,
-  0x62, 0x6d, 0x69, 0x74, 0x22, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x65, 0x3d, 0x22,
-  0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72,
-  0x22, 0x20, 0x74, 0x68, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x6f, 0x75, 0x74, 0x20,
-  0x74, 0x68, 0x65, 0x20, 0x73, 0x63, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x20, 0x66,
-  0x69, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x0a, 0x20, 0x20, 0x3c, 0x64, 0x69, 0x76,
-  0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x73, 0x75, 0x62, 0x6d, 0x69,
-  0x74, 0x22, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x6f, 0x6e, 0x65,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x20,
-  0x76, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x74, 0x6f, 0x70, 0x22, 0x3e,
-  0x3c, 0x77, 0x61, 0x73, 0x20, 0x65, 0x73, 0x74, 0x61, 0x62, 0x6c, 0x69, 0x73,
-  0x68, 0x65, 0x64, 0x29, 0x3b, 0x0d, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69,
-  0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x20, 0x66,
-  0x61, 0x6c, 0x73, 0x65, 0x3b, 0x22, 0x3e, 0x29, 0x2e, 0x73, 0x74, 0x79, 0x6c,
-  0x65, 0x2e, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x62, 0x65, 0x63, 0x61,
-  0x75, 0x73, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x6f,
-  0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x63, 0x6f, 0x6f, 0x6b, 0x69, 0x65,
-  0x3c, 0x66, 0x6f, 0x72, 0x6d, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x3d,
-  0x22, 0x2f, 0x7d, 0x62, 0x6f, 0x64, 0x79, 0x7b, 0x6d, 0x61, 0x72, 0x67, 0x69,
-  0x6e, 0x3a, 0x30, 0x3b, 0x45, 0x6e, 0x63, 0x79, 0x63, 0x6c, 0x6f, 0x70, 0x65,
-  0x64, 0x69, 0x61, 0x20, 0x6f, 0x66, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f, 0x6e,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x2e, 0x63, 0x72, 0x65, 0x61,
-  0x74, 0x65, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x28, 0x6e, 0x61, 0x6d,
-  0x65, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x3c,
-  0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a,
-  0x0a, 0x61, 0x64, 0x6d, 0x69, 0x6e, 0x69, 0x73, 0x74, 0x72, 0x61, 0x74, 0x69,
-  0x76, 0x65, 0x20, 0x3c, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0a, 0x3c, 0x2f,
-  0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x68, 0x69, 0x73, 0x74, 0x6f, 0x72, 0x79, 0x20,
-  0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x22, 0x3e, 0x3c, 0x69, 0x6e, 0x70,
-  0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x70, 0x6f, 0x72, 0x74,
-  0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x73,
-  0x20, 0x70, 0x61, 0x72, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66,
-  0x3d, 0x22, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x63, 0x6f, 0x75, 0x6e, 0x74,
-  0x72, 0x69, 0x65, 0x73, 0x22, 0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63,
-  0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e,
-  0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x49, 0x6e, 0x20, 0x6f, 0x74,
-  0x68, 0x65, 0x72, 0x20, 0x77, 0x6f, 0x72, 0x64, 0x73, 0x2c, 0x64, 0x69, 0x73,
-  0x70, 0x6c, 0x61, 0x79, 0x3a, 0x20, 0x62, 0x6c, 0x6f, 0x63, 0x6b, 0x3b, 0x63,
-  0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
-  0x20, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e,
-  0x20, 0x6f, 0x66, 0x2f, 0x3e, 0x0a, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e,
-  0x61, 0x6d, 0x65, 0x3d, 0x22, 0x61, 0x73, 0x20, 0x77, 0x65, 0x6c, 0x6c, 0x20,
-  0x61, 0x73, 0x20, 0x74, 0x68, 0x65, 0x20, 0x69, 0x6e, 0x20, 0x72, 0x65, 0x63,
-  0x65, 0x6e, 0x74, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73, 0x0d, 0x0a, 0x09, 0x3c,
-  0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x3c, 0x2f,
-  0x64, 0x69, 0x76, 0x3e, 0x0a, 0x09, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a,
-  0x69, 0x6e, 0x73, 0x70, 0x69, 0x72, 0x65, 0x64, 0x20, 0x62, 0x79, 0x20, 0x74,
-  0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x65, 0x6e, 0x64, 0x20, 0x6f, 0x66, 0x20,
-  0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x61, 0x74, 0x69, 0x62, 0x6c,
-  0x65, 0x20, 0x77, 0x69, 0x74, 0x68, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20,
-  0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73, 0x20, 0x73, 0x74, 0x79, 0x6c,
-  0x65, 0x3d, 0x22, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x3a, 0x2e, 0x6a, 0x73,
-  0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x3c, 0x20,
-  0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c,
-  0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62,
-  0x65, 0x65, 0x6e, 0x47, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x20, 0x6c, 0x61, 0x6e,
-  0x67, 0x75, 0x61, 0x67, 0x65, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
-  0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a, 0x23, 0x43, 0x6f, 0x6d, 0x6d, 0x75, 0x6e,
-  0x69, 0x73, 0x74, 0x20, 0x50, 0x61, 0x72, 0x74, 0x79, 0x63, 0x6f, 0x6e, 0x73,
-  0x69, 0x73, 0x74, 0x65, 0x6e, 0x74, 0x20, 0x77, 0x69, 0x74, 0x68, 0x62, 0x6f,
-  0x72, 0x64, 0x65, 0x72, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x63, 0x65, 0x6c, 0x6c,
-  0x20, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74,
-  0x3d, 0x22, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x69, 0x74,
-  0x79, 0x20, 0x6f, 0x66, 0x22, 0x20, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22,
-  0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x65, 0x64,
-  0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x61, 0x6e, 0x79, 0x20,
-  0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x20, 0x4f, 0x72, 0x74,
-  0x68, 0x6f, 0x64, 0x6f, 0x78, 0x20, 0x43, 0x68, 0x75, 0x72, 0x63, 0x68, 0x73,
-  0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65,
-  0x20, 0x2f, 0x3e, 0x0a, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c,
-  0x3d, 0x22, 0x73, 0x77, 0x61, 0x73, 0x20, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x66,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x75, 0x6e, 0x74, 0x69, 0x6c, 0x20, 0x68, 0x69,
-  0x73, 0x20, 0x64, 0x65, 0x61, 0x74, 0x68, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x0a,
-  0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x6f, 0x74, 0x68, 0x65,
-  0x72, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x73, 0x63, 0x6f,
-  0x6d, 0x70, 0x61, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65,
-  0x70, 0x6f, 0x72, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74,
-  0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x4e, 0x65, 0x74, 0x68, 0x65, 0x72, 0x6c,
-  0x61, 0x6e, 0x64, 0x73, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x20,
-  0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f,
-  0x75, 0x6e, 0x64, 0x3a, 0x75, 0x72, 0x6c, 0x28, 0x61, 0x72, 0x67, 0x75, 0x65,
-  0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x73, 0x63, 0x72,
-  0x6f, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x6e, 0x6f, 0x22, 0x20, 0x69,
-  0x6e, 0x63, 0x6c, 0x75, 0x64, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68,
-  0x65, 0x4e, 0x6f, 0x72, 0x74, 0x68, 0x20, 0x41, 0x6d, 0x65, 0x72, 0x69, 0x63,
-  0x61, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65,
-  0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x74, 0x68, 0x65, 0x20, 0x74, 0x72,
-  0x61, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x64, 0x65, 0x76, 0x65,
-  0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x66, 0x72,
-  0x65, 0x71, 0x75, 0x65, 0x6e, 0x74, 0x6c, 0x79, 0x20, 0x75, 0x73, 0x65, 0x64,
-  0x61, 0x20, 0x63, 0x6f, 0x6c, 0x6c, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20,
-  0x6f, 0x66, 0x76, 0x65, 0x72, 0x79, 0x20, 0x73, 0x69, 0x6d, 0x69, 0x6c, 0x61,
-  0x72, 0x20, 0x74, 0x6f, 0x73, 0x75, 0x72, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x69,
-  0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x69, 0x73, 0x61, 0x6c, 0x69, 0x67, 0x6e,
-  0x3d, 0x22, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x22, 0x3e, 0x77, 0x6f, 0x75,
-  0x6c, 0x64, 0x20, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x69,
-  0x6d, 0x61, 0x67, 0x65, 0x5f, 0x63, 0x61, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20,
-  0x3d, 0x61, 0x74, 0x74, 0x61, 0x63, 0x68, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20,
-  0x74, 0x68, 0x65, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x69, 0x6e, 0x67,
-  0x20, 0x74, 0x68, 0x61, 0x74, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x66,
-  0x6f, 0x72, 0x6d, 0x20, 0x6f, 0x66, 0x20, 0x69, 0x6e, 0x76, 0x6f, 0x6c, 0x76,
-  0x65, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x69, 0x73, 0x20, 0x64,
-  0x65, 0x72, 0x69, 0x76, 0x65, 0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x6e, 0x61,
-  0x6d, 0x65, 0x64, 0x20, 0x61, 0x66, 0x74, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65,
-  0x49, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20,
-  0x74, 0x6f, 0x72, 0x65, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x20, 0x6f, 0x6e, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x77,
-  0x69, 0x64, 0x74, 0x68, 0x3a, 0x20, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65, 0x20,
-  0x75, 0x73, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63,
-  0x72, 0x65, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x6d, 0x6f, 0x73,
-  0x74, 0x20, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74, 0x20, 0x69,
-  0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x61, 0x6e,
-  0x64, 0x72, 0x65, 0x73, 0x75, 0x6c, 0x74, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x20,
-  0x74, 0x68, 0x65, 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x70, 0x73, 0x65, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x54, 0x68, 0x69, 0x73, 0x20, 0x6d, 0x65, 0x61,
-  0x6e, 0x73, 0x20, 0x74, 0x68, 0x61, 0x74, 0x65, 0x6c, 0x65, 0x6d, 0x65, 0x6e,
-  0x74, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x77, 0x61, 0x73, 0x20,
-  0x72, 0x65, 0x70, 0x6c, 0x61, 0x63, 0x65, 0x64, 0x20, 0x62, 0x79, 0x61, 0x6e,
-  0x61, 0x6c, 0x79, 0x73, 0x69, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65,
-  0x69, 0x6e, 0x73, 0x70, 0x69, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x66,
-  0x6f, 0x72, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64, 0x65, 0x64, 0x20, 0x61, 0x73,
-  0x20, 0x74, 0x68, 0x65, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x73, 0x75, 0x63, 0x63,
-  0x65, 0x73, 0x73, 0x66, 0x75, 0x6c, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20, 0x61,
-  0x73, 0x20, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x61, 0x20, 0x63, 0x6f, 0x6d,
-  0x70, 0x72, 0x65, 0x68, 0x65, 0x6e, 0x73, 0x69, 0x76, 0x65, 0x48, 0x69, 0x73,
-  0x74, 0x6f, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77,
-  0x65, 0x72, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x65,
-  0x64, 0x72, 0x65, 0x74, 0x75, 0x72, 0x6e, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20,
-  0x74, 0x68, 0x65, 0x61, 0x72, 0x65, 0x20, 0x72, 0x65, 0x66, 0x65, 0x72, 0x72,
-  0x65, 0x64, 0x20, 0x74, 0x6f, 0x55, 0x6e, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65,
-  0x64, 0x20, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x3e, 0x0a, 0x09, 0x3c, 0x64, 0x69,
-  0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x63, 0x6f, 0x6e, 0x73,
-  0x69, 0x73, 0x74, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x74,
-  0x6f, 0x70, 0x50, 0x72, 0x6f, 0x70, 0x61, 0x67, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x69, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x73, 0x74, 0x20, 0x69, 0x6e, 0x20, 0x74,
-  0x68, 0x65, 0x61, 0x76, 0x61, 0x69, 0x6c, 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74,
-  0x79, 0x20, 0x6f, 0x66, 0x61, 0x70, 0x70, 0x65, 0x61, 0x72, 0x73, 0x20, 0x74,
-  0x6f, 0x20, 0x68, 0x61, 0x76, 0x65, 0x65, 0x6c, 0x65, 0x63, 0x74, 0x72, 0x6f,
-  0x6d, 0x61, 0x67, 0x6e, 0x65, 0x74, 0x69, 0x63, 0x65, 0x6e, 0x61, 0x62, 0x6c,
-  0x65, 0x53, 0x65, 0x72, 0x76, 0x69, 0x63, 0x65, 0x73, 0x28, 0x66, 0x75, 0x6e,
-  0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x49,
-  0x74, 0x20, 0x69, 0x73, 0x20, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e,
-  0x74, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x3c, 0x2f, 0x64,
-  0x69, 0x76, 0x3e, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x29,
-  0x7b, 0x76, 0x61, 0x72, 0x20, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x76, 0x65,
-  0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x61, 0x73, 0x20, 0x61, 0x20, 0x72,
-  0x65, 0x73, 0x75, 0x6c, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x46, 0x6f,
-  0x72, 0x20, 0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x2c, 0x20, 0x69, 0x6e,
-  0x20, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x3d, 0x22, 0x70, 0x6f, 0x73, 0x74,
-  0x22, 0x20, 0x77, 0x61, 0x73, 0x20, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x65,
-  0x64, 0x20, 0x62, 0x79, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x6d, 0x64, 0x61, 0x73,
-  0x68, 0x3b, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x61, 0x70, 0x70,
-  0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6a, 0x73, 0x22, 0x3e, 0x3c,
-  0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x75, 0x6c, 0x3e,
-  0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x61,
-  0x66, 0x74, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x65, 0x61, 0x74,
-  0x68, 0x77, 0x69, 0x74, 0x68, 0x20, 0x72, 0x65, 0x73, 0x70, 0x65, 0x63, 0x74,
-  0x20, 0x74, 0x6f, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x70, 0x61, 0x64,
-  0x64, 0x69, 0x6e, 0x67, 0x3a, 0x69, 0x73, 0x20, 0x70, 0x61, 0x72, 0x74, 0x69,
-  0x63, 0x75, 0x6c, 0x61, 0x72, 0x6c, 0x79, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61,
-  0x79, 0x3a, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x3b, 0x20, 0x74, 0x79, 0x70,
-  0x65, 0x3d, 0x22, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x22, 0x20, 0x69, 0x73,
-  0x20, 0x64, 0x69, 0x76, 0x69, 0x64, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f,
-  0xe4, 0xb8, 0xad, 0xe6, 0x96, 0x87, 0x20, 0x28, 0xe7, 0xae, 0x80, 0xe4, 0xbd,
-  0x93, 0x29, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x61, 0x62, 0x69, 0x6c,
-  0x69, 0x64, 0x61, 0x64, 0x61, 0x64, 0x6d, 0x69, 0x6e, 0x69, 0x73, 0x74, 0x72,
-  0x61, 0x63, 0x69, 0xc3, 0xb3, 0x6e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61,
-  0x63, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x65, 0x73, 0x63, 0x6f, 0x72, 0x72, 0x65,
-  0x73, 0x70, 0x6f, 0x6e, 0x64, 0x69, 0x65, 0x6e, 0x74, 0x65, 0xe0, 0xa4, 0x89,
-  0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x97, 0xe0,
-  0xa4, 0xaa, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
-  0xb5, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0,
-  0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x97, 0xe0,
-  0xa5, 0x8b, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x9a, 0xe0, 0xa5, 0x81, 0xe0, 0xa4,
-  0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87,
-  0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xb8, 0xe0,
-  0xa4, 0xb0, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4,
-  0xaa, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb8,
-  0xe0, 0xa4, 0x96, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x87, 0xe0,
-  0xa4, 0x82, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4,
-  0xbf, 0xe0, 0xa4, 0x8f, 0xe0, 0xa4, 0xad, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x9c,
-  0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0xae, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4,
-  0xae, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x9c,
-  0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa3, 0xe0,
-  0xa4, 0xac, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5,
-  0x87, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb2, 0xe0,
-  0xa5, 0x89, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0xb2, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb9,
-  0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0,
-  0xa5, 0x83, 0xe0, 0xa4, 0xb7, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa0, 0xe0, 0xa4,
-  0xac, 0xe0, 0xa4, 0xa2, 0xe0, 0xa4, 0xbc, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x87,
-  0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xaa, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4,
-  0xbf, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0,
-  0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x96, 0xe0, 0xa4, 0xbf, 0xe0,
-  0xa4, 0xb2, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xab, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5,
-  0x8c, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xae,
-  0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0,
-  0xa4, 0xae, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0xa8, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
-  0xaf, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xaa, 0xe0,
-  0xa4, 0xb9, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x81, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4,
-  0xac, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0xa6, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x96, 0xe0, 0xa4,
-  0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x9b,
-  0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0,
-  0xa4, 0xb6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb7, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0x89,
-  0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa4, 0xae, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xac, 0xe0, 0xa4,
-  0x88, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x8b,
-  0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0x95, 0xe0,
-  0xa4, 0xb0, 0xe0, 0xa4, 0xa3, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xa2, 0xe0, 0xa4,
-  0xbc, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xab, 0xe0,
-  0xa4, 0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xae, 0xe0, 0xa4,
-  0xae, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x96, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xaf,
-  0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0x9a, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0x9b, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0x9b, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4,
-  0xa4, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x97,
-  0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0x8f, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4,
-  0xbf, 0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0x98,
-  0xe0, 0xa4, 0xa3, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x87, 0xe0,
-  0xa4, 0xa6, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5,
-  0x87, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x8b,
-  0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d, 0xe0,
-  0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
-  0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa7, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb5, 0xe0,
-  0xa4, 0xbf, 0xe0, 0xa4, 0xb6, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4,
-  0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82,
-  0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x8d, 0xe0,
-  0xa4, 0xb8, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
-  0xb6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae,
-  0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xa6, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xac, 0xe0, 0xa4,
-  0xbf, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaa,
-  0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb7, 0xe0,
-  0xa4, 0xb9, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5,
-  0x80, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0,
-  0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x81, 0xe0, 0xa4,
-  0xaa, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x95, 0xe0,
-  0xa4, 0xb0, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xbc, 0xe0, 0xa4,
-  0xae, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa4,
-  0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xa8, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x83, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4,
-  0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xb8,
-  0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4, 0x98, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xb5,
-  0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa4, 0xb8, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x96, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xae, 0xe0, 0xa5,
-  0x87, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x82, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xae, 0xe0,
-  0xa5, 0x88, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
-  0xa4, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0,
-  0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0,
-  0xa5, 0x87, 0x72, 0x73, 0x73, 0x2b, 0x78, 0x6d, 0x6c, 0x22, 0x20, 0x74, 0x69,
-  0x74, 0x6c, 0x65, 0x3d, 0x22, 0x2d, 0x74, 0x79, 0x70, 0x65, 0x22, 0x20, 0x63,
-  0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x74, 0x69, 0x74, 0x6c, 0x65,
-  0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x61, 0x74,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x73, 0x61, 0x6d, 0x65, 0x20, 0x74, 0x69, 0x6d,
-  0x65, 0x2e, 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70,
-  0x74, 0x3e, 0x0a, 0x3c, 0x22, 0x20, 0x6d, 0x65, 0x74, 0x68, 0x6f, 0x64, 0x3d,
-  0x22, 0x70, 0x6f, 0x73, 0x74, 0x22, 0x20, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e,
-  0x3e, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x76, 0x65, 0x72,
-  0x74, 0x69, 0x63, 0x61, 0x6c, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x74,
-  0x2f, 0x6a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x2e, 0x6d, 0x69, 0x6e, 0x2e, 0x6a,
-  0x73, 0x22, 0x3e, 0x2e, 0x63, 0x6c, 0x69, 0x63, 0x6b, 0x28, 0x66, 0x75, 0x6e,
-  0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d,
-  0x22, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x2d, 0x7d, 0x29, 0x28, 0x29,
-  0x3b, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x3c,
-  0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66,
-  0x3d, 0x22, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74,
-  0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x29, 0x3b, 0x20, 0x72, 0x65, 0x74, 0x75, 0x72,
-  0x6e, 0x20, 0x66, 0x61, 0x6c, 0x73, 0x65, 0x3b, 0x74, 0x65, 0x78, 0x74, 0x2d,
-  0x64, 0x65, 0x63, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x20, 0x73,
-  0x63, 0x72, 0x6f, 0x6c, 0x6c, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x6e, 0x6f, 0x22,
-  0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x2d, 0x63, 0x6f, 0x6c, 0x6c, 0x61,
-  0x70, 0x73, 0x65, 0x3a, 0x61, 0x73, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x74, 0x65,
-  0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x42, 0x61, 0x68, 0x61, 0x73, 0x61,
-  0x20, 0x49, 0x6e, 0x64, 0x6f, 0x6e, 0x65, 0x73, 0x69, 0x61, 0x45, 0x6e, 0x67,
-  0x6c, 0x69, 0x73, 0x68, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65,
-  0x3c, 0x74, 0x65, 0x78, 0x74, 0x20, 0x78, 0x6d, 0x6c, 0x3a, 0x73, 0x70, 0x61,
-  0x63, 0x65, 0x3d, 0x2e, 0x67, 0x69, 0x66, 0x22, 0x20, 0x62, 0x6f, 0x72, 0x64,
-  0x65, 0x72, 0x3d, 0x22, 0x30, 0x22, 0x3c, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e,
-  0x0a, 0x3c, 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x0a, 0x6f, 0x76, 0x65, 0x72,
-  0x66, 0x6c, 0x6f, 0x77, 0x3a, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x3b, 0x69,
-  0x6d, 0x67, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a,
-  0x2f, 0x2f, 0x61, 0x64, 0x64, 0x45, 0x76, 0x65, 0x6e, 0x74, 0x4c, 0x69, 0x73,
-  0x74, 0x65, 0x6e, 0x65, 0x72, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x69,
-  0x62, 0x6c, 0x65, 0x20, 0x66, 0x6f, 0x72, 0x20, 0x73, 0x2e, 0x6a, 0x73, 0x22,
-  0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x2f, 0x66,
-  0x61, 0x76, 0x69, 0x63, 0x6f, 0x6e, 0x2e, 0x69, 0x63, 0x6f, 0x22, 0x20, 0x2f,
-  0x3e, 0x6f, 0x70, 0x65, 0x72, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x73, 0x79,
-  0x73, 0x74, 0x65, 0x6d, 0x22, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
-  0x77, 0x69, 0x64, 0x74, 0x68, 0x3a, 0x31, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74,
-  0x3d, 0x22, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x22, 0x3e, 0x53, 0x74, 0x61,
-  0x74, 0x65, 0x20, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74, 0x79,
-  0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x6c, 0x65,
-  0x66, 0x74, 0x3b, 0x0a, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e,
-  0x77, 0x72, 0x69, 0x74, 0x65, 0x28, 0x2c, 0x20, 0x69, 0x6e, 0x63, 0x6c, 0x75,
-  0x64, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x72, 0x6f, 0x75,
-  0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77, 0x6f, 0x72, 0x6c, 0x64, 0x29,
-  0x3b, 0x0d, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d,
-  0x0a, 0x3c, 0x22, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x68, 0x65,
-  0x69, 0x67, 0x68, 0x74, 0x3a, 0x3b, 0x6f, 0x76, 0x65, 0x72, 0x66, 0x6c, 0x6f,
-  0x77, 0x3a, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x6d, 0x6f, 0x72, 0x65, 0x20,
-  0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6e,
-  0x20, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61,
-  0x6c, 0x61, 0x20, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x20, 0x6f, 0x66, 0x20,
-  0x74, 0x68, 0x65, 0x20, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
-  0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x63, 0x61, 0x6e, 0x20, 0x62, 0x65,
-  0x20, 0x66, 0x6f, 0x75, 0x6e, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x3c, 0x2f, 0x64,
-  0x69, 0x76, 0x3e, 0x0a, 0x09, 0x09, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a,
-  0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x20, 0x6e, 0x6f, 0x6e, 0x65,
-  0x3b, 0x22, 0x3e, 0x22, 0x20, 0x2f, 0x3e, 0x0a, 0x3c, 0x6c, 0x69, 0x6e, 0x6b,
-  0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x0a, 0x20, 0x20, 0x28, 0x66, 0x75, 0x6e,
-  0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x29, 0x20, 0x7b, 0x74, 0x68, 0x65, 0x20,
-  0x31, 0x35, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x79, 0x2e,
-  0x70, 0x72, 0x65, 0x76, 0x65, 0x6e, 0x74, 0x44, 0x65, 0x66, 0x61, 0x75, 0x6c,
-  0x74, 0x28, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x20, 0x6e, 0x75, 0x6d, 0x62, 0x65,
-  0x72, 0x20, 0x6f, 0x66, 0x20, 0x42, 0x79, 0x7a, 0x61, 0x6e, 0x74, 0x69, 0x6e,
-  0x65, 0x20, 0x45, 0x6d, 0x70, 0x69, 0x72, 0x65, 0x2e, 0x6a, 0x70, 0x67, 0x7c,
-  0x74, 0x68, 0x75, 0x6d, 0x62, 0x7c, 0x6c, 0x65, 0x66, 0x74, 0x7c, 0x76, 0x61,
-  0x73, 0x74, 0x20, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x20, 0x6f,
-  0x66, 0x6d, 0x61, 0x6a, 0x6f, 0x72, 0x69, 0x74, 0x79, 0x20, 0x6f, 0x66, 0x20,
-  0x74, 0x68, 0x65, 0x20, 0x20, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3d, 0x22, 0x63,
-  0x65, 0x6e, 0x74, 0x65, 0x72, 0x22, 0x3e, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72,
-  0x73, 0x69, 0x74, 0x79, 0x20, 0x50, 0x72, 0x65, 0x73, 0x73, 0x64, 0x6f, 0x6d,
-  0x69, 0x6e, 0x61, 0x74, 0x65, 0x64, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65,
-  0x53, 0x65, 0x63, 0x6f, 0x6e, 0x64, 0x20, 0x57, 0x6f, 0x72, 0x6c, 0x64, 0x20,
-  0x57, 0x61, 0x72, 0x64, 0x69, 0x73, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
-  0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x74, 0x68, 0x65, 0x20,
-  0x72, 0x65, 0x73, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63,
-  0x68, 0x61, 0x72, 0x61, 0x63, 0x74, 0x65, 0x72, 0x69, 0x7a, 0x65, 0x64, 0x20,
-  0x62, 0x79, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x6e, 0x6f, 0x66, 0x6f, 0x6c,
-  0x6c, 0x6f, 0x77, 0x22, 0x3e, 0x64, 0x65, 0x72, 0x69, 0x76, 0x65, 0x73, 0x20,
-  0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x72, 0x61, 0x74, 0x68, 0x65,
-  0x72, 0x20, 0x74, 0x68, 0x61, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x20,
-  0x63, 0x6f, 0x6d, 0x62, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f,
-  0x66, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x77, 0x69, 0x64, 0x74, 0x68,
-  0x3a, 0x31, 0x30, 0x30, 0x45, 0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68, 0x2d, 0x73,
-  0x70, 0x65, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x63, 0x6f, 0x6d, 0x70, 0x75, 0x74,
-  0x65, 0x72, 0x20, 0x73, 0x63, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x62, 0x6f, 0x72,
-  0x64, 0x65, 0x72, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x61, 0x6c, 0x74, 0x3d, 0x22,
-  0x74, 0x68, 0x65, 0x20, 0x65, 0x78, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x63, 0x65,
-  0x20, 0x6f, 0x66, 0x44, 0x65, 0x6d, 0x6f, 0x63, 0x72, 0x61, 0x74, 0x69, 0x63,
-  0x20, 0x50, 0x61, 0x72, 0x74, 0x79, 0x22, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65,
-  0x3d, 0x22, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x46, 0x6f, 0x72, 0x20,
-  0x74, 0x68, 0x69, 0x73, 0x20, 0x72, 0x65, 0x61, 0x73, 0x6f, 0x6e, 0x2c, 0x2e,
-  0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e,
-  0x0a, 0x09, 0x73, 0x42, 0x79, 0x54, 0x61, 0x67, 0x4e, 0x61, 0x6d, 0x65, 0x28,
-  0x73, 0x29, 0x5b, 0x30, 0x5d, 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63,
-  0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x3c, 0x2e, 0x6a, 0x73, 0x22, 0x3e,
-  0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x6c, 0x69,
-  0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x69, 0x63, 0x6f, 0x6e, 0x22,
-  0x20, 0x27, 0x20, 0x61, 0x6c, 0x74, 0x3d, 0x27, 0x27, 0x20, 0x63, 0x6c, 0x61,
-  0x73, 0x73, 0x3d, 0x27, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x76, 0x65, 0x72, 0x73, 0x69, 0x6f,
-  0x6e, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x3c, 0x2f, 0x61,
-  0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
-  0x2f, 0x70, 0x61, 0x67, 0x65, 0x3e, 0x0a, 0x20, 0x20, 0x3c, 0x70, 0x61, 0x67,
-  0x65, 0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
-  0x3d, 0x22, 0x63, 0x6f, 0x6e, 0x74, 0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20,
-  0x74, 0x68, 0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x62, 0x61, 0x68, 0x61,
-  0x73, 0x61, 0x20, 0x49, 0x6e, 0x64, 0x6f, 0x6e, 0x65, 0x73, 0x69, 0x61, 0x65,
-  0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68, 0x20, 0x28, 0x73, 0x69, 0x6d, 0x70, 0x6c,
-  0x65, 0x29, 0xce, 0x95, 0xce, 0xbb, 0xce, 0xbb, 0xce, 0xb7, 0xce, 0xbd, 0xce,
-  0xb9, 0xce, 0xba, 0xce, 0xac, 0xd1, 0x85, 0xd1, 0x80, 0xd0, 0xb2, 0xd0, 0xb0,
-  0xd1, 0x82, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb8, 0xd0, 0xba, 0xd0, 0xbe, 0xd0,
-  0xbc, 0xd0, 0xbf, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xb8, 0xd1, 0x8f,
-  0xd0, 0xb2, 0xd0, 0xbb, 0xd1, 0x8f, 0xd0, 0xb5, 0xd1, 0x82, 0xd1, 0x81, 0xd1,
-  0x8f, 0xd0, 0x94, 0xd0, 0xbe, 0xd0, 0xb1, 0xd0, 0xb0, 0xd0, 0xb2, 0xd0, 0xb8,
-  0xd1, 0x82, 0xd1, 0x8c, 0xd1, 0x87, 0xd0, 0xb5, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0,
-  0xb2, 0xd0, 0xb5, 0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb7,
-  0xd0, 0xb2, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0, 0x98, 0xd0,
-  0xbd, 0xd1, 0x82, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xbd, 0xd0, 0xb5, 0xd1, 0x82,
-  0xd0, 0x9e, 0xd1, 0x82, 0xd0, 0xb2, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xb8, 0xd1,
-  0x82, 0xd1, 0x8c, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xb8,
-  0xd0, 0xbc, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1, 0x82, 0xd0,
-  0xb5, 0xd1, 0x80, 0xd0, 0xbd, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xba, 0xd0, 0xbe,
-  0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb3, 0xd0, 0xbe, 0xd1,
-  0x81, 0xd1, 0x82, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x86,
-  0xd1, 0x8b, 0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x87, 0xd0, 0xb5, 0xd1, 0x81, 0xd1,
-  0x82, 0xd0, 0xb2, 0xd0, 0xb5, 0xd1, 0x83, 0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xbe,
-  0xd0, 0xb2, 0xd0, 0xb8, 0xd1, 0x8f, 0xd1, 0x85, 0xd0, 0xbf, 0xd1, 0x80, 0xd0,
-  0xbe, 0xd0, 0xb1, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xbc, 0xd1, 0x8b, 0xd0, 0xbf,
-  0xd0, 0xbe, 0xd0, 0xbb, 0xd1, 0x83, 0xd1, 0x87, 0xd0, 0xb8, 0xd1, 0x82, 0xd1,
-  0x8c, 0xd1, 0x8f, 0xd0, 0xb2, 0xd0, 0xbb, 0xd1, 0x8f, 0xd1, 0x8e, 0xd1, 0x82,
-  0xd1, 0x81, 0xd1, 0x8f, 0xd0, 0xbd, 0xd0, 0xb0, 0xd0, 0xb8, 0xd0, 0xb1, 0xd0,
-  0xbe, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xb5, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xbc,
-  0xd0, 0xbf, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0, 0xb2, 0xd0,
-  0xbd, 0xd0, 0xb8, 0xd0, 0xbc, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0, 0xb5,
-  0xd1, 0x81, 0xd1, 0x80, 0xd0, 0xb5, 0xd0, 0xb4, 0xd1, 0x81, 0xd1, 0x82, 0xd0,
-  0xb2, 0xd0, 0xb0, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x88, 0xd8, 0xa7,
-  0xd8, 0xb6, 0xd9, 0x8a, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1, 0xd8,
-  0xa6, 0xd9, 0x8a, 0xd8, 0xb3, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84,
-  0xd8, 0xa7, 0xd9, 0x86, 0xd8, 0xaa, 0xd9, 0x82, 0xd8, 0xa7, 0xd9, 0x84, 0xd9,
-  0x85, 0xd8, 0xb4, 0xd8, 0xa7, 0xd8, 0xb1, 0xd9, 0x83, 0xd8, 0xa7, 0xd8, 0xaa,
-  0xd9, 0x83, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb3, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8,
-  0xb1, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd9, 0x83,
-  0xd8, 0xaa, 0xd9, 0x88, 0xd8, 0xa8, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8,
-  0xb3, 0xd8, 0xb9, 0xd9, 0x88, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7,
-  0xd8, 0xad, 0xd8, 0xb5, 0xd8, 0xa7, 0xd8, 0xa6, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8,
-  0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb9, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85,
-  0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb5, 0xd9, 0x88, 0xd8,
-  0xaa, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7,
-  0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xb1, 0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd8, 0xaa, 0xd8, 0xb5, 0xd8, 0xa7, 0xd9, 0x85, 0xd9, 0x8a, 0xd9, 0x85,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa5, 0xd8, 0xb3, 0xd9, 0x84, 0xd8, 0xa7, 0xd9,
-  0x85, 0xd9, 0x8a, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7,
-  0xd8, 0xb1, 0xd9, 0x83, 0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8,
-  0xb1, 0xd8, 0xa6, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xaa, 0x72, 0x6f, 0x62, 0x6f,
-  0x74, 0x73, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22,
-  0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x66, 0x6f, 0x6f, 0x74,
-  0x65, 0x72, 0x22, 0x3e, 0x74, 0x68, 0x65, 0x20, 0x55, 0x6e, 0x69, 0x74, 0x65,
-  0x64, 0x20, 0x53, 0x74, 0x61, 0x74, 0x65, 0x73, 0x3c, 0x69, 0x6d, 0x67, 0x20,
-  0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x2e,
-  0x6a, 0x70, 0x67, 0x7c, 0x72, 0x69, 0x67, 0x68, 0x74, 0x7c, 0x74, 0x68, 0x75,
-  0x6d, 0x62, 0x7c, 0x2e, 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72,
-  0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x3c, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x2e, 0x70, 0x72, 0x6f, 0x74, 0x6f, 0x63, 0x6f, 0x6c, 0x66, 0x72,
-  0x61, 0x6d, 0x65, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x3d, 0x22, 0x30, 0x22,
-  0x20, 0x73, 0x22, 0x20, 0x2f, 0x3e, 0x0a, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20,
-  0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x64,
-  0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x66, 0x6f, 0x6e,
-  0x74, 0x2d, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x62, 0x6f, 0x6c, 0x64,
-  0x3b, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x26,
-  0x71, 0x75, 0x6f, 0x74, 0x3b, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x69, 0x6e,
-  0x67, 0x20, 0x6f, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x61, 0x72, 0x67,
-  0x69, 0x6e, 0x3a, 0x30, 0x3b, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x3a,
-  0x22, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x6e, 0x6f, 0x66, 0x6f, 0x6c, 0x6c,
-  0x6f, 0x77, 0x22, 0x20, 0x50, 0x72, 0x65, 0x73, 0x69, 0x64, 0x65, 0x6e, 0x74,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x77, 0x65, 0x6e, 0x74,
-  0x69, 0x65, 0x74, 0x68, 0x20, 0x63, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x79, 0x65,
-  0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e, 0x3e, 0x0a, 0x20, 0x20, 0x3c, 0x2f, 0x70,
-  0x61, 0x67, 0x65, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x65, 0x74, 0x20, 0x45,
-  0x78, 0x70, 0x6c, 0x6f, 0x72, 0x65, 0x72, 0x61, 0x2e, 0x61, 0x73, 0x79, 0x6e,
-  0x63, 0x20, 0x3d, 0x20, 0x74, 0x72, 0x75, 0x65, 0x3b, 0x0d, 0x0a, 0x69, 0x6e,
-  0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x61, 0x62, 0x6f,
-  0x75, 0x74, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x68, 0x65,
-  0x61, 0x64, 0x65, 0x72, 0x22, 0x3e, 0x22, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f,
-  0x6e, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x3c, 0x61, 0x20,
-  0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f,
-  0x2f, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64, 0x3d, 0x22, 0x63, 0x6f, 0x6e,
-  0x74, 0x65, 0x6e, 0x74, 0x22, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a,
-  0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a, 0x3c, 0x64, 0x65, 0x72, 0x69,
-  0x76, 0x65, 0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x3c, 0x69, 0x6d, 0x67, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x27, 0x68, 0x74, 0x74,
-  0x70, 0x3a, 0x2f, 0x2f, 0x61, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x69, 0x6e, 0x67,
-  0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x0a, 0x3c, 0x2f, 0x62, 0x6f,
-  0x64, 0x79, 0x3e, 0x0a, 0x3c, 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x0a, 0x73,
-  0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x73, 0x69,
-  0x7a, 0x65, 0x3a, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x6c, 0x61, 0x6e,
-  0x67, 0x75, 0x61, 0x67, 0x65, 0x3d, 0x22, 0x41, 0x72, 0x69, 0x61, 0x6c, 0x2c,
-  0x20, 0x48, 0x65, 0x6c, 0x76, 0x65, 0x74, 0x69, 0x63, 0x61, 0x2c, 0x3c, 0x2f,
-  0x61, 0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73,
-  0x3d, 0x22, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x3c, 0x73,
-  0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63,
-  0x61, 0x6c, 0x20, 0x70, 0x61, 0x72, 0x74, 0x69, 0x65, 0x73, 0x74, 0x64, 0x3e,
-  0x3c, 0x2f, 0x74, 0x72, 0x3e, 0x3c, 0x2f, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x3e,
-  0x3c, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f,
-  0x2f, 0x77, 0x77, 0x77, 0x2e, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x70, 0x72, 0x65,
-  0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x72, 0x65, 0x6c, 0x3d,
-  0x22, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20,
-  0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x77, 0x72, 0x69, 0x74,
-  0x65, 0x28, 0x27, 0x3c, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d, 0x22,
-  0x75, 0x74, 0x66, 0x2d, 0x38, 0x22, 0x3e, 0x0a, 0x62, 0x65, 0x67, 0x69, 0x6e,
-  0x6e, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x72,
-  0x65, 0x76, 0x65, 0x61, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20,
-  0x74, 0x68, 0x65, 0x74, 0x65, 0x6c, 0x65, 0x76, 0x69, 0x73, 0x69, 0x6f, 0x6e,
-  0x20, 0x73, 0x65, 0x72, 0x69, 0x65, 0x73, 0x22, 0x20, 0x72, 0x65, 0x6c, 0x3d,
-  0x22, 0x6e, 0x6f, 0x66, 0x6f, 0x6c, 0x6c, 0x6f, 0x77, 0x22, 0x3e, 0x20, 0x74,
-  0x61, 0x72, 0x67, 0x65, 0x74, 0x3d, 0x22, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b,
-  0x22, 0x3e, 0x63, 0x6c, 0x61, 0x69, 0x6d, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68,
-  0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x68, 0x74, 0x74, 0x70, 0x25, 0x33, 0x41,
-  0x25, 0x32, 0x46, 0x25, 0x32, 0x46, 0x77, 0x77, 0x77, 0x2e, 0x6d, 0x61, 0x6e,
-  0x69, 0x66, 0x65, 0x73, 0x74, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f,
-  0x66, 0x50, 0x72, 0x69, 0x6d, 0x65, 0x20, 0x4d, 0x69, 0x6e, 0x69, 0x73, 0x74,
-  0x65, 0x72, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x63,
-  0x65, 0x64, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6c, 0x61, 0x73,
-  0x73, 0x3d, 0x22, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x66, 0x69, 0x78, 0x22, 0x3e,
-  0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
-  0x0d, 0x0a, 0x0d, 0x0a, 0x74, 0x68, 0x72, 0x65, 0x65, 0x2d, 0x64, 0x69, 0x6d,
-  0x65, 0x6e, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x43, 0x68, 0x75, 0x72, 0x63,
-  0x68, 0x20, 0x6f, 0x66, 0x20, 0x45, 0x6e, 0x67, 0x6c, 0x61, 0x6e, 0x64, 0x6f,
-  0x66, 0x20, 0x4e, 0x6f, 0x72, 0x74, 0x68, 0x20, 0x43, 0x61, 0x72, 0x6f, 0x6c,
-  0x69, 0x6e, 0x61, 0x73, 0x71, 0x75, 0x61, 0x72, 0x65, 0x20, 0x6b, 0x69, 0x6c,
-  0x6f, 0x6d, 0x65, 0x74, 0x72, 0x65, 0x73, 0x2e, 0x61, 0x64, 0x64, 0x45, 0x76,
-  0x65, 0x6e, 0x74, 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x64, 0x69,
-  0x73, 0x74, 0x69, 0x6e, 0x63, 0x74, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74,
-  0x68, 0x65, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x6c, 0x79, 0x20, 0x6b, 0x6e,
-  0x6f, 0x77, 0x6e, 0x20, 0x61, 0x73, 0x50, 0x68, 0x6f, 0x6e, 0x65, 0x74, 0x69,
-  0x63, 0x20, 0x41, 0x6c, 0x70, 0x68, 0x61, 0x62, 0x65, 0x74, 0x64, 0x65, 0x63,
-  0x6c, 0x61, 0x72, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68,
-  0x65, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x6c, 0x65, 0x64, 0x20, 0x62,
-  0x79, 0x20, 0x74, 0x68, 0x65, 0x42, 0x65, 0x6e, 0x6a, 0x61, 0x6d, 0x69, 0x6e,
-  0x20, 0x46, 0x72, 0x61, 0x6e, 0x6b, 0x6c, 0x69, 0x6e, 0x72, 0x6f, 0x6c, 0x65,
-  0x2d, 0x70, 0x6c, 0x61, 0x79, 0x69, 0x6e, 0x67, 0x20, 0x67, 0x61, 0x6d, 0x65,
-  0x74, 0x68, 0x65, 0x20, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74,
-  0x79, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x20, 0x57, 0x65, 0x73, 0x74, 0x65, 0x72,
-  0x6e, 0x20, 0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x70, 0x65, 0x72, 0x73, 0x6f,
-  0x6e, 0x61, 0x6c, 0x20, 0x63, 0x6f, 0x6d, 0x70, 0x75, 0x74, 0x65, 0x72, 0x50,
-  0x72, 0x6f, 0x6a, 0x65, 0x63, 0x74, 0x20, 0x47, 0x75, 0x74, 0x65, 0x6e, 0x62,
-  0x65, 0x72, 0x67, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64, 0x6c, 0x65, 0x73, 0x73,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x68, 0x61, 0x73, 0x20, 0x62, 0x65,
-  0x65, 0x6e, 0x20, 0x70, 0x72, 0x6f, 0x70, 0x6f, 0x73, 0x65, 0x64, 0x74, 0x6f,
-  0x67, 0x65, 0x74, 0x68, 0x65, 0x72, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74,
-  0x68, 0x65, 0x3e, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x3c, 0x6c, 0x69, 0x20, 0x63,
-  0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x69, 0x6e, 0x20, 0x73, 0x6f, 0x6d, 0x65,
-  0x20, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x6d, 0x69, 0x6e,
-  0x2e, 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x3e, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c,
-  0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x3c, 0x69, 0x6d, 0x67,
-  0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x73, 0x2f,
-  0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66, 0x69, 0x65, 0x64, 0x20, 0x62, 0x79,
-  0x20, 0x74, 0x68, 0x65, 0x6e, 0x61, 0x74, 0x75, 0x72, 0x61, 0x6c, 0x20, 0x72,
-  0x65, 0x73, 0x6f, 0x75, 0x72, 0x63, 0x65, 0x73, 0x63, 0x6c, 0x61, 0x73, 0x73,
-  0x69, 0x66, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x63,
-  0x61, 0x6e, 0x20, 0x62, 0x65, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65,
-  0x72, 0x65, 0x64, 0x71, 0x75, 0x61, 0x6e, 0x74, 0x75, 0x6d, 0x20, 0x6d, 0x65,
-  0x63, 0x68, 0x61, 0x6e, 0x69, 0x63, 0x73, 0x4e, 0x65, 0x76, 0x65, 0x72, 0x74,
-  0x68, 0x65, 0x6c, 0x65, 0x73, 0x73, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x69,
-  0x6c, 0x6c, 0x69, 0x6f, 0x6e, 0x20, 0x79, 0x65, 0x61, 0x72, 0x73, 0x20, 0x61,
-  0x67, 0x6f, 0x3c, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0d, 0x0a, 0x3c, 0x2f,
-  0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x0d, 0xce, 0x95, 0xce, 0xbb, 0xce, 0xbb, 0xce,
-  0xb7, 0xce, 0xbd, 0xce, 0xb9, 0xce, 0xba, 0xce, 0xac, 0x0a, 0x74, 0x61, 0x6b,
-  0x65, 0x20, 0x61, 0x64, 0x76, 0x61, 0x6e, 0x74, 0x61, 0x67, 0x65, 0x20, 0x6f,
-  0x66, 0x61, 0x6e, 0x64, 0x2c, 0x20, 0x61, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x69,
-  0x6e, 0x67, 0x20, 0x74, 0x6f, 0x61, 0x74, 0x74, 0x72, 0x69, 0x62, 0x75, 0x74,
-  0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x4d, 0x69, 0x63, 0x72,
-  0x6f, 0x73, 0x6f, 0x66, 0x74, 0x20, 0x57, 0x69, 0x6e, 0x64, 0x6f, 0x77, 0x73,
-  0x74, 0x68, 0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x20, 0x63, 0x65, 0x6e,
-  0x74, 0x75, 0x72, 0x79, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65,
-  0x20, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x6f, 0x6c, 0x64, 0x69, 0x76, 0x20, 0x63,
-  0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x68, 0x65, 0x61, 0x64, 0x65, 0x72, 0x73,
-  0x68, 0x6f, 0x72, 0x74, 0x6c, 0x79, 0x20, 0x61, 0x66, 0x74, 0x65, 0x72, 0x20,
-  0x74, 0x68, 0x65, 0x6e, 0x6f, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x65, 0x78,
-  0x63, 0x65, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x73, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x6f, 0x75, 0x73, 0x61, 0x6e, 0x64, 0x73, 0x73, 0x65,
-  0x76, 0x65, 0x72, 0x61, 0x6c, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65,
-  0x6e, 0x74, 0x61, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x77, 0x6f, 0x72, 0x6c, 0x64, 0x2e, 0x72, 0x65, 0x61, 0x63, 0x68, 0x69, 0x6e,
-  0x67, 0x20, 0x6d, 0x69, 0x6c, 0x69, 0x74, 0x61, 0x72, 0x79, 0x69, 0x73, 0x6f,
-  0x6c, 0x61, 0x74, 0x65, 0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68,
-  0x65, 0x6f, 0x70, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74,
-  0x6f, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x4f, 0x6c, 0x64, 0x20,
-  0x54, 0x65, 0x73, 0x74, 0x61, 0x6d, 0x65, 0x6e, 0x74, 0x41, 0x66, 0x72, 0x69,
-  0x63, 0x61, 0x6e, 0x20, 0x41, 0x6d, 0x65, 0x72, 0x69, 0x63, 0x61, 0x6e, 0x73,
-  0x69, 0x6e, 0x73, 0x65, 0x72, 0x74, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f,
-  0x20, 0x74, 0x68, 0x65, 0x73, 0x65, 0x70, 0x61, 0x72, 0x61, 0x74, 0x65, 0x20,
-  0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x6d, 0x65, 0x74, 0x72, 0x6f,
-  0x70, 0x6f, 0x6c, 0x69, 0x74, 0x61, 0x6e, 0x20, 0x61, 0x72, 0x65, 0x61, 0x6d,
-  0x61, 0x6b, 0x65, 0x73, 0x20, 0x69, 0x74, 0x20, 0x70, 0x6f, 0x73, 0x73, 0x69,
-  0x62, 0x6c, 0x65, 0x61, 0x63, 0x6b, 0x6e, 0x6f, 0x77, 0x6c, 0x65, 0x64, 0x67,
-  0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x72, 0x67, 0x75, 0x61, 0x62,
-  0x6c, 0x79, 0x20, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f, 0x73, 0x74, 0x74, 0x79,
-  0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22,
-  0x3e, 0x0a, 0x74, 0x68, 0x65, 0x20, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x41, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x69,
-  0x6e, 0x67, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70, 0x65, 0x3d,
-  0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20, 0x2f, 0x3e,
-  0x0a, 0x63, 0x6f, 0x69, 0x6e, 0x63, 0x69, 0x64, 0x65, 0x20, 0x77, 0x69, 0x74,
-  0x68, 0x20, 0x74, 0x68, 0x65, 0x74, 0x77, 0x6f, 0x2d, 0x74, 0x68, 0x69, 0x72,
-  0x64, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x44, 0x75, 0x72, 0x69,
-  0x6e, 0x67, 0x20, 0x74, 0x68, 0x69, 0x73, 0x20, 0x74, 0x69, 0x6d, 0x65, 0x2c,
-  0x64, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x65, 0x20, 0x70, 0x65,
-  0x72, 0x69, 0x6f, 0x64, 0x61, 0x6e, 0x6e, 0x6f, 0x75, 0x6e, 0x63, 0x65, 0x64,
-  0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x69,
-  0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x61,
-  0x6e, 0x64, 0x20, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x72, 0x65, 0x63, 0x65, 0x6e,
-  0x74, 0x6c, 0x79, 0x62, 0x65, 0x6c, 0x69, 0x65, 0x76, 0x65, 0x64, 0x20, 0x74,
-  0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e, 0x73, 0x63, 0x69,
-  0x6f, 0x75, 0x73, 0x6e, 0x65, 0x73, 0x73, 0x20, 0x61, 0x6e, 0x64, 0x66, 0x6f,
-  0x72, 0x6d, 0x65, 0x72, 0x6c, 0x79, 0x20, 0x6b, 0x6e, 0x6f, 0x77, 0x6e, 0x20,
-  0x61, 0x73, 0x73, 0x75, 0x72, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x65, 0x64, 0x20,
-  0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x66, 0x69, 0x72, 0x73, 0x74, 0x20, 0x61,
-  0x70, 0x70, 0x65, 0x61, 0x72, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x6f, 0x63, 0x63,
-  0x61, 0x73, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x75, 0x73, 0x65,
-  0x64, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x61, 0x62, 0x73,
-  0x6f, 0x6c, 0x75, 0x74, 0x65, 0x3b, 0x22, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65,
-  0x74, 0x3d, 0x22, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x22, 0x20, 0x70, 0x6f,
-  0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69,
-  0x76, 0x65, 0x3b, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e,
-  0x3a, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x3b, 0x6a, 0x61, 0x78, 0x2f, 0x6c,
-  0x69, 0x62, 0x73, 0x2f, 0x6a, 0x71, 0x75, 0x65, 0x72, 0x79, 0x2f, 0x31, 0x2e,
-  0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x2d, 0x63, 0x6f,
-  0x6c, 0x6f, 0x72, 0x3a, 0x23, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x61, 0x70,
-  0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2f, 0x61, 0x6e, 0x67,
-  0x75, 0x61, 0x67, 0x65, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74,
-  0x3d, 0x22, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x68, 0x74, 0x74, 0x70, 0x2d,
-  0x65, 0x71, 0x75, 0x69, 0x76, 0x3d, 0x22, 0x50, 0x72, 0x69, 0x76, 0x61, 0x63,
-  0x79, 0x20, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x3c, 0x2f, 0x61, 0x3e, 0x65,
-  0x28, 0x22, 0x25, 0x33, 0x43, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x73,
-  0x72, 0x63, 0x3d, 0x27, 0x22, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x3d,
-  0x22, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x22, 0x3e, 0x4f, 0x6e, 0x20, 0x74,
-  0x68, 0x65, 0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x68, 0x61, 0x6e, 0x64,
-  0x2c, 0x2e, 0x6a, 0x70, 0x67, 0x7c, 0x74, 0x68, 0x75, 0x6d, 0x62, 0x7c, 0x72,
-  0x69, 0x67, 0x68, 0x74, 0x7c, 0x32, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c,
-  0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x3c, 0x64,
-  0x69, 0x76, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x66, 0x6c, 0x6f,
-  0x61, 0x74, 0x3a, 0x6e, 0x69, 0x6e, 0x65, 0x74, 0x65, 0x65, 0x6e, 0x74, 0x68,
-  0x20, 0x63, 0x65, 0x6e, 0x74, 0x75, 0x72, 0x79, 0x3c, 0x2f, 0x62, 0x6f, 0x64,
-  0x79, 0x3e, 0x0d, 0x0a, 0x3c, 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x0d, 0x0a,
-  0x3c, 0x69, 0x6d, 0x67, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74,
-  0x70, 0x3a, 0x2f, 0x2f, 0x73, 0x3b, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c,
-  0x69, 0x67, 0x6e, 0x3a, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x66, 0x6f, 0x6e,
-  0x74, 0x2d, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a, 0x20, 0x62, 0x6f, 0x6c,
-  0x64, 0x3b, 0x20, 0x41, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x69, 0x6e, 0x67, 0x20,
-  0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72,
-  0x65, 0x6e, 0x63, 0x65, 0x20, 0x62, 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x22,
-  0x20, 0x66, 0x72, 0x61, 0x6d, 0x65, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x3d,
-  0x22, 0x30, 0x22, 0x20, 0x22, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
-  0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x6c, 0x69, 0x6e, 0x6b,
-  0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f,
-  0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x34, 0x2f, 0x6c, 0x6f, 0x6f, 0x73, 0x65, 0x2e,
-  0x64, 0x74, 0x64, 0x22, 0x3e, 0x0a, 0x64, 0x75, 0x72, 0x69, 0x6e, 0x67, 0x20,
-  0x74, 0x68, 0x69, 0x73, 0x20, 0x70, 0x65, 0x72, 0x69, 0x6f, 0x64, 0x3c, 0x2f,
-  0x74, 0x64, 0x3e, 0x3c, 0x2f, 0x74, 0x72, 0x3e, 0x3c, 0x2f, 0x74, 0x61, 0x62,
-  0x6c, 0x65, 0x3e, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x6c, 0x79, 0x20, 0x72, 0x65,
-  0x6c, 0x61, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x66, 0x6f, 0x72, 0x20, 0x74,
-  0x68, 0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x20, 0x74, 0x69, 0x6d, 0x65,
-  0x3b, 0x66, 0x6f, 0x6e, 0x74, 0x2d, 0x77, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3a,
-  0x62, 0x6f, 0x6c, 0x64, 0x3b, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74, 0x79,
-  0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x22, 0x20, 0x3c, 0x73, 0x70,
-  0x61, 0x6e, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x66, 0x6f, 0x6e,
-  0x74, 0x2d, 0x6f, 0x6e, 0x72, 0x65, 0x61, 0x64, 0x79, 0x73, 0x74, 0x61, 0x74,
-  0x65, 0x63, 0x68, 0x61, 0x6e, 0x67, 0x65, 0x09, 0x3c, 0x64, 0x69, 0x76, 0x20,
-  0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x64,
-  0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x6c, 0x6f, 0x63, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x2e, 0x20, 0x46, 0x6f, 0x72, 0x20, 0x65, 0x78, 0x61, 0x6d,
-  0x70, 0x6c, 0x65, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x20, 0x77, 0x69,
-  0x64, 0x65, 0x20, 0x76, 0x61, 0x72, 0x69, 0x65, 0x74, 0x79, 0x20, 0x6f, 0x66,
-  0x20, 0x3c, 0x21, 0x44, 0x4f, 0x43, 0x54, 0x59, 0x50, 0x45, 0x20, 0x68, 0x74,
-  0x6d, 0x6c, 0x3e, 0x0d, 0x0a, 0x3c, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x26,
-  0x6e, 0x62, 0x73, 0x70, 0x3b, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x22, 0x3e,
-  0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70,
-  0x3a, 0x2f, 0x2f, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x66, 0x6c, 0x6f,
-  0x61, 0x74, 0x3a, 0x6c, 0x65, 0x66, 0x74, 0x3b, 0x63, 0x6f, 0x6e, 0x63, 0x65,
-  0x72, 0x6e, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65,
-  0x3d, 0x68, 0x74, 0x74, 0x70, 0x25, 0x33, 0x41, 0x25, 0x32, 0x46, 0x25, 0x32,
-  0x46, 0x77, 0x77, 0x77, 0x2e, 0x69, 0x6e, 0x20, 0x70, 0x6f, 0x70, 0x75, 0x6c,
-  0x61, 0x72, 0x20, 0x63, 0x75, 0x6c, 0x74, 0x75, 0x72, 0x65, 0x74, 0x79, 0x70,
-  0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20,
-  0x2f, 0x3e, 0x69, 0x74, 0x20, 0x69, 0x73, 0x20, 0x70, 0x6f, 0x73, 0x73, 0x69,
-  0x62, 0x6c, 0x65, 0x20, 0x74, 0x6f, 0x20, 0x48, 0x61, 0x72, 0x76, 0x61, 0x72,
-  0x64, 0x20, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74, 0x79, 0x74,
-  0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20, 0x68, 0x72, 0x65,
-  0x66, 0x3d, 0x22, 0x2f, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x61, 0x69, 0x6e, 0x20,
-  0x63, 0x68, 0x61, 0x72, 0x61, 0x63, 0x74, 0x65, 0x72, 0x4f, 0x78, 0x66, 0x6f,
-  0x72, 0x64, 0x20, 0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74, 0x79,
-  0x20, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x6b, 0x65, 0x79, 0x77, 0x6f,
-  0x72, 0x64, 0x73, 0x22, 0x20, 0x63, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22,
-  0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x74, 0x68,
-  0x65, 0x20, 0x55, 0x6e, 0x69, 0x74, 0x65, 0x64, 0x20, 0x4b, 0x69, 0x6e, 0x67,
-  0x64, 0x6f, 0x6d, 0x66, 0x65, 0x64, 0x65, 0x72, 0x61, 0x6c, 0x20, 0x67, 0x6f,
-  0x76, 0x65, 0x72, 0x6e, 0x6d, 0x65, 0x6e, 0x74, 0x3c, 0x64, 0x69, 0x76, 0x20,
-  0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e,
-  0x20, 0x64, 0x65, 0x70, 0x65, 0x6e, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x6e,
-  0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x64, 0x69,
-  0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x68, 0x65, 0x61, 0x64,
-  0x65, 0x72, 0x2e, 0x6d, 0x69, 0x6e, 0x2e, 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f,
-  0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x64, 0x65, 0x73, 0x74, 0x72, 0x75,
-  0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x73,
-  0x6c, 0x69, 0x67, 0x68, 0x74, 0x6c, 0x79, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65,
-  0x72, 0x65, 0x6e, 0x74, 0x69, 0x6e, 0x20, 0x61, 0x63, 0x63, 0x6f, 0x72, 0x64,
-  0x61, 0x6e, 0x63, 0x65, 0x20, 0x77, 0x69, 0x74, 0x68, 0x74, 0x65, 0x6c, 0x65,
-  0x63, 0x6f, 0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x73, 0x69, 0x6e, 0x64, 0x69, 0x63, 0x61, 0x74, 0x65, 0x73, 0x20, 0x74, 0x68,
-  0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x6c, 0x79,
-  0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x61, 0x66, 0x74, 0x65, 0x72, 0x65, 0x73,
-  0x70, 0x65, 0x63, 0x69, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x69, 0x6e, 0x20, 0x74,
-  0x68, 0x65, 0x20, 0x45, 0x75, 0x72, 0x6f, 0x70, 0x65, 0x61, 0x6e, 0x20, 0x63,
-  0x6f, 0x75, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x48, 0x6f, 0x77, 0x65, 0x76,
-  0x65, 0x72, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x72, 0x65, 0x20, 0x61, 0x72, 0x65,
-  0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x73,
-  0x74, 0x61, 0x74, 0x69, 0x63, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x65,
-  0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x22, 0x20, 0x73,
-  0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77,
-  0x77, 0x2e, 0x61, 0x20, 0x6c, 0x61, 0x72, 0x67, 0x65, 0x20, 0x6e, 0x75, 0x6d,
-  0x62, 0x65, 0x72, 0x20, 0x6f, 0x66, 0x20, 0x54, 0x65, 0x6c, 0x65, 0x63, 0x6f,
-  0x6d, 0x6d, 0x75, 0x6e, 0x69, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x22,
-  0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x6e, 0x6f, 0x66, 0x6f, 0x6c, 0x6c, 0x6f,
-  0x77, 0x22, 0x20, 0x74, 0x48, 0x6f, 0x6c, 0x79, 0x20, 0x52, 0x6f, 0x6d, 0x61,
-  0x6e, 0x20, 0x45, 0x6d, 0x70, 0x65, 0x72, 0x6f, 0x72, 0x61, 0x6c, 0x6d, 0x6f,
-  0x73, 0x74, 0x20, 0x65, 0x78, 0x63, 0x6c, 0x75, 0x73, 0x69, 0x76, 0x65, 0x6c,
-  0x79, 0x22, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65, 0x72, 0x3d, 0x22, 0x30, 0x22,
-  0x20, 0x61, 0x6c, 0x74, 0x3d, 0x22, 0x53, 0x65, 0x63, 0x72, 0x65, 0x74, 0x61,
-  0x72, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x53, 0x74, 0x61, 0x74, 0x65, 0x63, 0x75,
-  0x6c, 0x6d, 0x69, 0x6e, 0x61, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x69, 0x6e, 0x20,
-  0x74, 0x68, 0x65, 0x43, 0x49, 0x41, 0x20, 0x57, 0x6f, 0x72, 0x6c, 0x64, 0x20,
-  0x46, 0x61, 0x63, 0x74, 0x62, 0x6f, 0x6f, 0x6b, 0x74, 0x68, 0x65, 0x20, 0x6d,
-  0x6f, 0x73, 0x74, 0x20, 0x69, 0x6d, 0x70, 0x6f, 0x72, 0x74, 0x61, 0x6e, 0x74,
-  0x61, 0x6e, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x61, 0x72, 0x79, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x62,
-  0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x2d, 0x3c, 0x6c, 0x69,
-  0x3e, 0x3c, 0x65, 0x6d, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d,
-  0x22, 0x2f, 0x74, 0x68, 0x65, 0x20, 0x41, 0x74, 0x6c, 0x61, 0x6e, 0x74, 0x69,
-  0x63, 0x20, 0x4f, 0x63, 0x65, 0x61, 0x6e, 0x73, 0x74, 0x72, 0x69, 0x63, 0x74,
-  0x6c, 0x79, 0x20, 0x73, 0x70, 0x65, 0x61, 0x6b, 0x69, 0x6e, 0x67, 0x2c, 0x73,
-  0x68, 0x6f, 0x72, 0x74, 0x6c, 0x79, 0x20, 0x62, 0x65, 0x66, 0x6f, 0x72, 0x65,
-  0x20, 0x74, 0x68, 0x65, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74,
-  0x20, 0x74, 0x79, 0x70, 0x65, 0x73, 0x20, 0x6f, 0x66, 0x74, 0x68, 0x65, 0x20,
-  0x4f, 0x74, 0x74, 0x6f, 0x6d, 0x61, 0x6e, 0x20, 0x45, 0x6d, 0x70, 0x69, 0x72,
-  0x65, 0x3e, 0x3c, 0x69, 0x6d, 0x67, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68,
-  0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x41, 0x6e, 0x20, 0x49, 0x6e, 0x74, 0x72,
-  0x6f, 0x64, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x63, 0x6f,
-  0x6e, 0x73, 0x65, 0x71, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x20, 0x6f, 0x66, 0x20,
-  0x74, 0x68, 0x65, 0x64, 0x65, 0x70, 0x61, 0x72, 0x74, 0x75, 0x72, 0x65, 0x20,
-  0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68, 0x65, 0x43, 0x6f, 0x6e, 0x66, 0x65,
-  0x64, 0x65, 0x72, 0x61, 0x74, 0x65, 0x20, 0x53, 0x74, 0x61, 0x74, 0x65, 0x73,
-  0x69, 0x6e, 0x64, 0x69, 0x67, 0x65, 0x6e, 0x6f, 0x75, 0x73, 0x20, 0x70, 0x65,
-  0x6f, 0x70, 0x6c, 0x65, 0x73, 0x50, 0x72, 0x6f, 0x63, 0x65, 0x65, 0x64, 0x69,
-  0x6e, 0x67, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x69, 0x6e, 0x66,
-  0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x6e, 0x20, 0x74,
-  0x68, 0x65, 0x74, 0x68, 0x65, 0x6f, 0x72, 0x69, 0x65, 0x73, 0x20, 0x68, 0x61,
-  0x76, 0x65, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x69, 0x6e, 0x76, 0x6f, 0x6c, 0x76,
-  0x65, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x64,
-  0x69, 0x76, 0x69, 0x64, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x74, 0x6f, 0x20, 0x74,
-  0x68, 0x72, 0x65, 0x65, 0x61, 0x64, 0x6a, 0x61, 0x63, 0x65, 0x6e, 0x74, 0x20,
-  0x63, 0x6f, 0x75, 0x6e, 0x74, 0x72, 0x69, 0x65, 0x73, 0x69, 0x73, 0x20, 0x72,
-  0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x69, 0x62, 0x6c, 0x65, 0x20, 0x66, 0x6f,
-  0x72, 0x64, 0x69, 0x73, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x20,
-  0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6c, 0x6c, 0x61, 0x62, 0x6f,
-  0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x77, 0x69, 0x74, 0x68, 0x77, 0x69,
-  0x64, 0x65, 0x6c, 0x79, 0x20, 0x72, 0x65, 0x67, 0x61, 0x72, 0x64, 0x65, 0x64,
-  0x20, 0x61, 0x73, 0x68, 0x69, 0x73, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6d,
-  0x70, 0x6f, 0x72, 0x61, 0x72, 0x69, 0x65, 0x73, 0x66, 0x6f, 0x75, 0x6e, 0x64,
-  0x69, 0x6e, 0x67, 0x20, 0x6d, 0x65, 0x6d, 0x62, 0x65, 0x72, 0x20, 0x6f, 0x66,
-  0x44, 0x6f, 0x6d, 0x69, 0x6e, 0x69, 0x63, 0x61, 0x6e, 0x20, 0x52, 0x65, 0x70,
-  0x75, 0x62, 0x6c, 0x69, 0x63, 0x67, 0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x6c,
-  0x79, 0x20, 0x61, 0x63, 0x63, 0x65, 0x70, 0x74, 0x65, 0x64, 0x74, 0x68, 0x65,
-  0x20, 0x70, 0x6f, 0x73, 0x73, 0x69, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x79, 0x20,
-  0x6f, 0x66, 0x61, 0x72, 0x65, 0x20, 0x61, 0x6c, 0x73, 0x6f, 0x20, 0x61, 0x76,
-  0x61, 0x69, 0x6c, 0x61, 0x62, 0x6c, 0x65, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x20,
-  0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x72,
-  0x65, 0x73, 0x74, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66,
-  0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x67, 0x65, 0x6e, 0x65, 0x72,
-  0x61, 0x6c, 0x20, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x69, 0x73, 0x20, 0x61,
-  0x6c, 0x6d, 0x6f, 0x73, 0x74, 0x20, 0x65, 0x6e, 0x74, 0x69, 0x72, 0x65, 0x6c,
-  0x79, 0x70, 0x61, 0x73, 0x73, 0x65, 0x73, 0x20, 0x74, 0x68, 0x72, 0x6f, 0x75,
-  0x67, 0x68, 0x20, 0x74, 0x68, 0x65, 0x68, 0x61, 0x73, 0x20, 0x62, 0x65, 0x65,
-  0x6e, 0x20, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74, 0x65, 0x64, 0x63, 0x6f,
-  0x6d, 0x70, 0x75, 0x74, 0x65, 0x72, 0x20, 0x61, 0x6e, 0x64, 0x20, 0x76, 0x69,
-  0x64, 0x65, 0x6f, 0x47, 0x65, 0x72, 0x6d, 0x61, 0x6e, 0x69, 0x63, 0x20, 0x6c,
-  0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x73, 0x20, 0x61, 0x63, 0x63, 0x6f,
-  0x72, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20,
-  0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x20, 0x66, 0x72, 0x6f,
-  0x6d, 0x20, 0x74, 0x68, 0x65, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x6c, 0x79, 0x20,
-  0x61, 0x66, 0x74, 0x65, 0x72, 0x77, 0x61, 0x72, 0x64, 0x73, 0x68, 0x72, 0x65,
-  0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x73, 0x3a, 0x2f, 0x2f, 0x77, 0x77,
-  0x77, 0x2e, 0x72, 0x65, 0x63, 0x65, 0x6e, 0x74, 0x20, 0x64, 0x65, 0x76, 0x65,
-  0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x42, 0x6f, 0x61, 0x72, 0x64, 0x20,
-  0x6f, 0x66, 0x20, 0x44, 0x69, 0x72, 0x65, 0x63, 0x74, 0x6f, 0x72, 0x73, 0x3c,
-  0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x73, 0x65,
-  0x61, 0x72, 0x63, 0x68, 0x7c, 0x20, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66,
-  0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x49, 0x6e, 0x20, 0x70,
-  0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c, 0x61, 0x72, 0x2c, 0x20, 0x74, 0x68,
-  0x65, 0x4d, 0x75, 0x6c, 0x74, 0x69, 0x70, 0x6c, 0x65, 0x20, 0x66, 0x6f, 0x6f,
-  0x74, 0x6e, 0x6f, 0x74, 0x65, 0x73, 0x6f, 0x72, 0x20, 0x6f, 0x74, 0x68, 0x65,
-  0x72, 0x20, 0x73, 0x75, 0x62, 0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x74, 0x68,
-  0x6f, 0x75, 0x73, 0x61, 0x6e, 0x64, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x79, 0x65,
-  0x61, 0x72, 0x73, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x6c, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x3c, 0x2f, 0x64, 0x69, 0x76,
-  0x3e, 0x0d, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a, 0x0d, 0x0a,
-  0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x69, 0x6e, 0x64, 0x65,
-  0x78, 0x2e, 0x70, 0x68, 0x70, 0x77, 0x61, 0x73, 0x20, 0x65, 0x73, 0x74, 0x61,
-  0x62, 0x6c, 0x69, 0x73, 0x68, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x6d, 0x69, 0x6e,
-  0x2e, 0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x3e, 0x0a, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x74, 0x65,
-  0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x61, 0x20, 0x73, 0x74, 0x72, 0x6f,
-  0x6e, 0x67, 0x20, 0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x73,
-  0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d,
-  0x74, 0x6f, 0x70, 0x3a, 0x72, 0x65, 0x70, 0x72, 0x65, 0x73, 0x65, 0x6e, 0x74,
-  0x65, 0x64, 0x20, 0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x67, 0x72, 0x61, 0x64,
-  0x75, 0x61, 0x74, 0x65, 0x64, 0x20, 0x66, 0x72, 0x6f, 0x6d, 0x20, 0x74, 0x68,
-  0x65, 0x54, 0x72, 0x61, 0x64, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x6c,
-  0x79, 0x2c, 0x20, 0x74, 0x68, 0x65, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74,
-  0x28, 0x22, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x22, 0x29, 0x3b, 0x48, 0x6f,
-  0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x20, 0x73, 0x69, 0x6e, 0x63, 0x65, 0x20,
-  0x74, 0x68, 0x65, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x2f, 0x64, 0x69,
-  0x76, 0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x6c, 0x65, 0x66, 0x74, 0x3b,
-  0x20, 0x6d, 0x61, 0x72, 0x67, 0x69, 0x6e, 0x2d, 0x6c, 0x65, 0x66, 0x74, 0x3a,
-  0x70, 0x72, 0x6f, 0x74, 0x65, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x61, 0x67,
-  0x61, 0x69, 0x6e, 0x73, 0x74, 0x30, 0x3b, 0x20, 0x76, 0x65, 0x72, 0x74, 0x69,
-  0x63, 0x61, 0x6c, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x55, 0x6e, 0x66,
-  0x6f, 0x72, 0x74, 0x75, 0x6e, 0x61, 0x74, 0x65, 0x6c, 0x79, 0x2c, 0x20, 0x74,
-  0x68, 0x65, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x69, 0x6d, 0x61, 0x67, 0x65,
-  0x2f, 0x78, 0x2d, 0x69, 0x63, 0x6f, 0x6e, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a,
-  0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x20,
-  0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x63, 0x6c, 0x65, 0x61, 0x72, 0x66,
-  0x69, 0x78, 0x22, 0x3e, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73,
-  0x73, 0x3d, 0x22, 0x66, 0x6f, 0x6f, 0x74, 0x65, 0x72, 0x09, 0x09, 0x3c, 0x2f,
-  0x64, 0x69, 0x76, 0x3e, 0x0a, 0x09, 0x09, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e,
-  0x0a, 0x74, 0x68, 0x65, 0x20, 0x6d, 0x6f, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x70,
-  0x69, 0x63, 0x74, 0x75, 0x72, 0x65, 0xd0, 0x91, 0xd1, 0x8a, 0xd0, 0xbb, 0xd0,
-  0xb3, 0xd0, 0xb0, 0xd1, 0x80, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb8, 0xd0, 0xb1,
-  0xd1, 0x8a, 0xd0, 0xbb, 0xd0, 0xb3, 0xd0, 0xb0, 0xd1, 0x80, 0xd1, 0x81, 0xd0,
-  0xba, 0xd0, 0xb8, 0xd0, 0xa4, 0xd0, 0xb5, 0xd0, 0xb4, 0xd0, 0xb5, 0xd1, 0x80,
-  0xd0, 0xb0, 0xd1, 0x86, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xbd, 0xd0, 0xb5, 0xd1,
-  0x81, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xbb, 0xd1, 0x8c, 0xd0, 0xba, 0xd0, 0xbe,
-  0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xbe, 0xd0, 0xb1, 0xd1, 0x89, 0xd0, 0xb5, 0xd0,
-  0xbd, 0xd0, 0xb8, 0xd0, 0xb5, 0xd1, 0x81, 0xd0, 0xbe, 0xd0, 0xbe, 0xd0, 0xb1,
-  0xd1, 0x89, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0, 0xbf, 0xd1,
-  0x80, 0xd0, 0xbe, 0xd0, 0xb3, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbc, 0xd0, 0xbc,
-  0xd1, 0x8b, 0xd0, 0x9e, 0xd1, 0x82, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xb0, 0xd0,
-  0xb2, 0xd0, 0xb8, 0xd1, 0x82, 0xd1, 0x8c, 0xd0, 0xb1, 0xd0, 0xb5, 0xd1, 0x81,
-  0xd0, 0xbf, 0xd0, 0xbb, 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xbd, 0xd0, 0xbe, 0xd0,
-  0xbc, 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xb0,
-  0xd0, 0xbb, 0xd1, 0x8b, 0xd0, 0xbf, 0xd0, 0xbe, 0xd0, 0xb7, 0xd0, 0xb2, 0xd0,
-  0xbe, 0xd0, 0xbb, 0xd1, 0x8f, 0xd0, 0xb5, 0xd1, 0x82, 0xd0, 0xbf, 0xd0, 0xbe,
-  0xd1, 0x81, 0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xb4, 0xd0, 0xbd, 0xd0, 0xb8, 0xd0,
-  0xb5, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb7, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x87,
-  0xd0, 0xbd, 0xd1, 0x8b, 0xd1, 0x85, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xbe, 0xd0,
-  0xb4, 0xd1, 0x83, 0xd0, 0xba, 0xd1, 0x86, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xbf,
-  0xd1, 0x80, 0xd0, 0xbe, 0xd0, 0xb3, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbc, 0xd0,
-  0xbc, 0xd0, 0xb0, 0xd0, 0xbf, 0xd0, 0xbe, 0xd0, 0xbb, 0xd0, 0xbd, 0xd0, 0xbe,
-  0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x8c, 0xd1, 0x8e, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1,
-  0x85, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb8, 0xd1, 0x82, 0xd1, 0x81, 0xd1, 0x8f,
-  0xd0, 0xb8, 0xd0, 0xb7, 0xd0, 0xb1, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0,
-  0xbd, 0xd0, 0xbe, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xb5,
-  0xd0, 0xbb, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0, 0xb8, 0xd0,
-  0xb7, 0xd0, 0xbc, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8,
-  0xd1, 0x8f, 0xd0, 0xba, 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0,
-  0xbe, 0xd1, 0x80, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0x90, 0xd0, 0xbb, 0xd0, 0xb5,
-  0xd0, 0xba, 0xd1, 0x81, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb4, 0xd1, 0x80, 0xe0,
-  0xa4, 0xa6, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0xa8,
-  0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xaa, 0xe0,
-  0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0xa8, 0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa4,
-  0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xa8, 0xe0,
-  0xa5, 0x81, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4,
-  0xb9, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa6,
-  0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa1, 0xe0,
-  0xa4, 0xbf, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4,
-  0xbf, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x80,
-  0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xa7, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb5, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
-  0xa1, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x9a,
-  0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa0, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0x9a, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0x82,
-  0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xa8, 0xe0,
-  0xa4, 0xa6, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
-  0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0,
-  0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0x85, 0xe0,
-  0xa4, 0xa8, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0xb0, 0xe0, 0xa4, 0x91, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
-  0xb6, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8b,
-  0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x95, 0xe0,
-  0xa4, 0xb8, 0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xab, 0xe0, 0xa4,
-  0xbc, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x88, 0xe0, 0xa4, 0xb6,
-  0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa4, 0xe0,
-  0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
-  0xb0, 0xe0, 0xa4, 0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xaa,
-  0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xaf, 0xe0,
-  0xa4, 0xb0, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4,
-  0xa6, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbf, 0xe0,
-  0xa4, 0x89, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x9a, 0xe0,
-  0xa4, 0xbf, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa0, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x8d, 0xe0,
-  0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0xaa, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8,
-  0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xa1, 0xe0,
-  0xa4, 0xbc, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x85, 0xe0, 0xa4,
-  0xa8, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa6,
-  0xe0, 0xa4, 0xb6, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0,
-  0xa4, 0xa3, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
-  0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb7, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8,
-  0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x97, 0xe0, 0xa5,
-  0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb9, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb0,
-  0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa3, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0,
-  0xa4, 0xac, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0x82, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0x9a, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0x9a, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x89, 0xe0,
-  0xa4, 0xaa, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
-  0xa7, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82, 0xe0,
-  0xa4, 0xaa, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0x95, 0xe0, 0xa4,
-  0x89, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x80,
-  0xe0, 0xa4, 0xa6, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa7, 0xe0,
-  0xa5, 0x8d, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4,
-  0xb9, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xac, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa6, 0xe0,
-  0xa5, 0x8b, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x80, 0xe0, 0xa4,
-  0xa1, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x86,
-  0xe0, 0xa4, 0x88, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x8f, 0xe0,
-  0xa4, 0xb2, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xac, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0x87, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82,
-  0xe0, 0xa4, 0x96, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0x86, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0, 0xa4,
-  0xb6, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x85, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x81,
-  0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa7, 0xe0, 0xa4, 0xac, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbc, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0xb0, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xb5, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xa8,
-  0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8d, 0xe0,
-  0xa4, 0xb0, 0xe0, 0xa4, 0xae, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x96, 0xe0, 0xa4,
-  0xaa, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb6, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xaa, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbf, 0xe0,
-  0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5,
-  0x81, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8,
-  0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0,
-  0xa4, 0xa5, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x86, 0xe0, 0xa4, 0xaf, 0xe0, 0xa5,
-  0x8b, 0xe0, 0xa4, 0x9c, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xb8,
-  0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0xb0, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb4, 0xd8, 0xa7, 0xd8,
-  0xb1, 0xd9, 0x83, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85,
-  0xd9, 0x86, 0xd8, 0xaa, 0xd8, 0xaf, 0xd9, 0x8a, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd9, 0x83, 0xd9, 0x85, 0xd8, 0xa8, 0xd9, 0x8a, 0xd9, 0x88,
-  0xd8, 0xaa, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb4, 0xd8,
-  0xa7, 0xd9, 0x87, 0xd8, 0xaf, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xb9, 0xd8, 0xaf,
-  0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb2, 0xd9, 0x88, 0xd8, 0xa7, 0xd8,
-  0xb1, 0xd8, 0xb9, 0xd8, 0xaf, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xb1,
-  0xd8, 0xaf, 0xd9, 0x88, 0xd8, 0xaf, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa5, 0xd8,
-  0xb3, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x85, 0xd9, 0x8a, 0xd8, 0xa9, 0xd8, 0xa7,
-  0xd9, 0x84, 0xd9, 0x81, 0xd9, 0x88, 0xd8, 0xaa, 0xd9, 0x88, 0xd8, 0xb4, 0xd9,
-  0x88, 0xd8, 0xa8, 0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb3, 0xd8, 0xa7,
-  0xd8, 0xa8, 0xd9, 0x82, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd9,
-  0x85, 0xd8, 0xb9, 0xd9, 0x84, 0xd9, 0x88, 0xd9, 0x85, 0xd8, 0xa7, 0xd8, 0xaa,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xb3, 0xd9, 0x84, 0xd8, 0xb3, 0xd9,
-  0x84, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xac, 0xd8, 0xb1,
-  0xd8, 0xa7, 0xd9, 0x81, 0xd9, 0x8a, 0xd9, 0x83, 0xd8, 0xb3, 0xd8, 0xa7, 0xd9,
-  0x84, 0xd8, 0xa7, 0xd8, 0xb3, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x85, 0xd9, 0x8a,
-  0xd8, 0xa9, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd8, 0xaa, 0xd8, 0xb5, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd8, 0xaa, 0x6b, 0x65, 0x79, 0x77, 0x6f, 0x72,
-  0x64, 0x73, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22,
-  0x77, 0x33, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x31, 0x39, 0x39, 0x39, 0x2f, 0x78,
-  0x68, 0x74, 0x6d, 0x6c, 0x22, 0x3e, 0x3c, 0x61, 0x20, 0x74, 0x61, 0x72, 0x67,
-  0x65, 0x74, 0x3d, 0x22, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x22, 0x20, 0x74,
-  0x65, 0x78, 0x74, 0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3b, 0x20, 0x63, 0x68, 0x61,
-  0x72, 0x73, 0x65, 0x74, 0x3d, 0x22, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74,
-  0x3d, 0x22, 0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x22, 0x3e, 0x3c, 0x74, 0x61,
-  0x62, 0x6c, 0x65, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x70, 0x61, 0x64, 0x64, 0x69,
-  0x6e, 0x67, 0x3d, 0x22, 0x61, 0x75, 0x74, 0x6f, 0x63, 0x6f, 0x6d, 0x70, 0x6c,
-  0x65, 0x74, 0x65, 0x3d, 0x22, 0x6f, 0x66, 0x66, 0x22, 0x20, 0x74, 0x65, 0x78,
-  0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a, 0x20, 0x63, 0x65, 0x6e, 0x74,
-  0x65, 0x72, 0x3b, 0x74, 0x6f, 0x20, 0x6c, 0x61, 0x73, 0x74, 0x20, 0x76, 0x65,
-  0x72, 0x73, 0x69, 0x6f, 0x6e, 0x20, 0x62, 0x79, 0x20, 0x62, 0x61, 0x63, 0x6b,
-  0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x2d, 0x63, 0x6f, 0x6c, 0x6f, 0x72, 0x3a,
-  0x20, 0x23, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74,
-  0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x2f, 0x64, 0x69, 0x76, 0x3e,
-  0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x69, 0x64,
-  0x3d, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x23, 0x22, 0x20,
-  0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x22, 0x3e, 0x3c, 0x69, 0x6d, 0x67,
-  0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f,
-  0x63, 0x72, 0x69, 0x70, 0x74, 0x22, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68,
-  0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x0a, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70,
-  0x74, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x3d, 0x22, 0x2f,
-  0x2f, 0x45, 0x4e, 0x22, 0x20, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f,
-  0x77, 0x77, 0x77, 0x2e, 0x77, 0x65, 0x6e, 0x63, 0x6f, 0x64, 0x65, 0x55, 0x52,
-  0x49, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x28, 0x22, 0x20,
-  0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72,
-  0x69, 0x70, 0x74, 0x3a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73,
-  0x73, 0x3d, 0x22, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x64, 0x6f, 0x63,
-  0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x77, 0x72, 0x69, 0x74, 0x65, 0x28, 0x27,
-  0x3c, 0x73, 0x63, 0x70, 0x6f, 0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x20,
-  0x61, 0x62, 0x73, 0x6f, 0x6c, 0x75, 0x74, 0x65, 0x3b, 0x73, 0x63, 0x72, 0x69,
-  0x70, 0x74, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a,
-  0x2f, 0x2f, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x6d, 0x61, 0x72,
-  0x67, 0x69, 0x6e, 0x2d, 0x74, 0x6f, 0x70, 0x3a, 0x2e, 0x6d, 0x69, 0x6e, 0x2e,
-  0x6a, 0x73, 0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e,
-  0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20,
-  0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x77, 0x33, 0x2e, 0x6f, 0x72, 0x67,
-  0x2f, 0x31, 0x39, 0x39, 0x39, 0x2f, 0x78, 0x68, 0x74, 0x6d, 0x6c, 0x22, 0x20,
-  0x0a, 0x0d, 0x0a, 0x3c, 0x2f, 0x62, 0x6f, 0x64, 0x79, 0x3e, 0x0d, 0x0a, 0x3c,
-  0x2f, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x64, 0x69, 0x73, 0x74, 0x69, 0x6e, 0x63,
-  0x74, 0x69, 0x6f, 0x6e, 0x20, 0x62, 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x2f,
-  0x22, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x3d, 0x22, 0x5f, 0x62, 0x6c,
-  0x61, 0x6e, 0x6b, 0x22, 0x3e, 0x3c, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x68, 0x72,
-  0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x65, 0x6e,
-  0x63, 0x6f, 0x64, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x75, 0x74, 0x66, 0x2d, 0x38,
-  0x22, 0x3f, 0x3e, 0x0a, 0x77, 0x2e, 0x61, 0x64, 0x64, 0x45, 0x76, 0x65, 0x6e,
-  0x74, 0x4c, 0x69, 0x73, 0x74, 0x65, 0x6e, 0x65, 0x72, 0x3f, 0x61, 0x63, 0x74,
-  0x69, 0x6f, 0x6e, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77,
-  0x77, 0x77, 0x2e, 0x69, 0x63, 0x6f, 0x6e, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66,
-  0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x20, 0x73, 0x74, 0x79,
-  0x6c, 0x65, 0x3d, 0x22, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e,
-  0x64, 0x3a, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f,
-  0x63, 0x73, 0x73, 0x22, 0x20, 0x2f, 0x3e, 0x0a, 0x6d, 0x65, 0x74, 0x61, 0x20,
-  0x70, 0x72, 0x6f, 0x70, 0x65, 0x72, 0x74, 0x79, 0x3d, 0x22, 0x6f, 0x67, 0x3a,
-  0x74, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d,
-  0x22, 0x74, 0x65, 0x78, 0x74, 0x22, 0x20, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65,
-  0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x61, 0x6c, 0x69, 0x67, 0x6e, 0x3a,
-  0x74, 0x68, 0x65, 0x20, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x6d, 0x65,
-  0x6e, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x68, 0x65,
-  0x65, 0x74, 0x22, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x68,
-  0x74, 0x6d, 0x6c, 0x3b, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d,
-  0x75, 0x74, 0x66, 0x2d, 0x38, 0x69, 0x73, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69,
-  0x64, 0x65, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x62, 0x65, 0x74, 0x61,
-  0x62, 0x6c, 0x65, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x31, 0x30,
-  0x30, 0x25, 0x22, 0x20, 0x49, 0x6e, 0x20, 0x61, 0x64, 0x64, 0x69, 0x74, 0x69,
-  0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x20, 0x63, 0x6f, 0x6e,
-  0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x74,
-  0x68, 0x65, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x63, 0x65,
-  0x73, 0x20, 0x62, 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x64, 0x65, 0x76, 0x65,
-  0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
-  0x65, 0x20, 0x49, 0x74, 0x20, 0x69, 0x73, 0x20, 0x69, 0x6d, 0x70, 0x6f, 0x72,
-  0x74, 0x61, 0x6e, 0x74, 0x20, 0x74, 0x6f, 0x20, 0x3c, 0x2f, 0x73, 0x63, 0x72,
-  0x69, 0x70, 0x74, 0x3e, 0x0a, 0x0a, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x20, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x66, 0x6f, 0x6e, 0x74,
-  0x2d, 0x73, 0x69, 0x7a, 0x65, 0x3a, 0x31, 0x3e, 0x3c, 0x2f, 0x73, 0x70, 0x61,
-  0x6e, 0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x69, 0x64, 0x3d, 0x67, 0x62,
-  0x4c, 0x69, 0x62, 0x72, 0x61, 0x72, 0x79, 0x20, 0x6f, 0x66, 0x20, 0x43, 0x6f,
-  0x6e, 0x67, 0x72, 0x65, 0x73, 0x73, 0x3c, 0x69, 0x6d, 0x67, 0x20, 0x73, 0x72,
-  0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x69, 0x6d, 0x45,
-  0x6e, 0x67, 0x6c, 0x69, 0x73, 0x68, 0x20, 0x74, 0x72, 0x61, 0x6e, 0x73, 0x6c,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x41, 0x63, 0x61, 0x64, 0x65, 0x6d, 0x79, 0x20,
-  0x6f, 0x66, 0x20, 0x53, 0x63, 0x69, 0x65, 0x6e, 0x63, 0x65, 0x73, 0x64, 0x69,
-  0x76, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x70,
-  0x6c, 0x61, 0x79, 0x3a, 0x63, 0x6f, 0x6e, 0x73, 0x74, 0x72, 0x75, 0x63, 0x74,
-  0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x2e, 0x67, 0x65,
-  0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x42, 0x79, 0x49, 0x64, 0x28,
-  0x69, 0x64, 0x29, 0x69, 0x6e, 0x20, 0x63, 0x6f, 0x6e, 0x6a, 0x75, 0x6e, 0x63,
-  0x74, 0x69, 0x6f, 0x6e, 0x20, 0x77, 0x69, 0x74, 0x68, 0x45, 0x6c, 0x65, 0x6d,
-  0x65, 0x6e, 0x74, 0x28, 0x27, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x27, 0x29,
-  0x3b, 0x20, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x70, 0x72, 0x6f, 0x70, 0x65,
-  0x72, 0x74, 0x79, 0x3d, 0x22, 0x6f, 0x67, 0x3a, 0xd0, 0x91, 0xd1, 0x8a, 0xd0,
-  0xbb, 0xd0, 0xb3, 0xd0, 0xb0, 0xd1, 0x80, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xb8,
-  0x0a, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x22,
-  0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x3e, 0x50, 0x72, 0x69, 0x76, 0x61,
-  0x63, 0x79, 0x20, 0x50, 0x6f, 0x6c, 0x69, 0x63, 0x79, 0x3c, 0x2f, 0x61, 0x3e,
-  0x61, 0x64, 0x6d, 0x69, 0x6e, 0x69, 0x73, 0x74, 0x65, 0x72, 0x65, 0x64, 0x20,
-  0x62, 0x79, 0x20, 0x74, 0x68, 0x65, 0x65, 0x6e, 0x61, 0x62, 0x6c, 0x65, 0x53,
-  0x69, 0x6e, 0x67, 0x6c, 0x65, 0x52, 0x65, 0x71, 0x75, 0x65, 0x73, 0x74, 0x73,
-  0x74, 0x79, 0x6c, 0x65, 0x3d, 0x26, 0x71, 0x75, 0x6f, 0x74, 0x3b, 0x6d, 0x61,
-  0x72, 0x67, 0x69, 0x6e, 0x3a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f,
-  0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x3e, 0x3c,
-  0x69, 0x6d, 0x67, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70,
-  0x3a, 0x2f, 0x2f, 0x69, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x26, 0x71,
-  0x75, 0x6f, 0x74, 0x3b, 0x66, 0x6c, 0x6f, 0x61, 0x74, 0x3a, 0x72, 0x65, 0x66,
-  0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x61, 0x73, 0x20, 0x74,
-  0x68, 0x65, 0x20, 0x74, 0x6f, 0x74, 0x61, 0x6c, 0x20, 0x70, 0x6f, 0x70, 0x75,
-  0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x69, 0x6e, 0x20, 0x57,
-  0x61, 0x73, 0x68, 0x69, 0x6e, 0x67, 0x74, 0x6f, 0x6e, 0x2c, 0x20, 0x44, 0x2e,
-  0x43, 0x2e, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x62, 0x61, 0x63,
-  0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x2d, 0x61, 0x6d, 0x6f, 0x6e, 0x67,
-  0x20, 0x6f, 0x74, 0x68, 0x65, 0x72, 0x20, 0x74, 0x68, 0x69, 0x6e, 0x67, 0x73,
-  0x2c, 0x6f, 0x72, 0x67, 0x61, 0x6e, 0x69, 0x7a, 0x61, 0x74, 0x69, 0x6f, 0x6e,
-  0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63,
-  0x69, 0x70, 0x61, 0x74, 0x65, 0x64, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65,
-  0x74, 0x68, 0x65, 0x20, 0x69, 0x6e, 0x74, 0x72, 0x6f, 0x64, 0x75, 0x63, 0x74,
-  0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x69, 0x64, 0x65, 0x6e, 0x74, 0x69, 0x66,
-  0x69, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x66,
-  0x69, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x20, 0x63, 0x68, 0x61, 0x72,
-  0x61, 0x63, 0x74, 0x65, 0x72, 0x20, 0x4f, 0x78, 0x66, 0x6f, 0x72, 0x64, 0x20,
-  0x55, 0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74, 0x79, 0x20, 0x6d, 0x69,
-  0x73, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x73, 0x74, 0x61, 0x6e, 0x64, 0x69, 0x6e,
-  0x67, 0x20, 0x6f, 0x66, 0x54, 0x68, 0x65, 0x72, 0x65, 0x20, 0x61, 0x72, 0x65,
-  0x2c, 0x20, 0x68, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c, 0x73, 0x74, 0x79,
-  0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66,
-  0x3d, 0x22, 0x2f, 0x43, 0x6f, 0x6c, 0x75, 0x6d, 0x62, 0x69, 0x61, 0x20, 0x55,
-  0x6e, 0x69, 0x76, 0x65, 0x72, 0x73, 0x69, 0x74, 0x79, 0x65, 0x78, 0x70, 0x61,
-  0x6e, 0x64, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x69, 0x6e, 0x63, 0x6c, 0x75,
-  0x64, 0x65, 0x75, 0x73, 0x75, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x72, 0x65, 0x66,
-  0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x69, 0x6e, 0x64, 0x69, 0x63,
-  0x61, 0x74, 0x69, 0x6e, 0x67, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x74, 0x68,
-  0x65, 0x68, 0x61, 0x76, 0x65, 0x20, 0x73, 0x75, 0x67, 0x67, 0x65, 0x73, 0x74,
-  0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x61, 0x66, 0x66, 0x69, 0x6c, 0x69,
-  0x61, 0x74, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65,
-  0x63, 0x6f, 0x72, 0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x62,
-  0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x20,
-  0x6f, 0x66, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x3e,
-  0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x3c, 0x2f, 0x74, 0x72, 0x3e, 0x3c, 0x2f, 0x74,
-  0x61, 0x62, 0x6c, 0x65, 0x3e, 0x52, 0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63,
-  0x20, 0x6f, 0x66, 0x20, 0x49, 0x72, 0x65, 0x6c, 0x61, 0x6e, 0x64, 0x0a, 0x3c,
-  0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x3c, 0x73, 0x63, 0x72,
-  0x69, 0x70, 0x74, 0x20, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x20, 0x74, 0x68, 0x65,
-  0x20, 0x69, 0x6e, 0x66, 0x6c, 0x75, 0x65, 0x6e, 0x63, 0x65, 0x63, 0x6f, 0x6e,
-  0x74, 0x72, 0x69, 0x62, 0x75, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x74, 0x6f, 0x20,
-  0x74, 0x68, 0x65, 0x4f, 0x66, 0x66, 0x69, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x77,
-  0x65, 0x62, 0x73, 0x69, 0x74, 0x65, 0x20, 0x6f, 0x66, 0x68, 0x65, 0x61, 0x64,
-  0x71, 0x75, 0x61, 0x72, 0x74, 0x65, 0x72, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74,
-  0x68, 0x65, 0x63, 0x65, 0x6e, 0x74, 0x65, 0x72, 0x65, 0x64, 0x20, 0x61, 0x72,
-  0x6f, 0x75, 0x6e, 0x64, 0x20, 0x74, 0x68, 0x65, 0x69, 0x6d, 0x70, 0x6c, 0x69,
-  0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
-  0x65, 0x68, 0x61, 0x76, 0x65, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x20, 0x64, 0x65,
-  0x76, 0x65, 0x6c, 0x6f, 0x70, 0x65, 0x64, 0x46, 0x65, 0x64, 0x65, 0x72, 0x61,
-  0x6c, 0x20, 0x52, 0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x20, 0x6f, 0x66,
-  0x62, 0x65, 0x63, 0x61, 0x6d, 0x65, 0x20, 0x69, 0x6e, 0x63, 0x72, 0x65, 0x61,
-  0x73, 0x69, 0x6e, 0x67, 0x6c, 0x79, 0x63, 0x6f, 0x6e, 0x74, 0x69, 0x6e, 0x75,
-  0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x4e,
-  0x6f, 0x74, 0x65, 0x2c, 0x20, 0x68, 0x6f, 0x77, 0x65, 0x76, 0x65, 0x72, 0x2c,
-  0x20, 0x74, 0x68, 0x61, 0x74, 0x73, 0x69, 0x6d, 0x69, 0x6c, 0x61, 0x72, 0x20,
-  0x74, 0x6f, 0x20, 0x74, 0x68, 0x61, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x63, 0x61,
-  0x70, 0x61, 0x62, 0x69, 0x6c, 0x69, 0x74, 0x69, 0x65, 0x73, 0x20, 0x6f, 0x66,
-  0x20, 0x74, 0x68, 0x65, 0x61, 0x63, 0x63, 0x6f, 0x72, 0x64, 0x61, 0x6e, 0x63,
-  0x65, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x70, 0x61, 0x72,
-  0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x6e, 0x74, 0x73, 0x20, 0x69, 0x6e, 0x20,
-  0x74, 0x68, 0x65, 0x66, 0x75, 0x72, 0x74, 0x68, 0x65, 0x72, 0x20, 0x64, 0x65,
-  0x76, 0x65, 0x6c, 0x6f, 0x70, 0x6d, 0x65, 0x6e, 0x74, 0x75, 0x6e, 0x64, 0x65,
-  0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x64, 0x69, 0x72, 0x65, 0x63, 0x74, 0x69,
-  0x6f, 0x6e, 0x69, 0x73, 0x20, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x20, 0x63, 0x6f,
-  0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x65, 0x64, 0x68, 0x69, 0x73, 0x20, 0x79,
-  0x6f, 0x75, 0x6e, 0x67, 0x65, 0x72, 0x20, 0x62, 0x72, 0x6f, 0x74, 0x68, 0x65,
-  0x72, 0x3c, 0x2f, 0x74, 0x64, 0x3e, 0x3c, 0x2f, 0x74, 0x72, 0x3e, 0x3c, 0x2f,
-  0x74, 0x61, 0x62, 0x6c, 0x65, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x74, 0x74, 0x70,
-  0x2d, 0x65, 0x71, 0x75, 0x69, 0x76, 0x3d, 0x22, 0x58, 0x2d, 0x55, 0x41, 0x2d,
-  0x70, 0x68, 0x79, 0x73, 0x69, 0x63, 0x61, 0x6c, 0x20, 0x70, 0x72, 0x6f, 0x70,
-  0x65, 0x72, 0x74, 0x69, 0x65, 0x73, 0x6f, 0x66, 0x20, 0x42, 0x72, 0x69, 0x74,
-  0x69, 0x73, 0x68, 0x20, 0x43, 0x6f, 0x6c, 0x75, 0x6d, 0x62, 0x69, 0x61, 0x68,
-  0x61, 0x73, 0x20, 0x62, 0x65, 0x65, 0x6e, 0x20, 0x63, 0x72, 0x69, 0x74, 0x69,
-  0x63, 0x69, 0x7a, 0x65, 0x64, 0x28, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68,
-  0x65, 0x20, 0x65, 0x78, 0x63, 0x65, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x71, 0x75,
-  0x65, 0x73, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x61, 0x62, 0x6f, 0x75, 0x74,
-  0x20, 0x74, 0x68, 0x65, 0x70, 0x61, 0x73, 0x73, 0x69, 0x6e, 0x67, 0x20, 0x74,
-  0x68, 0x72, 0x6f, 0x75, 0x67, 0x68, 0x20, 0x74, 0x68, 0x65, 0x30, 0x22, 0x20,
-  0x63, 0x65, 0x6c, 0x6c, 0x70, 0x61, 0x64, 0x64, 0x69, 0x6e, 0x67, 0x3d, 0x22,
-  0x30, 0x22, 0x20, 0x74, 0x68, 0x6f, 0x75, 0x73, 0x61, 0x6e, 0x64, 0x73, 0x20,
-  0x6f, 0x66, 0x20, 0x70, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x72, 0x65, 0x64, 0x69,
-  0x72, 0x65, 0x63, 0x74, 0x73, 0x20, 0x68, 0x65, 0x72, 0x65, 0x2e, 0x20, 0x46,
-  0x6f, 0x72, 0x68, 0x61, 0x76, 0x65, 0x20, 0x63, 0x68, 0x69, 0x6c, 0x64, 0x72,
-  0x65, 0x6e, 0x20, 0x75, 0x6e, 0x64, 0x65, 0x72, 0x25, 0x33, 0x45, 0x25, 0x33,
-  0x43, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x25, 0x33, 0x45, 0x22, 0x29,
-  0x29, 0x3b, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74,
-  0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x3c, 0x6c, 0x69, 0x3e,
-  0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70,
-  0x3a, 0x2f, 0x2f, 0x73, 0x69, 0x74, 0x65, 0x5f, 0x6e, 0x61, 0x6d, 0x65, 0x22,
-  0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x74, 0x65, 0x78,
-  0x74, 0x2d, 0x64, 0x65, 0x63, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3a,
-  0x6e, 0x6f, 0x6e, 0x65, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x64, 0x69,
-  0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x20, 0x6e, 0x6f, 0x6e, 0x65, 0x3c, 0x6d,
-  0x65, 0x74, 0x61, 0x20, 0x68, 0x74, 0x74, 0x70, 0x2d, 0x65, 0x71, 0x75, 0x69,
-  0x76, 0x3d, 0x22, 0x58, 0x2d, 0x6e, 0x65, 0x77, 0x20, 0x44, 0x61, 0x74, 0x65,
-  0x28, 0x29, 0x2e, 0x67, 0x65, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x28, 0x29, 0x20,
-  0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x2f, 0x78,
-  0x2d, 0x69, 0x63, 0x6f, 0x6e, 0x22, 0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e,
-  0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22,
-  0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x3d, 0x22, 0x6a, 0x61, 0x76,
-  0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x77, 0x69, 0x6e, 0x64, 0x6f, 0x77,
-  0x2e, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e, 0x68, 0x72, 0x65,
-  0x66, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x6a, 0x61, 0x76,
-  0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3a, 0x2d, 0x2d, 0x3e, 0x0d, 0x0a,
-  0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d,
-  0x22, 0x74, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x27, 0x68, 0x74,
-  0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x68, 0x6f, 0x72, 0x74,
-  0x63, 0x75, 0x74, 0x20, 0x69, 0x63, 0x6f, 0x6e, 0x22, 0x20, 0x68, 0x72, 0x65,
-  0x66, 0x3d, 0x22, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0d, 0x0a, 0x3c, 0x64,
-  0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x3c, 0x73, 0x63,
-  0x72, 0x69, 0x70, 0x74, 0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74,
-  0x70, 0x3a, 0x2f, 0x2f, 0x22, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x73, 0x74,
-  0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20, 0x74, 0x3c, 0x2f,
-  0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20,
-  0x74, 0x79, 0x70, 0x65, 0x3d, 0x2f, 0x61, 0x3e, 0x20, 0x3c, 0x61, 0x20, 0x68,
-  0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x20,
-  0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x54, 0x72, 0x61, 0x6e, 0x73, 0x70, 0x61, 0x72,
-  0x65, 0x6e, 0x63, 0x79, 0x3d, 0x22, 0x58, 0x2d, 0x55, 0x41, 0x2d, 0x43, 0x6f,
-  0x6d, 0x70, 0x61, 0x74, 0x69, 0x62, 0x6c, 0x65, 0x22, 0x20, 0x63, 0x6f, 0x6e,
-  0x72, 0x65, 0x6c, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x73, 0x68, 0x69, 0x70, 0x20,
-  0x62, 0x65, 0x74, 0x77, 0x65, 0x65, 0x6e, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72,
-  0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x20, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x3c, 0x2f, 0x75,
-  0x6c, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x61, 0x73, 0x73, 0x6f, 0x63,
-  0x69, 0x61, 0x74, 0x65, 0x64, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68,
-  0x65, 0x20, 0x70, 0x72, 0x6f, 0x67, 0x72, 0x61, 0x6d, 0x6d, 0x69, 0x6e, 0x67,
-  0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x3c, 0x2f, 0x61, 0x3e,
-  0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70,
-  0x3a, 0x2f, 0x2f, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x3c,
-  0x6c, 0x69, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x66, 0x6f, 0x72,
-  0x6d, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x3d, 0x22, 0x68, 0x74, 0x74,
-  0x70, 0x3a, 0x2f, 0x2f, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x73, 0x74, 0x79, 0x6c,
-  0x65, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x74, 0x79,
-  0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x22, 0x20, 0x6e, 0x61, 0x6d,
-  0x65, 0x3d, 0x22, 0x71, 0x22, 0x3c, 0x74, 0x61, 0x62, 0x6c, 0x65, 0x20, 0x77,
-  0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x31, 0x30, 0x30, 0x25, 0x22, 0x20, 0x62,
-  0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x2d, 0x70, 0x6f, 0x73,
-  0x69, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x22, 0x20, 0x62, 0x6f, 0x72, 0x64, 0x65,
-  0x72, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22,
-  0x72, 0x65, 0x6c, 0x3d, 0x22, 0x73, 0x68, 0x6f, 0x72, 0x74, 0x63, 0x75, 0x74,
-  0x20, 0x69, 0x63, 0x6f, 0x6e, 0x22, 0x20, 0x68, 0x36, 0x3e, 0x3c, 0x75, 0x6c,
-  0x3e, 0x3c, 0x6c, 0x69, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d,
-  0x22, 0x20, 0x20, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x68, 0x74, 0x74, 0x70,
-  0x2d, 0x65, 0x71, 0x75, 0x69, 0x76, 0x3d, 0x22, 0x63, 0x73, 0x73, 0x22, 0x20,
-  0x6d, 0x65, 0x64, 0x69, 0x61, 0x3d, 0x22, 0x73, 0x63, 0x72, 0x65, 0x65, 0x6e,
-  0x22, 0x20, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x73, 0x69, 0x62, 0x6c, 0x65,
-  0x20, 0x66, 0x6f, 0x72, 0x20, 0x74, 0x68, 0x65, 0x20, 0x22, 0x20, 0x74, 0x79,
-  0x70, 0x65, 0x3d, 0x22, 0x61, 0x70, 0x70, 0x6c, 0x69, 0x63, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x2f, 0x22, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x3d, 0x22, 0x62,
-  0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f, 0x75, 0x6e, 0x64, 0x2d, 0x68, 0x74, 0x6d,
-  0x6c, 0x3b, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d, 0x75, 0x74,
-  0x66, 0x2d, 0x38, 0x22, 0x20, 0x61, 0x6c, 0x6c, 0x6f, 0x77, 0x74, 0x72, 0x61,
-  0x6e, 0x73, 0x70, 0x61, 0x72, 0x65, 0x6e, 0x63, 0x79, 0x3d, 0x22, 0x73, 0x74,
-  0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20, 0x74, 0x79, 0x70,
-  0x65, 0x3d, 0x22, 0x74, 0x65, 0x0d, 0x0a, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20,
-  0x68, 0x74, 0x74, 0x70, 0x2d, 0x65, 0x71, 0x75, 0x69, 0x76, 0x3d, 0x22, 0x3e,
-  0x3c, 0x2f, 0x73, 0x70, 0x61, 0x6e, 0x3e, 0x3c, 0x73, 0x70, 0x61, 0x6e, 0x20,
-  0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x63, 0x65, 0x6c,
-  0x6c, 0x73, 0x70, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x3e,
-  0x3b, 0x0a, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0a, 0x3c,
-  0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x73, 0x6f, 0x6d, 0x65, 0x74, 0x69,
-  0x6d, 0x65, 0x73, 0x20, 0x63, 0x61, 0x6c, 0x6c, 0x65, 0x64, 0x20, 0x74, 0x68,
-  0x65, 0x64, 0x6f, 0x65, 0x73, 0x20, 0x6e, 0x6f, 0x74, 0x20, 0x6e, 0x65, 0x63,
-  0x65, 0x73, 0x73, 0x61, 0x72, 0x69, 0x6c, 0x79, 0x46, 0x6f, 0x72, 0x20, 0x6d,
-  0x6f, 0x72, 0x65, 0x20, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61, 0x74, 0x69,
-  0x6f, 0x6e, 0x61, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x62, 0x65, 0x67, 0x69,
-  0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x20, 0x6f, 0x66, 0x20, 0x3c, 0x21, 0x44, 0x4f,
-  0x43, 0x54, 0x59, 0x50, 0x45, 0x20, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x3c, 0x68,
-  0x74, 0x6d, 0x6c, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x75, 0x6c, 0x61, 0x72,
-  0x6c, 0x79, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x20, 0x74, 0x79, 0x70,
-  0x65, 0x3d, 0x22, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x22, 0x20, 0x6e, 0x61,
-  0x6d, 0x65, 0x3d, 0x22, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70,
-  0x74, 0x3a, 0x76, 0x6f, 0x69, 0x64, 0x28, 0x30, 0x29, 0x3b, 0x22, 0x65, 0x66,
-  0x66, 0x65, 0x63, 0x74, 0x69, 0x76, 0x65, 0x6e, 0x65, 0x73, 0x73, 0x20, 0x6f,
-  0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x61, 0x75, 0x74, 0x6f, 0x63, 0x6f, 0x6d,
-  0x70, 0x6c, 0x65, 0x74, 0x65, 0x3d, 0x22, 0x6f, 0x66, 0x66, 0x22, 0x20, 0x67,
-  0x65, 0x6e, 0x65, 0x72, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x63, 0x6f, 0x6e, 0x73,
-  0x69, 0x64, 0x65, 0x72, 0x65, 0x64, 0x3e, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74,
-  0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x22, 0x20,
-  0x22, 0x3e, 0x3c, 0x2f, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3e, 0x0d, 0x0a,
-  0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x74, 0x68, 0x72, 0x6f, 0x75, 0x67,
-  0x68, 0x6f, 0x75, 0x74, 0x20, 0x74, 0x68, 0x65, 0x20, 0x77, 0x6f, 0x72, 0x6c,
-  0x64, 0x63, 0x6f, 0x6d, 0x6d, 0x6f, 0x6e, 0x20, 0x6d, 0x69, 0x73, 0x63, 0x6f,
-  0x6e, 0x63, 0x65, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x73, 0x73, 0x6f, 0x63,
-  0x69, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74,
-  0x68, 0x65, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x2f, 0x64, 0x69,
-  0x76, 0x3e, 0x0a, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x64, 0x75, 0x72, 0x69,
-  0x6e, 0x67, 0x20, 0x68, 0x69, 0x73, 0x20, 0x6c, 0x69, 0x66, 0x65, 0x74, 0x69,
-  0x6d, 0x65, 0x2c, 0x63, 0x6f, 0x72, 0x72, 0x65, 0x73, 0x70, 0x6f, 0x6e, 0x64,
-  0x69, 0x6e, 0x67, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x74, 0x79, 0x70,
-  0x65, 0x3d, 0x22, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x2f, 0x78, 0x2d, 0x69, 0x63,
-  0x6f, 0x6e, 0x22, 0x20, 0x61, 0x6e, 0x20, 0x69, 0x6e, 0x63, 0x72, 0x65, 0x61,
-  0x73, 0x69, 0x6e, 0x67, 0x20, 0x6e, 0x75, 0x6d, 0x62, 0x65, 0x72, 0x64, 0x69,
-  0x70, 0x6c, 0x6f, 0x6d, 0x61, 0x74, 0x69, 0x63, 0x20, 0x72, 0x65, 0x6c, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x61, 0x72, 0x65, 0x20, 0x6f, 0x66, 0x74, 0x65,
-  0x6e, 0x20, 0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x65, 0x64, 0x6d,
-  0x65, 0x74, 0x61, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d, 0x22,
-  0x75, 0x74, 0x66, 0x2d, 0x38, 0x22, 0x20, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74,
-  0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x22, 0x20,
-  0x65, 0x78, 0x61, 0x6d, 0x70, 0x6c, 0x65, 0x73, 0x20, 0x69, 0x6e, 0x63, 0x6c,
-  0x75, 0x64, 0x65, 0x20, 0x74, 0x68, 0x65, 0x22, 0x3e, 0x3c, 0x69, 0x6d, 0x67,
-  0x20, 0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f,
-  0x69, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x74, 0x68, 0x65, 0x20, 0x65,
-  0x73, 0x74, 0x61, 0x62, 0x6c, 0x69, 0x73, 0x68, 0x6d, 0x65, 0x6e, 0x74, 0x20,
-  0x6f, 0x66, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x64, 0x69,
-  0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x22, 0x26, 0x61, 0x6d, 0x70,
-  0x3b, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x26, 0x61, 0x6d, 0x70, 0x3b, 0x6e, 0x62,
-  0x73, 0x70, 0x3b, 0x74, 0x6f, 0x20, 0x64, 0x65, 0x74, 0x65, 0x72, 0x6d, 0x69,
-  0x6e, 0x65, 0x20, 0x77, 0x68, 0x65, 0x74, 0x68, 0x65, 0x72, 0x71, 0x75, 0x69,
-  0x74, 0x65, 0x20, 0x64, 0x69, 0x66, 0x66, 0x65, 0x72, 0x65, 0x6e, 0x74, 0x20,
-  0x66, 0x72, 0x6f, 0x6d, 0x6d, 0x61, 0x72, 0x6b, 0x65, 0x64, 0x20, 0x74, 0x68,
-  0x65, 0x20, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x6e, 0x69, 0x6e, 0x67, 0x64, 0x69,
-  0x73, 0x74, 0x61, 0x6e, 0x63, 0x65, 0x20, 0x62, 0x65, 0x74, 0x77, 0x65, 0x65,
-  0x6e, 0x20, 0x74, 0x68, 0x65, 0x63, 0x6f, 0x6e, 0x74, 0x72, 0x69, 0x62, 0x75,
-  0x74, 0x69, 0x6f, 0x6e, 0x73, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65, 0x63,
-  0x6f, 0x6e, 0x66, 0x6c, 0x69, 0x63, 0x74, 0x20, 0x62, 0x65, 0x74, 0x77, 0x65,
-  0x65, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x77, 0x69, 0x64, 0x65, 0x6c, 0x79, 0x20,
-  0x63, 0x6f, 0x6e, 0x73, 0x69, 0x64, 0x65, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f,
-  0x77, 0x61, 0x73, 0x20, 0x6f, 0x6e, 0x65, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68,
-  0x65, 0x20, 0x66, 0x69, 0x72, 0x73, 0x74, 0x77, 0x69, 0x74, 0x68, 0x20, 0x76,
-  0x61, 0x72, 0x79, 0x69, 0x6e, 0x67, 0x20, 0x64, 0x65, 0x67, 0x72, 0x65, 0x65,
-  0x73, 0x68, 0x61, 0x76, 0x65, 0x20, 0x73, 0x70, 0x65, 0x63, 0x75, 0x6c, 0x61,
-  0x74, 0x65, 0x64, 0x20, 0x74, 0x68, 0x61, 0x74, 0x28, 0x64, 0x6f, 0x63, 0x75,
-  0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x67, 0x65, 0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65,
-  0x6e, 0x74, 0x70, 0x61, 0x72, 0x74, 0x69, 0x63, 0x69, 0x70, 0x61, 0x74, 0x69,
-  0x6e, 0x67, 0x20, 0x69, 0x6e, 0x20, 0x74, 0x68, 0x65, 0x6f, 0x72, 0x69, 0x67,
-  0x69, 0x6e, 0x61, 0x6c, 0x6c, 0x79, 0x20, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f,
-  0x70, 0x65, 0x64, 0x65, 0x74, 0x61, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65,
-  0x74, 0x3d, 0x22, 0x75, 0x74, 0x66, 0x2d, 0x38, 0x22, 0x3e, 0x20, 0x74, 0x79,
-  0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22,
-  0x20, 0x2f, 0x3e, 0x0a, 0x69, 0x6e, 0x74, 0x65, 0x72, 0x63, 0x68, 0x61, 0x6e,
-  0x67, 0x65, 0x61, 0x62, 0x6c, 0x79, 0x20, 0x77, 0x69, 0x74, 0x68, 0x6d, 0x6f,
-  0x72, 0x65, 0x20, 0x63, 0x6c, 0x6f, 0x73, 0x65, 0x6c, 0x79, 0x20, 0x72, 0x65,
-  0x6c, 0x61, 0x74, 0x65, 0x64, 0x73, 0x6f, 0x63, 0x69, 0x61, 0x6c, 0x20, 0x61,
-  0x6e, 0x64, 0x20, 0x70, 0x6f, 0x6c, 0x69, 0x74, 0x69, 0x63, 0x61, 0x6c, 0x74,
-  0x68, 0x61, 0x74, 0x20, 0x77, 0x6f, 0x75, 0x6c, 0x64, 0x20, 0x6f, 0x74, 0x68,
-  0x65, 0x72, 0x77, 0x69, 0x73, 0x65, 0x70, 0x65, 0x72, 0x70, 0x65, 0x6e, 0x64,
-  0x69, 0x63, 0x75, 0x6c, 0x61, 0x72, 0x20, 0x74, 0x6f, 0x20, 0x74, 0x68, 0x65,
-  0x73, 0x74, 0x79, 0x6c, 0x65, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74,
-  0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
-  0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x22, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d,
-  0x22, 0x66, 0x61, 0x6d, 0x69, 0x6c, 0x69, 0x65, 0x73, 0x20, 0x72, 0x65, 0x73,
-  0x69, 0x64, 0x69, 0x6e, 0x67, 0x20, 0x69, 0x6e, 0x64, 0x65, 0x76, 0x65, 0x6c,
-  0x6f, 0x70, 0x69, 0x6e, 0x67, 0x20, 0x63, 0x6f, 0x75, 0x6e, 0x74, 0x72, 0x69,
-  0x65, 0x73, 0x63, 0x6f, 0x6d, 0x70, 0x75, 0x74, 0x65, 0x72, 0x20, 0x70, 0x72,
-  0x6f, 0x67, 0x72, 0x61, 0x6d, 0x6d, 0x69, 0x6e, 0x67, 0x65, 0x63, 0x6f, 0x6e,
-  0x6f, 0x6d, 0x69, 0x63, 0x20, 0x64, 0x65, 0x76, 0x65, 0x6c, 0x6f, 0x70, 0x6d,
-  0x65, 0x6e, 0x74, 0x64, 0x65, 0x74, 0x65, 0x72, 0x6d, 0x69, 0x6e, 0x61, 0x74,
-  0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x66, 0x6f, 0x72,
-  0x20, 0x6d, 0x6f, 0x72, 0x65, 0x20, 0x69, 0x6e, 0x66, 0x6f, 0x72, 0x6d, 0x61,
-  0x74, 0x69, 0x6f, 0x6e, 0x6f, 0x6e, 0x20, 0x73, 0x65, 0x76, 0x65, 0x72, 0x61,
-  0x6c, 0x20, 0x6f, 0x63, 0x63, 0x61, 0x73, 0x69, 0x6f, 0x6e, 0x73, 0x70, 0x6f,
-  0x72, 0x74, 0x75, 0x67, 0x75, 0xc3, 0xaa, 0x73, 0x20, 0x28, 0x45, 0x75, 0x72,
-  0x6f, 0x70, 0x65, 0x75, 0x29, 0xd0, 0xa3, 0xd0, 0xba, 0xd1, 0x80, 0xd0, 0xb0,
-  0xd1, 0x97, 0xd0, 0xbd, 0xd1, 0x81, 0xd1, 0x8c, 0xd0, 0xba, 0xd0, 0xb0, 0xd1,
-  0x83, 0xd0, 0xba, 0xd1, 0x80, 0xd0, 0xb0, 0xd1, 0x97, 0xd0, 0xbd, 0xd1, 0x81,
-  0xd1, 0x8c, 0xd0, 0xba, 0xd0, 0xb0, 0xd0, 0xa0, 0xd0, 0xbe, 0xd1, 0x81, 0xd1,
-  0x81, 0xd0, 0xb8, 0xd0, 0xb9, 0xd1, 0x81, 0xd0, 0xba, 0xd0, 0xbe, 0xd0, 0xb9,
-  0xd0, 0xbc, 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xb5, 0xd1, 0x80, 0xd0, 0xb8, 0xd0,
-  0xb0, 0xd0, 0xbb, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1, 0x84,
-  0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbc, 0xd0, 0xb0, 0xd1, 0x86, 0xd0, 0xb8, 0xd0,
-  0xb8, 0xd1, 0x83, 0xd0, 0xbf, 0xd1, 0x80, 0xd0, 0xb0, 0xd0, 0xb2, 0xd0, 0xbb,
-  0xd0, 0xb5, 0xd0, 0xbd, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0, 0xbd, 0xd0, 0xb5, 0xd0,
-  0xbe, 0xd0, 0xb1, 0xd1, 0x85, 0xd0, 0xbe, 0xd0, 0xb4, 0xd0, 0xb8, 0xd0, 0xbc,
-  0xd0, 0xbe, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1, 0x84, 0xd0, 0xbe, 0xd1, 0x80, 0xd0,
-  0xbc, 0xd0, 0xb0, 0xd1, 0x86, 0xd0, 0xb8, 0xd1, 0x8f, 0xd0, 0x98, 0xd0, 0xbd,
-  0xd1, 0x84, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xbc, 0xd0, 0xb0, 0xd1, 0x86, 0xd0,
-  0xb8, 0xd1, 0x8f, 0xd0, 0xa0, 0xd0, 0xb5, 0xd1, 0x81, 0xd0, 0xbf, 0xd1, 0x83,
-  0xd0, 0xb1, 0xd0, 0xbb, 0xd0, 0xb8, 0xd0, 0xba, 0xd0, 0xb8, 0xd0, 0xba, 0xd0,
-  0xbe, 0xd0, 0xbb, 0xd0, 0xb8, 0xd1, 0x87, 0xd0, 0xb5, 0xd1, 0x81, 0xd1, 0x82,
-  0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb8, 0xd0, 0xbd, 0xd1, 0x84, 0xd0, 0xbe, 0xd1,
-  0x80, 0xd0, 0xbc, 0xd0, 0xb0, 0xd1, 0x86, 0xd0, 0xb8, 0xd1, 0x8e, 0xd1, 0x82,
-  0xd0, 0xb5, 0xd1, 0x80, 0xd1, 0x80, 0xd0, 0xb8, 0xd1, 0x82, 0xd0, 0xbe, 0xd1,
-  0x80, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xb4, 0xd0, 0xbe, 0xd1, 0x81, 0xd1, 0x82,
-  0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xbe, 0xd1, 0x87, 0xd0, 0xbd, 0xd0, 0xbe, 0xd8,
-  0xa7, 0xd9, 0x84, 0xd9, 0x85, 0xd8, 0xaa, 0xd9, 0x88, 0xd8, 0xa7, 0xd8, 0xac,
-  0xd8, 0xaf, 0xd9, 0x88, 0xd9, 0x86, 0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd8,
-  0xb4, 0xd8, 0xaa, 0xd8, 0xb1, 0xd8, 0xa7, 0xd9, 0x83, 0xd8, 0xa7, 0xd8, 0xaa,
-  0xd8, 0xa7, 0xd9, 0x84, 0xd8, 0xa7, 0xd9, 0x82, 0xd8, 0xaa, 0xd8, 0xb1, 0xd8,
-  0xa7, 0xd8, 0xad, 0xd8, 0xa7, 0xd8, 0xaa, 0x68, 0x74, 0x6d, 0x6c, 0x3b, 0x20,
-  0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d, 0x55, 0x54, 0x46, 0x2d, 0x38,
-  0x22, 0x20, 0x73, 0x65, 0x74, 0x54, 0x69, 0x6d, 0x65, 0x6f, 0x75, 0x74, 0x28,
-  0x66, 0x75, 0x6e, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x28, 0x29, 0x64, 0x69, 0x73,
-  0x70, 0x6c, 0x61, 0x79, 0x3a, 0x69, 0x6e, 0x6c, 0x69, 0x6e, 0x65, 0x2d, 0x62,
-  0x6c, 0x6f, 0x63, 0x6b, 0x3b, 0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74,
-  0x79, 0x70, 0x65, 0x3d, 0x22, 0x73, 0x75, 0x62, 0x6d, 0x69, 0x74, 0x22, 0x20,
-  0x74, 0x79, 0x70, 0x65, 0x20, 0x3d, 0x20, 0x27, 0x74, 0x65, 0x78, 0x74, 0x2f,
-  0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x3c, 0x69, 0x6d, 0x67, 0x20,
-  0x73, 0x72, 0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77,
-  0x77, 0x77, 0x2e, 0x22, 0x20, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f,
-  0x77, 0x77, 0x77, 0x2e, 0x77, 0x33, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x73, 0x68,
-  0x6f, 0x72, 0x74, 0x63, 0x75, 0x74, 0x20, 0x69, 0x63, 0x6f, 0x6e, 0x22, 0x20,
-  0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x22, 0x20, 0x61, 0x75, 0x74, 0x6f, 0x63,
-  0x6f, 0x6d, 0x70, 0x6c, 0x65, 0x74, 0x65, 0x3d, 0x22, 0x6f, 0x66, 0x66, 0x22,
-  0x20, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x64,
-  0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d, 0x3c, 0x2f, 0x61, 0x3e,
-  0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x0a, 0x3c, 0x6c, 0x69, 0x20, 0x63, 0x6c, 0x61,
-  0x73, 0x73, 0x3d, 0x22, 0x63, 0x73, 0x73, 0x22, 0x20, 0x74, 0x79, 0x70, 0x65,
-  0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20, 0x3c,
-  0x66, 0x6f, 0x72, 0x6d, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x3d, 0x22,
-  0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73,
-  0x22, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a,
-  0x2f, 0x2f, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x61,
-  0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x65, 0x22, 0x20, 0x0d, 0x0a, 0x3c,
-  0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
-  0x74, 0x65, 0x78, 0x74, 0x2f, 0x20, 0x6f, 0x6e, 0x63, 0x6c, 0x69, 0x63, 0x6b,
-  0x3d, 0x22, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x3a,
-  0x28, 0x6e, 0x65, 0x77, 0x20, 0x44, 0x61, 0x74, 0x65, 0x29, 0x2e, 0x67, 0x65,
-  0x74, 0x54, 0x69, 0x6d, 0x65, 0x28, 0x29, 0x7d, 0x68, 0x65, 0x69, 0x67, 0x68,
-  0x74, 0x3d, 0x22, 0x31, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22,
-  0x31, 0x22, 0x20, 0x50, 0x65, 0x6f, 0x70, 0x6c, 0x65, 0x27, 0x73, 0x20, 0x52,
-  0x65, 0x70, 0x75, 0x62, 0x6c, 0x69, 0x63, 0x20, 0x6f, 0x66, 0x20, 0x20, 0x3c,
-  0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a,
-  0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x74, 0x65, 0x78, 0x74, 0x2d, 0x64, 0x65,
-  0x63, 0x6f, 0x72, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x3a, 0x75, 0x6e, 0x64, 0x65,
-  0x72, 0x74, 0x68, 0x65, 0x20, 0x62, 0x65, 0x67, 0x69, 0x6e, 0x6e, 0x69, 0x6e,
-  0x67, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x3c, 0x2f, 0x64, 0x69,
-  0x76, 0x3e, 0x0a, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x0a, 0x3c, 0x2f, 0x64,
-  0x69, 0x76, 0x3e, 0x0a, 0x65, 0x73, 0x74, 0x61, 0x62, 0x6c, 0x69, 0x73, 0x68,
-  0x6d, 0x65, 0x6e, 0x74, 0x20, 0x6f, 0x66, 0x20, 0x74, 0x68, 0x65, 0x20, 0x3c,
-  0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f,
-  0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x23, 0x76, 0x69, 0x65, 0x77, 0x70,
-  0x6f, 0x72, 0x74, 0x7b, 0x6d, 0x69, 0x6e, 0x2d, 0x68, 0x65, 0x69, 0x67, 0x68,
-  0x74, 0x3a, 0x0a, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x73, 0x72,
-  0x63, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x6f, 0x70, 0x74,
-  0x69, 0x6f, 0x6e, 0x3e, 0x3c, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x76,
-  0x61, 0x6c, 0x75, 0x65, 0x3d, 0x6f, 0x66, 0x74, 0x65, 0x6e, 0x20, 0x72, 0x65,
-  0x66, 0x65, 0x72, 0x72, 0x65, 0x64, 0x20, 0x74, 0x6f, 0x20, 0x61, 0x73, 0x20,
-  0x2f, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x3e, 0x0a, 0x3c, 0x6f, 0x70, 0x74,
-  0x69, 0x6f, 0x6e, 0x20, 0x76, 0x61, 0x6c, 0x75, 0x3c, 0x21, 0x44, 0x4f, 0x43,
-  0x54, 0x59, 0x50, 0x45, 0x20, 0x68, 0x74, 0x6d, 0x6c, 0x3e, 0x0a, 0x3c, 0x21,
-  0x2d, 0x2d, 0x5b, 0x49, 0x6e, 0x74, 0x65, 0x72, 0x6e, 0x61, 0x74, 0x69, 0x6f,
-  0x6e, 0x61, 0x6c, 0x20, 0x41, 0x69, 0x72, 0x70, 0x6f, 0x72, 0x74, 0x3e, 0x0a,
-  0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70,
-  0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x3c, 0x2f, 0x61, 0x3e, 0x3c, 0x61, 0x20,
-  0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f,
-  0x77, 0xe0, 0xb8, 0xa0, 0xe0, 0xb8, 0xb2, 0xe0, 0xb8, 0xa9, 0xe0, 0xb8, 0xb2,
-  0xe0, 0xb9, 0x84, 0xe0, 0xb8, 0x97, 0xe0, 0xb8, 0xa2, 0xe1, 0x83, 0xa5, 0xe1,
-  0x83, 0x90, 0xe1, 0x83, 0xa0, 0xe1, 0x83, 0x97, 0xe1, 0x83, 0xa3, 0xe1, 0x83,
-  0x9a, 0xe1, 0x83, 0x98, 0xe6, 0xad, 0xa3, 0xe9, 0xab, 0x94, 0xe4, 0xb8, 0xad,
-  0xe6, 0x96, 0x87, 0x20, 0x28, 0xe7, 0xb9, 0x81, 0xe9, 0xab, 0x94, 0x29, 0xe0,
-  0xa4, 0xa8, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
-  0xa6, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb6, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xb2, 0xe0, 0xa5, 0x8b, 0xe0,
-  0xa4, 0xa1, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb7, 0xe0, 0xa5,
-  0x87, 0xe0, 0xa4, 0xa4, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x9c,
-  0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82, 0xe0, 0xa4,
-  0xac, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa7, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4,
-  0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa5, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0xaa, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5,
-  0x8d, 0xe0, 0xa4, 0xb5, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe,
-  0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xb8, 0xe0,
-  0xa5, 0x8d, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa3, 0xe0, 0xa4,
-  0xb8, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0x97, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x9a, 0xe0, 0xa4, 0xbf, 0xe0,
-  0xa4, 0x9f, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa0, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4,
-  0x82, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x9c, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0x9e, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x85, 0xe0,
-  0xa4, 0xae, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
-  0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xad,
-  0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa8, 0xe0,
-  0xa4, 0x97, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xa1, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
-  0xaf, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x81, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0xaf, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x95, 0xe0,
-  0xa4, 0xbf, 0xe0, 0xa4, 0xb8, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4,
-  0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb7, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa,
-  0xe0, 0xa4, 0xb9, 0xe0, 0xa5, 0x81, 0xe0, 0xa4, 0x81, 0xe0, 0xa4, 0x9a, 0xe0,
-  0xa4, 0xa4, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
-  0xb0, 0xe0, 0xa4, 0xac, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa7, 0xe0, 0xa4, 0xa8,
-  0xe0, 0xa4, 0x9f, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8d, 0xe0,
-  0xa4, 0xaa, 0xe0, 0xa4, 0xa3, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0x95, 0xe0, 0xa5,
-  0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x87,
-  0xe0, 0xa4, 0x9f, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xad, 0xe0, 0xa4,
-  0xaa, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa,
-  0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xae, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0xb2, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4,
-  0x82, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xab, 0xe0, 0xa4, 0xbc, 0xe0, 0xa5, 0x8d,
-  0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xa8, 0xe0,
-  0xa4, 0xbf, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xae, 0xe0, 0xa4,
-  0xbe, 0xe0, 0xa4, 0xa3, 0xe0, 0xa4, 0xb2, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xae,
-  0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x9f, 0xe0, 0xa5, 0x87, 0xe0, 0xa4, 0xa1, 0x64,
-  0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x22, 0x20, 0x63,
-  0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x64, 0x6f, 0x63, 0x75, 0x6d,
-  0x65, 0x6e, 0x74, 0x2e, 0x6c, 0x6f, 0x63, 0x61, 0x74, 0x69, 0x6f, 0x6e, 0x2e,
-  0x70, 0x72, 0x6f, 0x74, 0x2e, 0x67, 0x65, 0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65,
-  0x6e, 0x74, 0x73, 0x42, 0x79, 0x54, 0x61, 0x67, 0x4e, 0x61, 0x6d, 0x65, 0x28,
-  0x3c, 0x21, 0x44, 0x4f, 0x43, 0x54, 0x59, 0x50, 0x45, 0x20, 0x68, 0x74, 0x6d,
-  0x6c, 0x3e, 0x0a, 0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x20, 0x3c, 0x6d, 0x65, 0x74,
-  0x61, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d, 0x22, 0x75, 0x74,
-  0x66, 0x2d, 0x38, 0x22, 0x3e, 0x3a, 0x75, 0x72, 0x6c, 0x22, 0x20, 0x63, 0x6f,
-  0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f,
-  0x2f, 0x2e, 0x63, 0x73, 0x73, 0x22, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x73,
-  0x74, 0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x73, 0x74, 0x79,
-  0x6c, 0x65, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74,
-  0x2f, 0x63, 0x73, 0x73, 0x22, 0x3e, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74,
-  0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66,
-  0x3d, 0x22, 0x77, 0x33, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x31, 0x39, 0x39, 0x39,
-  0x2f, 0x78, 0x68, 0x74, 0x6d, 0x6c, 0x22, 0x20, 0x78, 0x6d, 0x6c, 0x74, 0x79,
-  0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61,
-  0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x22, 0x20, 0x6d, 0x65, 0x74, 0x68, 0x6f,
-  0x64, 0x3d, 0x22, 0x67, 0x65, 0x74, 0x22, 0x20, 0x61, 0x63, 0x74, 0x69, 0x6f,
-  0x6e, 0x3d, 0x22, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22,
-  0x73, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20, 0x20,
-  0x3d, 0x20, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x67, 0x65,
-  0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x74, 0x79, 0x70, 0x65, 0x3d,
-  0x22, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x2f, 0x78, 0x2d, 0x69, 0x63, 0x6f, 0x6e,
-  0x22, 0x20, 0x2f, 0x3e, 0x63, 0x65, 0x6c, 0x6c, 0x70, 0x61, 0x64, 0x64, 0x69,
-  0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x73, 0x70,
-  0x2e, 0x63, 0x73, 0x73, 0x22, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74,
-  0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20, 0x3c, 0x2f, 0x61, 0x3e,
-  0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x3c, 0x6c, 0x69, 0x3e, 0x3c, 0x61, 0x20, 0x68,
-  0x72, 0x65, 0x66, 0x3d, 0x22, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d,
-  0x22, 0x31, 0x22, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74, 0x3d, 0x22, 0x31,
-  0x22, 0x22, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68,
-  0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x73, 0x74, 0x79,
-  0x6c, 0x65, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x6e,
-  0x6f, 0x6e, 0x65, 0x3b, 0x22, 0x3e, 0x61, 0x6c, 0x74, 0x65, 0x72, 0x6e, 0x61,
-  0x74, 0x65, 0x22, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x61, 0x70, 0x70,
-  0x6c, 0x69, 0x2d, 0x2f, 0x2f, 0x57, 0x33, 0x43, 0x2f, 0x2f, 0x44, 0x54, 0x44,
-  0x20, 0x58, 0x48, 0x54, 0x4d, 0x4c, 0x20, 0x31, 0x2e, 0x30, 0x20, 0x65, 0x6c,
-  0x6c, 0x73, 0x70, 0x61, 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x20,
-  0x63, 0x65, 0x6c, 0x6c, 0x70, 0x61, 0x64, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d,
-  0x22, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x22, 0x20, 0x76, 0x61, 0x6c, 0x75,
-  0x65, 0x3d, 0x22, 0x2f, 0x61, 0x3e, 0x26, 0x6e, 0x62, 0x73, 0x70, 0x3b, 0x3c,
-  0x73, 0x70, 0x61, 0x6e, 0x20, 0x72, 0x6f, 0x6c, 0x65, 0x3d, 0x22, 0x73, 0x0a,
-  0x3c, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
-  0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x22, 0x20, 0x6c, 0x61, 0x6e, 0x67, 0x75,
-  0x61, 0x67, 0x65, 0x3d, 0x22, 0x4a, 0x61, 0x76, 0x61, 0x53, 0x63, 0x72, 0x69,
-  0x70, 0x74, 0x22, 0x20, 0x20, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74,
-  0x2e, 0x67, 0x65, 0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x42,
-  0x67, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x73, 0x70, 0x61,
-  0x63, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x79, 0x70, 0x65, 0x3d,
-  0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20, 0x6d, 0x65,
-  0x64, 0x69, 0x61, 0x3d, 0x22, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x27, 0x74, 0x65,
-  0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x27, 0x77, 0x69, 0x74, 0x68, 0x20, 0x74, 0x68, 0x65, 0x20, 0x65, 0x78, 0x63,
-  0x65, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x6f, 0x66, 0x20, 0x79, 0x70, 0x65,
-  0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73, 0x22, 0x20, 0x72,
-  0x65, 0x6c, 0x3d, 0x22, 0x73, 0x74, 0x20, 0x68, 0x65, 0x69, 0x67, 0x68, 0x74,
-  0x3d, 0x22, 0x31, 0x22, 0x20, 0x77, 0x69, 0x64, 0x74, 0x68, 0x3d, 0x22, 0x31,
-  0x22, 0x20, 0x3d, 0x27, 0x2b, 0x65, 0x6e, 0x63, 0x6f, 0x64, 0x65, 0x55, 0x52,
-  0x49, 0x43, 0x6f, 0x6d, 0x70, 0x6f, 0x6e, 0x65, 0x6e, 0x74, 0x28, 0x3c, 0x6c,
-  0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x61, 0x6c, 0x74, 0x65,
-  0x72, 0x6e, 0x61, 0x74, 0x65, 0x22, 0x20, 0x0a, 0x62, 0x6f, 0x64, 0x79, 0x2c,
-  0x20, 0x74, 0x72, 0x2c, 0x20, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x2c, 0x20, 0x74,
-  0x65, 0x78, 0x74, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d,
-  0x22, 0x72, 0x6f, 0x62, 0x6f, 0x74, 0x73, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x6d,
-  0x65, 0x74, 0x68, 0x6f, 0x64, 0x3d, 0x22, 0x70, 0x6f, 0x73, 0x74, 0x22, 0x20,
-  0x61, 0x63, 0x74, 0x69, 0x6f, 0x6e, 0x3d, 0x22, 0x3e, 0x0a, 0x3c, 0x61, 0x20,
-  0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f,
-  0x77, 0x77, 0x77, 0x2e, 0x63, 0x73, 0x73, 0x22, 0x20, 0x72, 0x65, 0x6c, 0x3d,
-  0x22, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20,
-  0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c,
-  0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x6c, 0x61, 0x6e, 0x67,
-  0x75, 0x61, 0x67, 0x65, 0x3d, 0x22, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72,
-  0x69, 0x70, 0x74, 0x22, 0x3e, 0x61, 0x72, 0x69, 0x61, 0x2d, 0x68, 0x69, 0x64,
-  0x64, 0x65, 0x6e, 0x3d, 0x22, 0x74, 0x72, 0x75, 0x65, 0x22, 0x3e, 0xc2, 0xb7,
-  0x3c, 0x72, 0x69, 0x70, 0x74, 0x22, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
-  0x74, 0x65, 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x6c, 0x3d, 0x30,
-  0x3b, 0x7d, 0x29, 0x28, 0x29, 0x3b, 0x0a, 0x28, 0x66, 0x75, 0x6e, 0x63, 0x74,
-  0x69, 0x6f, 0x6e, 0x28, 0x29, 0x7b, 0x62, 0x61, 0x63, 0x6b, 0x67, 0x72, 0x6f,
-  0x75, 0x6e, 0x64, 0x2d, 0x69, 0x6d, 0x61, 0x67, 0x65, 0x3a, 0x20, 0x75, 0x72,
-  0x6c, 0x28, 0x2f, 0x61, 0x3e, 0x3c, 0x2f, 0x6c, 0x69, 0x3e, 0x3c, 0x6c, 0x69,
-  0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x09, 0x09,
-  0x3c, 0x6c, 0x69, 0x3e, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22,
-  0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x61, 0x74, 0x6f, 0x72, 0x22, 0x20,
-  0x61, 0x72, 0x69, 0x61, 0x2d, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x3d, 0x22,
-  0x74, 0x72, 0x75, 0x3e, 0x20, 0x3c, 0x61, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d,
-  0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x6c,
-  0x61, 0x6e, 0x67, 0x75, 0x61, 0x67, 0x65, 0x3d, 0x22, 0x6a, 0x61, 0x76, 0x61,
-  0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x22, 0x20, 0x2f, 0x6f, 0x70, 0x74, 0x69,
-  0x6f, 0x6e, 0x3e, 0x0a, 0x3c, 0x6f, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x20, 0x76,
-  0x61, 0x6c, 0x75, 0x65, 0x2f, 0x64, 0x69, 0x76, 0x3e, 0x3c, 0x2f, 0x64, 0x69,
-  0x76, 0x3e, 0x3c, 0x64, 0x69, 0x76, 0x20, 0x63, 0x6c, 0x61, 0x73, 0x73, 0x3d,
-  0x72, 0x61, 0x74, 0x6f, 0x72, 0x22, 0x20, 0x61, 0x72, 0x69, 0x61, 0x2d, 0x68,
-  0x69, 0x64, 0x64, 0x65, 0x6e, 0x3d, 0x22, 0x74, 0x72, 0x65, 0x3d, 0x28, 0x6e,
-  0x65, 0x77, 0x20, 0x44, 0x61, 0x74, 0x65, 0x29, 0x2e, 0x67, 0x65, 0x74, 0x54,
-  0x69, 0x6d, 0x65, 0x28, 0x29, 0x70, 0x6f, 0x72, 0x74, 0x75, 0x67, 0x75, 0xc3,
-  0xaa, 0x73, 0x20, 0x28, 0x64, 0x6f, 0x20, 0x42, 0x72, 0x61, 0x73, 0x69, 0x6c,
-  0x29, 0xd0, 0xbe, 0xd1, 0x80, 0xd0, 0xb3, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb8,
-  0xd0, 0xb7, 0xd0, 0xb0, 0xd1, 0x86, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xb2, 0xd0,
-  0xbe, 0xd0, 0xb7, 0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xb6, 0xd0, 0xbd, 0xd0, 0xbe,
-  0xd1, 0x81, 0xd1, 0x82, 0xd1, 0x8c, 0xd0, 0xbe, 0xd0, 0xb1, 0xd1, 0x80, 0xd0,
-  0xb0, 0xd0, 0xb7, 0xd0, 0xbe, 0xd0, 0xb2, 0xd0, 0xb0, 0xd0, 0xbd, 0xd0, 0xb8,
-  0xd1, 0x8f, 0xd1, 0x80, 0xd0, 0xb5, 0xd0, 0xb3, 0xd0, 0xb8, 0xd1, 0x81, 0xd1,
-  0x82, 0xd1, 0x80, 0xd0, 0xb0, 0xd1, 0x86, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xb2,
-  0xd0, 0xbe, 0xd0, 0xb7, 0xd0, 0xbc, 0xd0, 0xbe, 0xd0, 0xb6, 0xd0, 0xbd, 0xd0,
-  0xbe, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8, 0xd0, 0xbe, 0xd0, 0xb1, 0xd1, 0x8f,
-  0xd0, 0xb7, 0xd0, 0xb0, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbb, 0xd1, 0x8c, 0xd0,
-  0xbd, 0xd0, 0xb0, 0x3c, 0x21, 0x44, 0x4f, 0x43, 0x54, 0x59, 0x50, 0x45, 0x20,
-  0x68, 0x74, 0x6d, 0x6c, 0x20, 0x50, 0x55, 0x42, 0x4c, 0x49, 0x43, 0x20, 0x22,
-  0x6e, 0x74, 0x2d, 0x54, 0x79, 0x70, 0x65, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74,
-  0x65, 0x6e, 0x74, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x3c, 0x6d, 0x65,
-  0x74, 0x61, 0x20, 0x68, 0x74, 0x74, 0x70, 0x2d, 0x65, 0x71, 0x75, 0x69, 0x76,
-  0x3d, 0x22, 0x43, 0x6f, 0x6e, 0x74, 0x65, 0x72, 0x61, 0x6e, 0x73, 0x69, 0x74,
-  0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x2f, 0x2f, 0x45, 0x4e, 0x22, 0x20, 0x22, 0x68,
-  0x74, 0x74, 0x70, 0x3a, 0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x20, 0x78, 0x6d, 0x6c,
-  0x6e, 0x73, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77,
-  0x77, 0x2d, 0x2f, 0x2f, 0x57, 0x33, 0x43, 0x2f, 0x2f, 0x44, 0x54, 0x44, 0x20,
-  0x58, 0x48, 0x54, 0x4d, 0x4c, 0x20, 0x31, 0x2e, 0x30, 0x20, 0x54, 0x44, 0x54,
-  0x44, 0x2f, 0x78, 0x68, 0x74, 0x6d, 0x6c, 0x31, 0x2d, 0x74, 0x72, 0x61, 0x6e,
-  0x73, 0x69, 0x74, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x2f, 0x2f, 0x77, 0x77, 0x77,
-  0x2e, 0x77, 0x33, 0x2e, 0x6f, 0x72, 0x67, 0x2f, 0x54, 0x52, 0x2f, 0x78, 0x68,
-  0x74, 0x6d, 0x6c, 0x31, 0x2f, 0x70, 0x65, 0x20, 0x3d, 0x20, 0x27, 0x74, 0x65,
-  0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x27, 0x3b, 0x3c, 0x6d, 0x65, 0x74, 0x61, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d,
-  0x22, 0x64, 0x65, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x69, 0x6f, 0x6e, 0x70,
-  0x61, 0x72, 0x65, 0x6e, 0x74, 0x4e, 0x6f, 0x64, 0x65, 0x2e, 0x69, 0x6e, 0x73,
-  0x65, 0x72, 0x74, 0x42, 0x65, 0x66, 0x6f, 0x72, 0x65, 0x3c, 0x69, 0x6e, 0x70,
-  0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x68, 0x69, 0x64, 0x64,
-  0x65, 0x6e, 0x22, 0x20, 0x6e, 0x61, 0x6a, 0x73, 0x22, 0x20, 0x74, 0x79, 0x70,
-  0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73,
-  0x63, 0x72, 0x69, 0x28, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x29,
-  0x2e, 0x72, 0x65, 0x61, 0x64, 0x79, 0x28, 0x66, 0x75, 0x6e, 0x63, 0x74, 0x69,
-  0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
-  0x74, 0x65, 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x69, 0x6d, 0x61,
-  0x67, 0x65, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x3d, 0x22,
-  0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x55, 0x41, 0x2d, 0x43, 0x6f, 0x6d,
-  0x70, 0x61, 0x74, 0x69, 0x62, 0x6c, 0x65, 0x22, 0x20, 0x63, 0x6f, 0x6e, 0x74,
-  0x65, 0x6e, 0x74, 0x3d, 0x74, 0x6d, 0x6c, 0x3b, 0x20, 0x63, 0x68, 0x61, 0x72,
-  0x73, 0x65, 0x74, 0x3d, 0x75, 0x74, 0x66, 0x2d, 0x38, 0x22, 0x20, 0x2f, 0x3e,
-  0x0a, 0x6c, 0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x73, 0x68,
-  0x6f, 0x72, 0x74, 0x63, 0x75, 0x74, 0x20, 0x69, 0x63, 0x6f, 0x6e, 0x3c, 0x6c,
-  0x69, 0x6e, 0x6b, 0x20, 0x72, 0x65, 0x6c, 0x3d, 0x22, 0x73, 0x74, 0x79, 0x6c,
-  0x65, 0x73, 0x68, 0x65, 0x65, 0x74, 0x22, 0x20, 0x3c, 0x2f, 0x73, 0x63, 0x72,
-  0x69, 0x70, 0x74, 0x3e, 0x0a, 0x3c, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x20,
-  0x74, 0x79, 0x70, 0x65, 0x3d, 0x3d, 0x20, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65,
-  0x6e, 0x74, 0x2e, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x45, 0x6c, 0x65, 0x6d,
-  0x65, 0x6e, 0x3c, 0x61, 0x20, 0x74, 0x61, 0x72, 0x67, 0x65, 0x74, 0x3d, 0x22,
-  0x5f, 0x62, 0x6c, 0x61, 0x6e, 0x6b, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d,
-  0x20, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e, 0x74, 0x2e, 0x67, 0x65, 0x74,
-  0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x42, 0x69, 0x6e, 0x70, 0x75,
-  0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x22,
-  0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x61, 0x2e, 0x74, 0x79, 0x70, 0x65, 0x20,
-  0x3d, 0x20, 0x27, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73,
-  0x63, 0x72, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d,
-  0x22, 0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x22, 0x20, 0x6e, 0x61, 0x6d, 0x65,
-  0x68, 0x74, 0x6d, 0x6c, 0x3b, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74,
-  0x3d, 0x75, 0x74, 0x66, 0x2d, 0x38, 0x22, 0x20, 0x2f, 0x3e, 0x64, 0x74, 0x64,
-  0x22, 0x3e, 0x0a, 0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x20, 0x78, 0x6d, 0x6c, 0x6e,
-  0x73, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x2d, 0x2f, 0x2f, 0x57, 0x33, 0x43,
-  0x2f, 0x2f, 0x44, 0x54, 0x44, 0x20, 0x48, 0x54, 0x4d, 0x4c, 0x20, 0x34, 0x2e,
-  0x30, 0x31, 0x20, 0x54, 0x65, 0x6e, 0x74, 0x73, 0x42, 0x79, 0x54, 0x61, 0x67,
-  0x4e, 0x61, 0x6d, 0x65, 0x28, 0x27, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x27,
-  0x29, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
-  0x68, 0x69, 0x64, 0x64, 0x65, 0x6e, 0x22, 0x20, 0x6e, 0x61, 0x6d, 0x3c, 0x73,
-  0x63, 0x72, 0x69, 0x70, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74,
-  0x65, 0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x22, 0x20, 0x73, 0x74,
-  0x79, 0x6c, 0x65, 0x3d, 0x22, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a,
-  0x6e, 0x6f, 0x6e, 0x65, 0x3b, 0x22, 0x3e, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65,
-  0x6e, 0x74, 0x2e, 0x67, 0x65, 0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74,
-  0x42, 0x79, 0x49, 0x64, 0x28, 0x3d, 0x64, 0x6f, 0x63, 0x75, 0x6d, 0x65, 0x6e,
-  0x74, 0x2e, 0x63, 0x72, 0x65, 0x61, 0x74, 0x65, 0x45, 0x6c, 0x65, 0x6d, 0x65,
-  0x6e, 0x74, 0x28, 0x27, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x27, 0x74, 0x65,
-  0x78, 0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74,
-  0x27, 0x69, 0x6e, 0x70, 0x75, 0x74, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x22,
-  0x74, 0x65, 0x78, 0x74, 0x22, 0x20, 0x6e, 0x61, 0x6d, 0x65, 0x3d, 0x22, 0x64,
-  0x2e, 0x67, 0x65, 0x74, 0x45, 0x6c, 0x65, 0x6d, 0x65, 0x6e, 0x74, 0x73, 0x42,
-  0x79, 0x54, 0x61, 0x67, 0x4e, 0x61, 0x6d, 0x65, 0x28, 0x73, 0x6e, 0x69, 0x63,
-  0x61, 0x6c, 0x22, 0x20, 0x68, 0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74,
-  0x70, 0x3a, 0x2f, 0x2f, 0x77, 0x77, 0x77, 0x2e, 0x43, 0x2f, 0x2f, 0x44, 0x54,
-  0x44, 0x20, 0x48, 0x54, 0x4d, 0x4c, 0x20, 0x34, 0x2e, 0x30, 0x31, 0x20, 0x54,
-  0x72, 0x61, 0x6e, 0x73, 0x69, 0x74, 0x3c, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x20,
-  0x74, 0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73,
-  0x73, 0x22, 0x3e, 0x0a, 0x0a, 0x3c, 0x73, 0x74, 0x79, 0x6c, 0x65, 0x20, 0x74,
-  0x79, 0x70, 0x65, 0x3d, 0x22, 0x74, 0x65, 0x78, 0x74, 0x2f, 0x63, 0x73, 0x73,
-  0x22, 0x3e, 0x69, 0x6f, 0x6e, 0x61, 0x6c, 0x2e, 0x64, 0x74, 0x64, 0x22, 0x3e,
-  0x0a, 0x3c, 0x68, 0x74, 0x6d, 0x6c, 0x20, 0x78, 0x6d, 0x6c, 0x6e, 0x73, 0x3d,
-  0x68, 0x74, 0x74, 0x70, 0x2d, 0x65, 0x71, 0x75, 0x69, 0x76, 0x3d, 0x22, 0x43,
-  0x6f, 0x6e, 0x74, 0x65, 0x6e, 0x74, 0x2d, 0x54, 0x79, 0x70, 0x65, 0x64, 0x69,
-  0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x20, 0x63, 0x65, 0x6c, 0x6c, 0x73, 0x70,
-  0x61, 0x63, 0x69, 0x6e, 0x67, 0x3d, 0x22, 0x30, 0x22, 0x68, 0x74, 0x6d, 0x6c,
-  0x3b, 0x20, 0x63, 0x68, 0x61, 0x72, 0x73, 0x65, 0x74, 0x3d, 0x75, 0x74, 0x66,
-  0x2d, 0x38, 0x22, 0x20, 0x2f, 0x3e, 0x0a, 0x20, 0x73, 0x74, 0x79, 0x6c, 0x65,
-  0x3d, 0x22, 0x64, 0x69, 0x73, 0x70, 0x6c, 0x61, 0x79, 0x3a, 0x6e, 0x6f, 0x6e,
-  0x65, 0x3b, 0x22, 0x3e, 0x3c, 0x3c, 0x6c, 0x69, 0x3e, 0x3c, 0x61, 0x20, 0x68,
-  0x72, 0x65, 0x66, 0x3d, 0x22, 0x68, 0x74, 0x74, 0x70, 0x3a, 0x2f, 0x2f, 0x77,
-  0x77, 0x77, 0x2e, 0x20, 0x74, 0x79, 0x70, 0x65, 0x3d, 0x27, 0x74, 0x65, 0x78,
-  0x74, 0x2f, 0x6a, 0x61, 0x76, 0x61, 0x73, 0x63, 0x72, 0x69, 0x70, 0x74, 0x27,
-  0x3e, 0xd0, 0xb4, 0xd0, 0xb5, 0xd1, 0x8f, 0xd1, 0x82, 0xd0, 0xb5, 0xd0, 0xbb,
-  0xd1, 0x8c, 0xd0, 0xbd, 0xd0, 0xbe, 0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8, 0xd1,
-  0x81, 0xd0, 0xbe, 0xd0, 0xbe, 0xd1, 0x82, 0xd0, 0xb2, 0xd0, 0xb5, 0xd1, 0x82,
-  0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb2, 0xd0, 0xb8, 0xd0, 0xb8, 0xd0, 0xbf, 0xd1,
-  0x80, 0xd0, 0xbe, 0xd0, 0xb8, 0xd0, 0xb7, 0xd0, 0xb2, 0xd0, 0xbe, 0xd0, 0xb4,
-  0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb2, 0xd0, 0xb0, 0xd0, 0xb1, 0xd0, 0xb5, 0xd0,
-  0xb7, 0xd0, 0xbe, 0xd0, 0xbf, 0xd0, 0xb0, 0xd1, 0x81, 0xd0, 0xbd, 0xd0, 0xbe,
-  0xd1, 0x81, 0xd1, 0x82, 0xd0, 0xb8, 0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x81, 0xe0,
-  0xa4, 0xb8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
-  0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0x82,
-  0xe0, 0xa4, 0x97, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa5, 0x87, 0xe0,
-  0xa4, 0xb8, 0xe0, 0xa4, 0x89, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
-  0xb9, 0xe0, 0xa5, 0x8b, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0xa8, 0xe0, 0xa5, 0x87,
-  0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa7, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0xa8, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0xad, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0xab, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb8,
-  0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0x82, 0xe0, 0xa4, 0x97, 0xe0, 0xa4, 0xb8, 0xe0,
-  0xa5, 0x81, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4,
-  0xb7, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x89,
-  0xe0, 0xa4, 0xaa, 0xe0, 0xa5, 0x80, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xbe, 0xe0,
-  0xa4, 0x87, 0xe0, 0xa4, 0x9f, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbf, 0xe0, 0xa4,
-  0x9c, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0x9e, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xaa,
-  0xe0, 0xa4, 0xa8, 0xe0, 0xa4, 0x95, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4, 0xb0, 0xe0,
-  0xa5, 0x8d, 0xe0, 0xa4, 0xb0, 0xe0, 0xa4, 0xb5, 0xe0, 0xa4, 0xbe, 0xe0, 0xa4,
-  0x88, 0xe0, 0xa4, 0xb8, 0xe0, 0xa4, 0x95, 0xe0, 0xa5, 0x8d, 0xe0, 0xa4, 0xb0,
-  0xe0, 0xa4, 0xbf, 0xe0, 0xa4, 0xaf, 0xe0, 0xa4, 0xa4, 0xe0, 0xa4, 0xbe,
-};
-
-#if defined(__cplusplus) || defined(c_plusplus)
-}  /* extern "C" */
-#endif
diff --git a/Source/ThirdParty/brotli/dec/dictionary.h b/Source/ThirdParty/brotli/dec/dictionary.h
deleted file mode 100644
index ae250c2d7..000000000
--- a/Source/ThirdParty/brotli/dec/dictionary.h
+++ /dev/null
@@ -1,38 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
-   Distributed under MIT license.
-   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-/* Collection of static dictionary words. */
-
-#ifndef BROTLI_DEC_DICTIONARY_H_
-#define BROTLI_DEC_DICTIONARY_H_
-
-#include "./types.h"
-
-#if defined(__cplusplus) || defined(c_plusplus)
-extern "C" {
-#endif
-
-extern const uint8_t kBrotliDictionary[122784];
-
-static const uint32_t kBrotliDictionaryOffsetsByLength[] = {
-  0, 0, 0, 0, 0, 4096, 9216, 21504, 35840, 44032, 53248, 63488, 74752, 87040,
-  93696, 100864, 104704, 106752, 108928, 113536, 115968, 118528, 119872, 121280,
-  122016
-};
-
-static const uint8_t kBrotliDictionarySizeBitsByLength[] = {
-  0, 0, 0, 0, 10, 10, 11, 11, 10, 10, 10, 10, 10,
-  9, 9, 8, 7, 7,  8,  7,  7,  6,  6,  5,  5,
-};
-
-static const int kBrotliMinDictionaryWordLength = 4;
-static const int kBrotliMaxDictionaryWordLength = 24;
-
-#if defined(__cplusplus) || defined(c_plusplus)
-}  /* extern "C" */
-#endif
-
-#endif  /* BROTLI_DEC_DICTIONARY_H_ */
diff --git a/Source/ThirdParty/brotli/dec/huffman.c b/Source/ThirdParty/brotli/dec/huffman.c
index 3775ffe7e..37da2a563 100644
--- a/Source/ThirdParty/brotli/dec/huffman.c
+++ b/Source/ThirdParty/brotli/dec/huffman.c
@@ -10,8 +10,9 @@
 
 #include <string.h>  /* memcpy, memset */
 
+#include "../common/constants.h"
+#include <brotli/types.h>
 #include "./port.h"
-#include "./types.h"
 
 #if defined(__cplusplus) || defined(c_plusplus)
 extern "C" {
@@ -20,7 +21,8 @@ extern "C" {
 #define BROTLI_REVERSE_BITS_MAX 8
 
 #ifdef BROTLI_RBIT
-#define BROTLI_REVERSE_BITS_BASE (32 - BROTLI_REVERSE_BITS_MAX)
+#define BROTLI_REVERSE_BITS_BASE \
+  ((sizeof(reg_t) << 3) - BROTLI_REVERSE_BITS_MAX)
 #else
 #define BROTLI_REVERSE_BITS_BASE 0
 static uint8_t kReverseBits[1 << BROTLI_REVERSE_BITS_MAX] = {
@@ -60,12 +62,12 @@ static uint8_t kReverseBits[1 << BROTLI_REVERSE_BITS_MAX] = {
 #endif  /* BROTLI_RBIT */
 
 #define BROTLI_REVERSE_BITS_LOWEST \
-  (1U << (BROTLI_REVERSE_BITS_MAX - 1 + BROTLI_REVERSE_BITS_BASE))
+  ((reg_t)1 << (BROTLI_REVERSE_BITS_MAX - 1 + BROTLI_REVERSE_BITS_BASE))
 
 /* Returns reverse(num >> BROTLI_REVERSE_BITS_BASE, BROTLI_REVERSE_BITS_MAX),
    where reverse(value, len) is the bit-wise reversal of the len least
    significant bits of value. */
-static BROTLI_INLINE uint32_t BrotliReverseBits(uint32_t num) {
+static BROTLI_INLINE reg_t BrotliReverseBits(reg_t num) {
 #ifdef BROTLI_RBIT
   return BROTLI_RBIT(num);
 #else
@@ -102,13 +104,13 @@ static BROTLI_INLINE int NextTableBitSize(const uint16_t* const count,
 void BrotliBuildCodeLengthsHuffmanTable(HuffmanCode* table,
                                         const uint8_t* const code_lengths,
                                         uint16_t* count) {
-  HuffmanCode code;   /* current table entry */
-  int symbol;         /* symbol index in original or sorted table */
-  uint32_t key;       /* prefix code */
-  uint32_t key_step;  /* prefix code addend */
-  int step;           /* step size to replicate values in current table */
-  int table_size;     /* size of current table */
-  int sorted[18];     /* symbols sorted by code length */
+  HuffmanCode code; /* current table entry */
+  int symbol;       /* symbol index in original or sorted table */
+  reg_t key;        /* prefix code */
+  reg_t key_step;   /* prefix code addend */
+  int step;         /* step size to replicate values in current table */
+  int table_size;   /* size of current table */
+  int sorted[BROTLI_CODE_LENGTH_CODES];  /* symbols sorted by code length */
   /* offsets in sorted table for each length */
   int offset[BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH + 1];
   int bits;
@@ -125,10 +127,10 @@ void BrotliBuildCodeLengthsHuffmanTable(HuffmanCode* table,
     bits++;
   });
   /* Symbols with code length 0 are placed after all other symbols. */
-  offset[0] = 17;
+  offset[0] = BROTLI_CODE_LENGTH_CODES - 1;
 
   /* sort symbols by length, by symbol order within each length */
-  symbol = 18;
+  symbol = BROTLI_CODE_LENGTH_CODES;
   do {
     BROTLI_REPEAT(6, {
       symbol--;
@@ -142,7 +144,7 @@ void BrotliBuildCodeLengthsHuffmanTable(HuffmanCode* table,
   if (offset[0] == 0) {
     code.bits = 0;
     code.value = (uint16_t)sorted[0];
-    for (key = 0; key < (uint32_t)table_size; ++key) {
+    for (key = 0; key < (reg_t)table_size; ++key) {
       table[key] = code;
     }
     return;
@@ -170,18 +172,18 @@ uint32_t BrotliBuildHuffmanTable(HuffmanCode* root_table,
                                  int root_bits,
                                  const uint16_t* const symbol_lists,
                                  uint16_t* count) {
-  HuffmanCode code;       /* current table entry */
-  HuffmanCode* table;     /* next available space in table */
-  int len;                /* current code length */
-  int symbol;             /* symbol index in original or sorted table */
-  uint32_t key;           /* prefix code */
-  uint32_t key_step;      /* prefix code addend */
-  uint32_t sub_key;       /* 2nd level table prefix code */
-  uint32_t sub_key_step;  /* 2nd level table prefix code addend */
-  int step;               /* step size to replicate values in current table */
-  int table_bits;         /* key length of current table */
-  int table_size;         /* size of current table */
-  int total_size;         /* sum of root table size and 2nd level table sizes */
+  HuffmanCode code;    /* current table entry */
+  HuffmanCode* table;  /* next available space in table */
+  int len;             /* current code length */
+  int symbol;          /* symbol index in original or sorted table */
+  reg_t key;           /* prefix code */
+  reg_t key_step;      /* prefix code addend */
+  reg_t sub_key;       /* 2nd level table prefix code */
+  reg_t sub_key_step;  /* 2nd level table prefix code addend */
+  int step;            /* step size to replicate values in current table */
+  int table_bits;      /* key length of current table */
+  int table_size;      /* size of current table */
+  int total_size;      /* sum of root table size and 2nd level table sizes */
   int max_length = -1;
   int bits;
   int bits_count;
diff --git a/Source/ThirdParty/brotli/dec/huffman.h b/Source/ThirdParty/brotli/dec/huffman.h
index fc880810c..d3b4d53e6 100644
--- a/Source/ThirdParty/brotli/dec/huffman.h
+++ b/Source/ThirdParty/brotli/dec/huffman.h
@@ -9,7 +9,7 @@
 #ifndef BROTLI_DEC_HUFFMAN_H_
 #define BROTLI_DEC_HUFFMAN_H_
 
-#include "./types.h"
+#include <brotli/types.h>
 #include "./port.h"
 
 #if defined(__cplusplus) || defined(c_plusplus)
@@ -18,16 +18,16 @@ extern "C" {
 
 #define BROTLI_HUFFMAN_MAX_CODE_LENGTH 15
 
-/* For current format this constant equals to kNumInsertAndCopyCodes */
-#define BROTLI_HUFFMAN_MAX_CODE_LENGTHS_SIZE 704
-
 /* Maximum possible Huffman table size for an alphabet size of (index * 32),
  * max code length 15 and root table bits 8. */
 static const uint16_t kMaxHuffmanTableSize[] = {
   256, 402, 436, 468, 500, 534, 566, 598, 630, 662, 694, 726, 758, 790, 822,
   854, 886, 920, 952, 984, 1016, 1048, 1080};
+/* BROTLI_NUM_BLOCK_LEN_SYMBOLS == 26 */
 #define BROTLI_HUFFMAN_MAX_SIZE_26 396
+/* BROTLI_MAX_BLOCK_TYPE_SYMBOLS == 258 */
 #define BROTLI_HUFFMAN_MAX_SIZE_258 632
+/* BROTLI_MAX_CONTEXT_MAP_SYMBOLS == 272 */
 #define BROTLI_HUFFMAN_MAX_SIZE_272 646
 
 #define BROTLI_HUFFMAN_MAX_CODE_LENGTH_CODE_LENGTH 5
diff --git a/Source/ThirdParty/brotli/dec/port.h b/Source/ThirdParty/brotli/dec/port.h
index 19b457c75..6b3d7352b 100644
--- a/Source/ThirdParty/brotli/dec/port.h
+++ b/Source/ThirdParty/brotli/dec/port.h
@@ -16,6 +16,7 @@
       features and attributes
     * BROTLI_BUILD_PORTABLE disables dangerous optimizations, like unaligned
       read and overlapping memcpy; this reduces decompression speed by 5%
+    * BROTLI_BUILD_NO_RBIT disables "rbit" optimization for ARM CPUs
     * BROTLI_DEBUG dumps file name and line number when decoder detects stream
       or memory error
     * BROTLI_ENABLE_LOG enables asserts and dumps various state information
@@ -29,27 +30,16 @@
 #include <stdio.h>
 #endif
 
-/* Compatibility with non-clang compilers. */
-#ifndef __has_builtin
-#define __has_builtin(x) 0
-#endif
-
-#ifndef __has_attribute
-#define __has_attribute(x) 0
-#endif
-
-#ifndef __has_feature
-#define __has_feature(x) 0
-#endif
+#include <brotli/port.h>
 
 #if defined(__arm__) || defined(__thumb__) || \
-    defined(_M_ARM) || defined(_M_ARMT)
+    defined(_M_ARM) || defined(_M_ARMT) || defined(__ARM64_ARCH_8__)
 #define BROTLI_TARGET_ARM
-#if (defined(__ARM_ARCH) && (__ARM_ARCH >= 7)) || \
-    (defined(M_ARM) && (M_ARM >= 7))
+#if (defined(__ARM_ARCH) && (__ARM_ARCH == 7)) || \
+    (defined(M_ARM) && (M_ARM == 7))
 #define BROTLI_TARGET_ARMV7
 #endif  /* ARMv7 */
-#if defined(__aarch64__)
+#if defined(__aarch64__) || defined(__ARM64_ARCH_8__)
 #define BROTLI_TARGET_ARMV8
 #endif  /* ARMv8 */
 #endif  /* ARM */
@@ -66,61 +56,16 @@
 #define BROTLI_TARGET_POWERPC64
 #endif
 
-#if defined(__GNUC__) && defined(__GNUC_MINOR__)
-#define BROTLI_GCC_VERSION (__GNUC__ * 100 + __GNUC_MINOR__)
-#else
-#define BROTLI_GCC_VERSION 0
-#endif
-
-#if defined(__ICC)
-#define BROTLI_ICC_VERSION __ICC
-#else
-#define BROTLI_ICC_VERSION 0
-#endif
-
-#if defined(BROTLI_BUILD_MODERN_COMPILER)
-#define BROTLI_MODERN_COMPILER 1
-#elif (BROTLI_GCC_VERSION > 300) || (BROTLI_ICC_VERSION >= 1600)
-#define BROTLI_MODERN_COMPILER 1
-#else
-#define BROTLI_MODERN_COMPILER 0
-#endif
-
 #ifdef BROTLI_BUILD_PORTABLE
 #define BROTLI_ALIGNED_READ (!!1)
 #elif defined(BROTLI_TARGET_X86) || defined(BROTLI_TARGET_X64) || \
      defined(BROTLI_TARGET_ARMV7) || defined(BROTLI_TARGET_ARMV8)
-/* Allow unaligned read only for whitelisted CPUs. */
+/* Allow unaligned read only for white-listed CPUs. */
 #define BROTLI_ALIGNED_READ (!!0)
 #else
 #define BROTLI_ALIGNED_READ (!!1)
 #endif
 
-/* Define "PREDICT_TRUE" and "PREDICT_FALSE" macros for capable compilers.
-
-To apply compiler hint, enclose the branching condition into macros, like this:
-
-  if (PREDICT_TRUE(zero == 0)) {
-    // main execution path
-  } else {
-    // compiler should place this code outside of main execution path
-  }
-
-OR:
-
-  if (PREDICT_FALSE(something_rare_or_unexpected_happens)) {
-    // compiler should place this code outside of main execution path
-  }
-
-*/
-#if BROTLI_MODERN_COMPILER || __has_builtin(__builtin_expect)
-#define PREDICT_TRUE(x) (__builtin_expect(!!(x), 1))
-#define PREDICT_FALSE(x) (__builtin_expect(x, 0))
-#else
-#define PREDICT_FALSE(x) (x)
-#define PREDICT_TRUE(x) (x)
-#endif
-
 /* IS_CONSTANT macros returns true for compile-time constant expressions. */
 #if BROTLI_MODERN_COMPILER || __has_builtin(__builtin_constant_p)
 #define IS_CONSTANT(x) (!!__builtin_constant_p(x))
@@ -128,35 +73,6 @@ OR:
 #define IS_CONSTANT(x) (!!0)
 #endif
 
-#if BROTLI_MODERN_COMPILER || __has_attribute(always_inline)
-#define ATTRIBUTE_ALWAYS_INLINE __attribute__ ((always_inline))
-#else
-#define ATTRIBUTE_ALWAYS_INLINE
-#endif
-
-#if defined(_WIN32) || defined(__CYGWIN__)
-#define ATTRIBUTE_VISIBILITY_HIDDEN
-#elif BROTLI_MODERN_COMPILER || __has_attribute(visibility)
-#define ATTRIBUTE_VISIBILITY_HIDDEN __attribute__ ((visibility ("hidden")))
-#else
-#define ATTRIBUTE_VISIBILITY_HIDDEN
-#endif
-
-#ifndef BROTLI_INTERNAL
-#define BROTLI_INTERNAL ATTRIBUTE_VISIBILITY_HIDDEN
-#endif
-
-#ifndef _MSC_VER
-#if defined(__cplusplus) || !defined(__STRICT_ANSI__) || \
-    __STDC_VERSION__ >= 199901L
-#define BROTLI_INLINE inline ATTRIBUTE_ALWAYS_INLINE
-#else
-#define BROTLI_INLINE
-#endif
-#else  /* _MSC_VER */
-#define BROTLI_INLINE __forceinline
-#endif  /* _MSC_VER */
-
 #ifdef BROTLI_ENABLE_LOG
 #define BROTLI_DCHECK(x) assert(x)
 #define BROTLI_LOG(x) printf x
@@ -166,7 +82,7 @@ OR:
 #endif
 
 #if defined(BROTLI_DEBUG) || defined(BROTLI_ENABLE_LOG)
-static inline void BrotliDump(const char* f, int l, const char* fn) {
+static BROTLI_INLINE void BrotliDump(const char* f, int l, const char* fn) {
   fprintf(stderr, "%s:%d (%s)\n", f, l, fn);
   fflush(stderr);
 }
@@ -186,6 +102,12 @@ static inline void BrotliDump(const char* f, int l, const char* fn) {
 #define BROTLI_64_BITS 0
 #endif
 
+#if (BROTLI_64_BITS)
+#define reg_t uint64_t
+#else
+#define reg_t uint32_t
+#endif
+
 #if defined(BROTLI_BUILD_BIG_ENDIAN)
 #define BROTLI_LITTLE_ENDIAN 0
 #define BROTLI_BIG_ENDIAN 1
@@ -211,22 +133,18 @@ static inline void BrotliDump(const char* f, int l, const char* fn) {
 #define BROTLI_LITTLE_ENDIAN 0
 #endif
 
-#if BROTLI_MODERN_COMPILER || __has_attribute(noinline)
-#define BROTLI_NOINLINE __attribute__((noinline))
-#else
-#define BROTLI_NOINLINE
-#endif
-
 #define BROTLI_REPEAT(N, X) {     \
   if ((N & 1) != 0) {X;}          \
   if ((N & 2) != 0) {X; X;}       \
   if ((N & 4) != 0) {X; X; X; X;} \
 }
 
-#if BROTLI_MODERN_COMPILER || defined(__llvm__)
-#if defined(BROTLI_TARGET_ARMV7)
-static BROTLI_INLINE unsigned BrotliRBit(unsigned input) {
-  unsigned output;
+#if (BROTLI_MODERN_COMPILER || defined(__llvm__)) && \
+    !defined(BROTLI_BUILD_NO_RBIT)
+#if defined(BROTLI_TARGET_ARMV7) || defined(BROTLI_TARGET_ARMV8)
+/* TODO: detect ARMv6T2 and enable this code for it. */
+static BROTLI_INLINE reg_t BrotliRBit(reg_t input) {
+  reg_t output;
   __asm__("rbit %0, %1\n" : "=r"(output) : "r"(input));
   return output;
 }
@@ -247,6 +165,4 @@ static BROTLI_INLINE unsigned BrotliRBit(unsigned input) {
   X = NULL;                                  \
 }
 
-#define BROTLI_UNUSED(X) (void)(X)
-
 #endif  /* BROTLI_DEC_PORT_H_ */
diff --git a/Source/ThirdParty/brotli/dec/prefix.h b/Source/ThirdParty/brotli/dec/prefix.h
index eaae37f02..aa776c723 100644
--- a/Source/ThirdParty/brotli/dec/prefix.h
+++ b/Source/ThirdParty/brotli/dec/prefix.h
@@ -11,7 +11,8 @@
 #ifndef BROTLI_DEC_PREFIX_H_
 #define BROTLI_DEC_PREFIX_H_
 
-#include "./types.h"
+#include "../common/constants.h"
+#include <brotli/types.h>
 
 /* Represents the range of values belonging to a prefix code: */
 /* [offset, offset + 2^nbits) */
@@ -20,7 +21,8 @@ struct PrefixCodeRange {
   uint8_t nbits;
 };
 
-static const struct PrefixCodeRange kBlockLengthPrefixCode[] = {
+static const struct PrefixCodeRange
+    kBlockLengthPrefixCode[BROTLI_NUM_BLOCK_LEN_SYMBOLS] = {
   {   1,  2}, {    5,  2}, {  9,   2}, {  13,  2},
   {  17,  3}, {   25,  3}, {  33,  3}, {  41,  3},
   {  49,  4}, {   65,  4}, {  81,  4}, {  97,  4},
@@ -39,7 +41,7 @@ typedef struct CmdLutElement {
   uint16_t copy_len_offset;
 } CmdLutElement;
 
-static const CmdLutElement kCmdLut[704] = {
+static const CmdLutElement kCmdLut[BROTLI_NUM_COMMAND_SYMBOLS] = {
   { 0x00, 0x00, 0, 0x00, 0x0000, 0x0002 },
   { 0x00, 0x00, 0, 0x01, 0x0000, 0x0003 },
   { 0x00, 0x00, 0, 0x02, 0x0000, 0x0004 },
diff --git a/Source/ThirdParty/brotli/dec/state.c b/Source/ThirdParty/brotli/dec/state.c
index 358e08d3d..554313d8f 100644
--- a/Source/ThirdParty/brotli/dec/state.c
+++ b/Source/ThirdParty/brotli/dec/state.c
@@ -8,17 +8,13 @@
 
 #include <stdlib.h>  /* free, malloc */
 
+#include <brotli/types.h>
 #include "./huffman.h"
-#include "./types.h"
 
 #if defined(__cplusplus) || defined(c_plusplus)
 extern "C" {
 #endif
 
-/* Declared in decode.h */
-int BrotliStateIsStreamStart(const BrotliState* s);
-int BrotliStateIsStreamEnd(const BrotliState* s);
-
 static void* DefaultAllocFunc(void* opaque, size_t size) {
   BROTLI_UNUSED(opaque);
   return malloc(size);
@@ -29,11 +25,11 @@ static void DefaultFreeFunc(void* opaque, void* address) {
   free(address);
 }
 
-void BrotliStateInit(BrotliState* s) {
-  BrotliStateInitWithCustomAllocators(s, 0, 0, 0);
+void BrotliDecoderStateInit(BrotliDecoderState* s) {
+  BrotliDecoderStateInitWithCustomAllocators(s, 0, 0, 0);
 }
 
-void BrotliStateInitWithCustomAllocators(BrotliState* s,
+void BrotliDecoderStateInitWithCustomAllocators(BrotliDecoderState* s,
     brotli_alloc_func alloc_func, brotli_free_func free_func, void* opaque) {
   if (!alloc_func) {
     s->alloc_func = DefaultAllocFunc;
@@ -45,6 +41,8 @@ void BrotliStateInitWithCustomAllocators(BrotliState* s,
     s->memory_manager_opaque = opaque;
   }
 
+  s->error_code = 0; /* BROTLI_DECODER_NO_ERROR */
+
   BrotliInitBitReader(&s->br);
   s->state = BROTLI_STATE_UNINITED;
   s->substate_metablock_header = BROTLI_STATE_METABLOCK_HEADER_NONE;
@@ -55,6 +53,8 @@ void BrotliStateInitWithCustomAllocators(BrotliState* s,
   s->substate_decode_uint8 = BROTLI_STATE_DECODE_UINT8_NONE;
   s->substate_read_block_length = BROTLI_STATE_READ_BLOCK_LENGTH_NONE;
 
+  s->dictionary = BrotliGetDictionary();
+
   s->buffer_length = 0;
   s->loop_counter = 0;
   s->pos = 0;
@@ -64,6 +64,9 @@ void BrotliStateInitWithCustomAllocators(BrotliState* s,
   s->block_type_trees = NULL;
   s->block_len_trees = NULL;
   s->ringbuffer = NULL;
+  s->ringbuffer_size = 0;
+  s->new_ringbuffer_size = 0;
+  s->ringbuffer_mask = 0;
 
   s->context_map = NULL;
   s->context_modes = NULL;
@@ -80,10 +83,12 @@ void BrotliStateInitWithCustomAllocators(BrotliState* s,
   s->distance_hgroup.codes = NULL;
   s->distance_hgroup.htrees = NULL;
 
-  s->custom_dict = NULL;
-  s->custom_dict_size = 0;
-
   s->is_last_metablock = 0;
+  s->is_uncompressed = 0;
+  s->is_metadata = 0;
+  s->should_wrap_ringbuffer = 0;
+  s->canny_ringbuffer_allocation = 1;
+
   s->window_bits = 0;
   s->max_distance = 0;
   s->dist_rb[0] = 16;
@@ -97,10 +102,10 @@ void BrotliStateInitWithCustomAllocators(BrotliState* s,
   /* Make small negative indexes addressable. */
   s->symbol_lists = &s->symbols_lists_array[BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1];
 
-  s->mtf_upper_bound = 255;
+  s->mtf_upper_bound = 63;
 }
 
-void BrotliStateMetablockBegin(BrotliState* s) {
+void BrotliDecoderStateMetablockBegin(BrotliDecoderState* s) {
   s->meta_block_remaining_len = 0;
   s->block_length[0] = 1U << 28;
   s->block_length[1] = 1U << 28;
@@ -131,48 +136,35 @@ void BrotliStateMetablockBegin(BrotliState* s) {
   s->distance_hgroup.htrees = NULL;
 }
 
-void BrotliStateCleanupAfterMetablock(BrotliState* s) {
+void BrotliDecoderStateCleanupAfterMetablock(BrotliDecoderState* s) {
   BROTLI_FREE(s, s->context_modes);
   BROTLI_FREE(s, s->context_map);
   BROTLI_FREE(s, s->dist_context_map);
-
-  BrotliHuffmanTreeGroupRelease(s, &s->literal_hgroup);
-  BrotliHuffmanTreeGroupRelease(s, &s->insert_copy_hgroup);
-  BrotliHuffmanTreeGroupRelease(s, &s->distance_hgroup);
+  BROTLI_FREE(s, s->literal_hgroup.htrees);
+  BROTLI_FREE(s, s->insert_copy_hgroup.htrees);
+  BROTLI_FREE(s, s->distance_hgroup.htrees);
 }
 
-void BrotliStateCleanup(BrotliState* s) {
-  BrotliStateCleanupAfterMetablock(s);
+void BrotliDecoderStateCleanup(BrotliDecoderState* s) {
+  BrotliDecoderStateCleanupAfterMetablock(s);
 
   BROTLI_FREE(s, s->ringbuffer);
   BROTLI_FREE(s, s->block_type_trees);
 }
 
-int BrotliStateIsStreamStart(const BrotliState* s) {
-  return (s->state == BROTLI_STATE_UNINITED &&
-      BrotliGetAvailableBits(&s->br) == 0);
-}
-
-int BrotliStateIsStreamEnd(const BrotliState* s) {
-  return s->state == BROTLI_STATE_DONE;
-}
-
-void BrotliHuffmanTreeGroupInit(BrotliState* s, HuffmanTreeGroup* group,
-    uint32_t alphabet_size, uint32_t ntrees) {
+BROTLI_BOOL BrotliDecoderHuffmanTreeGroupInit(BrotliDecoderState* s,
+    HuffmanTreeGroup* group, uint32_t alphabet_size, uint32_t ntrees) {
   /* Pack two allocations into one */
   const size_t max_table_size = kMaxHuffmanTableSize[(alphabet_size + 31) >> 5];
   const size_t code_size = sizeof(HuffmanCode) * ntrees * max_table_size;
   const size_t htree_size = sizeof(HuffmanCode*) * ntrees;
-  char* p = (char*)BROTLI_ALLOC(s, code_size + htree_size);
+  /* Pointer alignment is, hopefully, wider than sizeof(HuffmanCode). */
+  HuffmanCode** p = (HuffmanCode**)BROTLI_ALLOC(s, code_size + htree_size);
   group->alphabet_size = (uint16_t)alphabet_size;
   group->num_htrees = (uint16_t)ntrees;
-  group->codes = (HuffmanCode*)p;
-  group->htrees = (HuffmanCode**)(p + code_size);
-}
-
-void BrotliHuffmanTreeGroupRelease(BrotliState* s, HuffmanTreeGroup* group) {
-  BROTLI_FREE(s, group->codes);
-  group->htrees = NULL;
+  group->htrees = p;
+  group->codes = (HuffmanCode*)(&p[ntrees]);
+  return !!p;
 }
 
 #if defined(__cplusplus) || defined(c_plusplus)
diff --git a/Source/ThirdParty/brotli/dec/state.h b/Source/ThirdParty/brotli/dec/state.h
index 63647ef2b..1d2773b7f 100644
--- a/Source/ThirdParty/brotli/dec/state.h
+++ b/Source/ThirdParty/brotli/dec/state.h
@@ -9,9 +9,11 @@
 #ifndef BROTLI_DEC_STATE_H_
 #define BROTLI_DEC_STATE_H_
 
+#include "../common/constants.h"
+#include "../common/dictionary.h"
+#include <brotli/types.h>
 #include "./bit_reader.h"
 #include "./huffman.h"
-#include "./types.h"
 #include "./port.h"
 
 #if defined(__cplusplus) || defined(c_plusplus)
@@ -93,7 +95,7 @@ typedef enum {
   BROTLI_STATE_READ_BLOCK_LENGTH_SUFFIX
 } BrotliRunningReadBlockLengthState;
 
-struct BrotliStateStruct {
+struct BrotliDecoderStateStruct {
   BrotliRunningState state;
 
   /* This counter is reused for several disjoint loops. */
@@ -114,7 +116,6 @@ struct BrotliStateStruct {
 
   int pos;
   int max_backward_distance;
-  int max_backward_distance_minus_custom_dict_size;
   int max_distance;
   int ringbuffer_size;
   int ringbuffer_mask;
@@ -140,6 +141,8 @@ struct BrotliStateStruct {
   /* This is true if the literal context map histogram type always matches the
   block type. It is then not needed to keep the context (faster decoding). */
   int trivial_literal_context;
+  /* Distance context is actual after command is decoded and before distance
+  is computed. After distance computation it is used as a temporary variable. */
   int distance_context;
   int meta_block_remaining_len;
   uint32_t block_length_index;
@@ -160,8 +163,8 @@ struct BrotliStateStruct {
   int distance_code;
 
   /* For partial write operations */
-  size_t rb_roundtrips;  /* How many times we went around the ringbuffer */
-  size_t partial_pos_out;  /* How much output to the user in total (<= rb) */
+  size_t rb_roundtrips;  /* How many times we went around the ring-buffer */
+  size_t partial_pos_out;  /* How much output to the user in total */
 
   /* For ReadHuffmanCode */
   uint32_t symbol;
@@ -169,14 +172,14 @@ struct BrotliStateStruct {
   uint32_t space;
 
   HuffmanCode table[32];
-  /* List of of symbol chains. */
+  /* List of heads of symbol chains. */
   uint16_t* symbol_lists;
   /* Storage from symbol_lists. */
   uint16_t symbols_lists_array[BROTLI_HUFFMAN_MAX_CODE_LENGTH + 1 +
-                               BROTLI_HUFFMAN_MAX_CODE_LENGTHS_SIZE];
+                               BROTLI_NUM_COMMAND_SYMBOLS];
   /* Tails of symbol chains. */
   int next_symbol[32];
-  uint8_t code_length_code_lengths[18];
+  uint8_t code_length_code_lengths[BROTLI_CODE_LENGTH_CODES];
   /* Population counts for the code lengths */
   uint16_t code_length_histo[16];
 
@@ -192,11 +195,7 @@ struct BrotliStateStruct {
 
   /* For InverseMoveToFrontTransform */
   uint32_t mtf_upper_bound;
-  uint8_t mtf[256 + 4];
-
-  /* For custom dictionaries */
-  const uint8_t* custom_dict;
-  int custom_dict_size;
+  uint32_t mtf[64 + 1];
 
   /* less used attributes are in the end of this struct */
   /* States inside function calls */
@@ -208,32 +207,38 @@ struct BrotliStateStruct {
   BrotliRunningDecodeUint8State substate_decode_uint8;
   BrotliRunningReadBlockLengthState substate_read_block_length;
 
-  uint8_t is_last_metablock;
-  uint8_t is_uncompressed;
-  uint8_t is_metadata;
-  uint8_t size_nibbles;
+  unsigned int is_last_metablock : 1;
+  unsigned int is_uncompressed : 1;
+  unsigned int is_metadata : 1;
+  unsigned int should_wrap_ringbuffer : 1;
+  unsigned int canny_ringbuffer_allocation : 1;
+  unsigned int size_nibbles : 8;
   uint32_t window_bits;
 
+  int new_ringbuffer_size;
+
   uint32_t num_literal_htrees;
   uint8_t* context_map;
   uint8_t* context_modes;
+  const BrotliDictionary* dictionary;
 
   uint32_t trivial_literal_contexts[8];  /* 256 bits */
 };
 
-typedef struct BrotliStateStruct BrotliStateInternal;
-#define BrotliState BrotliStateInternal
-
-BROTLI_INTERNAL void BrotliStateInit(BrotliState* s);
-BROTLI_INTERNAL void BrotliStateInitWithCustomAllocators(BrotliState* s,
-    brotli_alloc_func alloc_func, brotli_free_func free_func, void* opaque);
-BROTLI_INTERNAL void BrotliStateCleanup(BrotliState* s);
-BROTLI_INTERNAL void BrotliStateMetablockBegin(BrotliState* s);
-BROTLI_INTERNAL void BrotliStateCleanupAfterMetablock(BrotliState* s);
-BROTLI_INTERNAL void BrotliHuffmanTreeGroupInit(BrotliState* s,
-    HuffmanTreeGroup* group, uint32_t alphabet_size, uint32_t ntrees);
-BROTLI_INTERNAL void BrotliHuffmanTreeGroupRelease(BrotliState* s,
-    HuffmanTreeGroup* group);
+typedef struct BrotliDecoderStateStruct BrotliDecoderStateInternal;
+#define BrotliDecoderState BrotliDecoderStateInternal
+
+BROTLI_INTERNAL void BrotliDecoderStateInit(BrotliDecoderState* s);
+BROTLI_INTERNAL void BrotliDecoderStateInitWithCustomAllocators(
+    BrotliDecoderState* s, brotli_alloc_func alloc_func,
+    brotli_free_func free_func, void* opaque);
+BROTLI_INTERNAL void BrotliDecoderStateCleanup(BrotliDecoderState* s);
+BROTLI_INTERNAL void BrotliDecoderStateMetablockBegin(BrotliDecoderState* s);
+BROTLI_INTERNAL void BrotliDecoderStateCleanupAfterMetablock(
+    BrotliDecoderState* s);
+BROTLI_INTERNAL BROTLI_BOOL BrotliDecoderHuffmanTreeGroupInit(
+    BrotliDecoderState* s, HuffmanTreeGroup* group, uint32_t alphabet_size,
+    uint32_t ntrees);
 
 #if defined(__cplusplus) || defined(c_plusplus)
 }  /* extern "C" */
diff --git a/Source/ThirdParty/brotli/dec/transform.h b/Source/ThirdParty/brotli/dec/transform.h
index 8c08f3fc0..fde3cdfdf 100644
--- a/Source/ThirdParty/brotli/dec/transform.h
+++ b/Source/ThirdParty/brotli/dec/transform.h
@@ -9,8 +9,8 @@
 #ifndef BROTLI_DEC_TRANSFORM_H_
 #define BROTLI_DEC_TRANSFORM_H_
 
+#include <brotli/types.h>
 #include "./port.h"
-#include "./types.h"
 
 #if defined(__cplusplus) || defined(c_plusplus)
 extern "C" {
@@ -247,7 +247,7 @@ static int ToUpperCase(uint8_t* p) {
     }
     return 1;
   }
-  /* An overly simplified uppercasing model for utf-8. */
+  /* An overly simplified uppercasing model for UTF-8. */
   if (p[0] < 0xe0) {
     p[1] ^= 32;
     return 2;
diff --git a/Source/ThirdParty/brotli/dec/types.h b/Source/ThirdParty/brotli/dec/types.h
deleted file mode 100644
index 0f7a0216a..000000000
--- a/Source/ThirdParty/brotli/dec/types.h
+++ /dev/null
@@ -1,38 +0,0 @@
-/* Copyright 2013 Google Inc. All Rights Reserved.
-
-   Distributed under MIT license.
-   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
-*/
-
-/* Common types */
-
-#ifndef BROTLI_DEC_TYPES_H_
-#define BROTLI_DEC_TYPES_H_
-
-#include <stddef.h>  /* for size_t */
-
-#if defined(_MSC_VER) && (_MSC_VER < 1600)
-typedef __int8 int8_t;
-typedef unsigned __int8 uint8_t;
-typedef __int16 int16_t;
-typedef unsigned __int16 uint16_t;
-typedef __int32 int32_t;
-typedef unsigned __int32 uint32_t;
-typedef unsigned __int64 uint64_t;
-typedef __int64 int64_t;
-#else
-#include <stdint.h>
-#endif  /* defined(_MSC_VER) && (_MSC_VER < 1600) */
-
-/* Allocating function pointer. Function MUST return 0 in the case of failure.
-   Otherwise it MUST return a valid pointer to a memory region of at least
-   size length. Neither items nor size are allowed to be 0.
-   opaque argument is a pointer provided by client and could be used to bind
-   function to specific object (memory pool). */
-typedef void* (*brotli_alloc_func)(void* opaque, size_t size);
-
-/* Deallocating function pointer. Function SHOULD be no-op in the case the
-   address is 0. */
-typedef void (*brotli_free_func)(void* opaque, void* address);
-
-#endif  /* BROTLI_DEC_TYPES_H_ */
diff --git a/Source/ThirdParty/brotli/include/brotli/decode.h b/Source/ThirdParty/brotli/include/brotli/decode.h
new file mode 100755
index 000000000..d1d21c42d
--- /dev/null
+++ b/Source/ThirdParty/brotli/include/brotli/decode.h
@@ -0,0 +1,339 @@
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+   Distributed under MIT license.
+   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/**
+ * @file
+ * API for Brotli decompression.
+ */
+
+#ifndef BROTLI_DEC_DECODE_H_
+#define BROTLI_DEC_DECODE_H_
+
+#include <brotli/port.h>
+#include <brotli/types.h>
+
+#if defined(__cplusplus) || defined(c_plusplus)
+extern "C" {
+#endif
+
+/**
+ * Opaque structure that holds decoder state.
+ *
+ * Allocated and initialized with ::BrotliDecoderCreateInstance.
+ * Cleaned up and deallocated with ::BrotliDecoderDestroyInstance.
+ */
+typedef struct BrotliDecoderStateStruct BrotliDecoderState;
+
+/**
+ * Result type for ::BrotliDecoderDecompress and
+ * ::BrotliDecoderDecompressStream functions.
+ */
+typedef enum {
+  /** Decoding error, e.g. corrupted input or memory allocation problem. */
+  BROTLI_DECODER_RESULT_ERROR = 0,
+  /** Decoding successfully completed */
+  BROTLI_DECODER_RESULT_SUCCESS = 1,
+  /** Partially done; should be called again with more input */
+  BROTLI_DECODER_RESULT_NEEDS_MORE_INPUT = 2,
+  /** Partially done; should be called again with more output */
+  BROTLI_DECODER_RESULT_NEEDS_MORE_OUTPUT = 3
+} BrotliDecoderResult;
+
+/**
+ * Template that evaluates items of ::BrotliDecoderErrorCode.
+ *
+ * Example: @code {.cpp}
+ * // Log Brotli error code.
+ * switch (brotliDecoderErrorCode) {
+ * #define CASE_(PREFIX, NAME, CODE) \
+ *   case BROTLI_DECODER ## PREFIX ## NAME: \
+ *     LOG(INFO) << "error code:" << #NAME; \
+ *     break;
+ * #define NEWLINE_
+ * BROTLI_DECODER_ERROR_CODES_LIST(CASE_, NEWLINE_)
+ * #undef CASE_
+ * #undef NEWLINE_
+ *   default: LOG(FATAL) << "unknown brotli error code";
+ * }
+ * @endcode
+ */
+#define BROTLI_DECODER_ERROR_CODES_LIST(BROTLI_ERROR_CODE, SEPARATOR)      \
+  BROTLI_ERROR_CODE(_, NO_ERROR, 0) SEPARATOR                              \
+  /* Same as BrotliDecoderResult values */                                 \
+  BROTLI_ERROR_CODE(_, SUCCESS, 1) SEPARATOR                               \
+  BROTLI_ERROR_CODE(_, NEEDS_MORE_INPUT, 2) SEPARATOR                      \
+  BROTLI_ERROR_CODE(_, NEEDS_MORE_OUTPUT, 3) SEPARATOR                     \
+                                                                           \
+  /* Errors caused by invalid input */                                     \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, EXUBERANT_NIBBLE, -1) SEPARATOR        \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, RESERVED, -2) SEPARATOR                \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, EXUBERANT_META_NIBBLE, -3) SEPARATOR   \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, SIMPLE_HUFFMAN_ALPHABET, -4) SEPARATOR \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, SIMPLE_HUFFMAN_SAME, -5) SEPARATOR     \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, CL_SPACE, -6) SEPARATOR                \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, HUFFMAN_SPACE, -7) SEPARATOR           \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, CONTEXT_MAP_REPEAT, -8) SEPARATOR      \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, BLOCK_LENGTH_1, -9) SEPARATOR          \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, BLOCK_LENGTH_2, -10) SEPARATOR         \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, TRANSFORM, -11) SEPARATOR              \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, DICTIONARY, -12) SEPARATOR             \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, WINDOW_BITS, -13) SEPARATOR            \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, PADDING_1, -14) SEPARATOR              \
+  BROTLI_ERROR_CODE(_ERROR_FORMAT_, PADDING_2, -15) SEPARATOR              \
+                                                                           \
+  /* -16..-17 codes are reserved */                                        \
+                                                                           \
+  BROTLI_ERROR_CODE(_ERROR_, COMPOUND_DICTIONARY, -18) SEPARATOR           \
+  BROTLI_ERROR_CODE(_ERROR_, DICTIONARY_NOT_SET, -19) SEPARATOR            \
+  BROTLI_ERROR_CODE(_ERROR_, INVALID_ARGUMENTS, -20) SEPARATOR             \
+                                                                           \
+  /* Memory allocation problems */                                         \
+  BROTLI_ERROR_CODE(_ERROR_ALLOC_, CONTEXT_MODES, -21) SEPARATOR           \
+  /* Literal, insert and distance trees together */                        \
+  BROTLI_ERROR_CODE(_ERROR_ALLOC_, TREE_GROUPS, -22) SEPARATOR             \
+  /* -23..-24 codes are reserved for distinct tree groups */               \
+  BROTLI_ERROR_CODE(_ERROR_ALLOC_, CONTEXT_MAP, -25) SEPARATOR             \
+  BROTLI_ERROR_CODE(_ERROR_ALLOC_, RING_BUFFER_1, -26) SEPARATOR           \
+  BROTLI_ERROR_CODE(_ERROR_ALLOC_, RING_BUFFER_2, -27) SEPARATOR           \
+  /* -28..-29 codes are reserved for dynamic ring-buffer allocation */     \
+  BROTLI_ERROR_CODE(_ERROR_ALLOC_, BLOCK_TYPE_TREES, -30) SEPARATOR        \
+                                                                           \
+  /* "Impossible" states */                                                \
+  BROTLI_ERROR_CODE(_ERROR_, UNREACHABLE, -31)
+
+/**
+ * Error code for detailed logging / production debugging.
+ *
+ * See ::BrotliDecoderGetErrorCode and ::BROTLI_LAST_ERROR_CODE.
+ */
+typedef enum {
+#define BROTLI_COMMA_ ,
+#define BROTLI_ERROR_CODE_ENUM_ITEM_(PREFIX, NAME, CODE) \
+    BROTLI_DECODER ## PREFIX ## NAME = CODE
+  BROTLI_DECODER_ERROR_CODES_LIST(BROTLI_ERROR_CODE_ENUM_ITEM_, BROTLI_COMMA_)
+} BrotliDecoderErrorCode;
+#undef BROTLI_ERROR_CODE_ENUM_ITEM_
+#undef BROTLI_COMMA_
+
+/**
+ * The value of the last error code, negative integer.
+ *
+ * All other error code values are in the range from ::BROTLI_LAST_ERROR_CODE
+ * to @c -1. There are also 4 other possible non-error codes @c 0 .. @c 3 in
+ * ::BrotliDecoderErrorCode enumeration.
+ */
+#define BROTLI_LAST_ERROR_CODE BROTLI_DECODER_ERROR_UNREACHABLE
+
+/** Options to be used with ::BrotliDecoderSetParameter. */
+typedef enum BrotliDecoderParameter {
+  /**
+   * Disable "canny" ring buffer allocation strategy.
+   *
+   * Ring buffer is allocated according to window size, despite the real size of
+   * the content.
+   */
+  BROTLI_DECODER_PARAM_DISABLE_RING_BUFFER_REALLOCATION = 0
+} BrotliDecoderParameter;
+
+/**
+ * Sets the specified parameter to the given decoder instance.
+ *
+ * @param state decoder instance
+ * @param param parameter to set
+ * @param value new parameter value
+ * @returns ::BROTLI_FALSE if parameter is unrecognized, or value is invalid
+ * @returns ::BROTLI_TRUE if value is accepted
+ */
+BROTLI_DEC_API BROTLI_BOOL BrotliDecoderSetParameter(
+    BrotliDecoderState* state, BrotliDecoderParameter param, uint32_t value);
+
+/**
+ * Creates an instance of ::BrotliDecoderState and initializes it.
+ *
+ * The instance can be used once for decoding and should then be destroyed with
+ * ::BrotliDecoderDestroyInstance, it cannot be reused for a new decoding
+ * session.
+ *
+ * @p alloc_func and @p free_func @b MUST be both zero or both non-zero. In the
+ * case they are both zero, default memory allocators are used. @p opaque is
+ * passed to @p alloc_func and @p free_func when they are called.
+ *
+ * @param alloc_func custom memory allocation function
+ * @param free_func custom memory fee function
+ * @param opaque custom memory manager handle
+ * @returns @c 0 if instance can not be allocated or initialized
+ * @returns pointer to initialized ::BrotliDecoderState otherwise
+ */
+BROTLI_DEC_API BrotliDecoderState* BrotliDecoderCreateInstance(
+    brotli_alloc_func alloc_func, brotli_free_func free_func, void* opaque);
+
+/**
+ * Deinitializes and frees ::BrotliDecoderState instance.
+ *
+ * @param state decoder instance to be cleaned up and deallocated
+ */
+BROTLI_DEC_API void BrotliDecoderDestroyInstance(BrotliDecoderState* state);
+
+/**
+ * Performs one-shot memory-to-memory decompression.
+ *
+ * Decompresses the data in @p encoded_buffer into @p decoded_buffer, and sets
+ * @p *decoded_size to the decompressed length.
+ *
+ * @param encoded_size size of @p encoded_buffer
+ * @param encoded_buffer compressed data buffer with at least @p encoded_size
+ *        addressable bytes
+ * @param[in, out] decoded_size @b in: size of @p decoded_buffer; \n
+ *                 @b out: length of decompressed data written to
+ *                 @p decoded_buffer
+ * @param decoded_buffer decompressed data destination buffer
+ * @returns ::BROTLI_DECODER_RESULT_ERROR if input is corrupted, memory
+ *          allocation failed, or @p decoded_buffer is not large enough;
+ * @returns ::BROTLI_DECODER_RESULT_SUCCESS otherwise
+ */
+BROTLI_DEC_API BrotliDecoderResult BrotliDecoderDecompress(
+    size_t encoded_size,
+    const uint8_t encoded_buffer[BROTLI_ARRAY_PARAM(encoded_size)],
+    size_t* decoded_size,
+    uint8_t decoded_buffer[BROTLI_ARRAY_PARAM(*decoded_size)]);
+
+/**
+ * Decompresses the input stream to the output stream.
+ *
+ * The values @p *available_in and @p *available_out must specify the number of
+ * bytes addressable at @p *next_in and @p *next_out respectively.
+ * When @p *available_out is @c 0, @p next_out is allowed to be @c NULL.
+ *
+ * After each call, @p *available_in will be decremented by the amount of input
+ * bytes consumed, and the @p *next_in pointer will be incremented by that
+ * amount. Similarly, @p *available_out will be decremented by the amount of
+ * output bytes written, and the @p *next_out pointer will be incremented by
+ * that amount.
+ *
+ * @p total_out, if it is not a null-pointer, will be set to the number
+ * of bytes decompressed since the last @p state initialization.
+ *
+ * @note Input is never overconsumed, so @p next_in and @p available_in could be
+ * passed to the next consumer after decoding is complete.
+ *
+ * @param state decoder instance
+ * @param[in, out] available_in @b in: amount of available input; \n
+ *                 @b out: amount of unused input
+ * @param[in, out] next_in pointer to the next compressed byte
+ * @param[in, out] available_out @b in: length of output buffer; \n
+ *                 @b out: remaining size of output buffer
+ * @param[in, out] next_out output buffer cursor;
+ *                 can be @c NULL if @p available_out is @c 0
+ * @param[out] total_out number of bytes decompressed so far; can be @c NULL
+ * @returns ::BROTLI_DECODER_RESULT_ERROR if input is corrupted, memory
+ *          allocation failed, arguments were invalid, etc.;
+ *          use ::BrotliDecoderGetErrorCode to get detailed error code
+ * @returns ::BROTLI_DECODER_RESULT_NEEDS_MORE_INPUT decoding is blocked until
+ *          more input data is provided
+ * @returns ::BROTLI_DECODER_RESULT_NEEDS_MORE_OUTPUT decoding is blocked until
+ *          more output space is provided
+ * @returns ::BROTLI_DECODER_RESULT_SUCCESS decoding is finished, no more
+ *          input might be consumed and no more output will be produced
+ */
+BROTLI_DEC_API BrotliDecoderResult BrotliDecoderDecompressStream(
+  BrotliDecoderState* state, size_t* available_in, const uint8_t** next_in,
+  size_t* available_out, uint8_t** next_out, size_t* total_out);
+
+/**
+ * Checks if decoder has more output.
+ *
+ * @param state decoder instance
+ * @returns ::BROTLI_TRUE, if decoder has some unconsumed output
+ * @returns ::BROTLI_FALSE otherwise
+ */
+BROTLI_DEC_API BROTLI_BOOL BrotliDecoderHasMoreOutput(
+    const BrotliDecoderState* state);
+
+/**
+ * Acquires pointer to internal output buffer.
+ *
+ * This method is used to make language bindings easier and more efficient:
+ *  -# push data to ::BrotliDecoderDecompressStream,
+ *     until ::BROTLI_DECODER_RESULT_NEEDS_MORE_OUTPUT is reported
+ *  -# use ::BrotliDecoderTakeOutput to peek bytes and copy to language-specific
+ *     entity
+ *
+ * Also this could be useful if there is an output stream that is able to
+ * consume all the provided data (e.g. when data is saved to file system).
+ *
+ * @attention After every call to ::BrotliDecoderTakeOutput @p *size bytes of
+ *            output are considered consumed for all consecutive calls to the
+ *            instance methods; returned pointer becomes invalidated as well.
+ *
+ * @note Decoder output is not guaranteed to be contiguous. This means that
+ *       after the size-unrestricted call to ::BrotliDecoderTakeOutput,
+ *       immediate next call to ::BrotliDecoderTakeOutput may return more data.
+ *
+ * @param state decoder instance
+ * @param[in, out] size @b in: number of bytes caller is ready to take, @c 0 if
+ *                 any amount could be handled; \n
+ *                 @b out: amount of data pointed by returned pointer and
+ *                 considered consumed; \n
+ *                 out value is never greater than in value, unless it is @c 0
+ * @returns pointer to output data
+ */
+BROTLI_DEC_API const uint8_t* BrotliDecoderTakeOutput(
+    BrotliDecoderState* state, size_t* size);
+
+/**
+ * Checks if instance has already consumed input.
+ *
+ * Instance that returns ::BROTLI_FALSE is considered "fresh" and could be
+ * reused.
+ *
+ * @param state decoder instance
+ * @returns ::BROTLI_TRUE if decoder has already used some input bytes
+ * @returns ::BROTLI_FALSE otherwise
+ */
+BROTLI_DEC_API BROTLI_BOOL BrotliDecoderIsUsed(const BrotliDecoderState* state);
+
+/**
+ * Checks if decoder instance reached the final state.
+ *
+ * @param state decoder instance
+ * @returns ::BROTLI_TRUE if decoder is in a state where it reached the end of
+ *          the input and produced all of the output
+ * @returns ::BROTLI_FALSE otherwise
+ */
+BROTLI_DEC_API BROTLI_BOOL BrotliDecoderIsFinished(
+    const BrotliDecoderState* state);
+
+/**
+ * Acquires a detailed error code.
+ *
+ * Should be used only after ::BrotliDecoderDecompressStream returns
+ * ::BROTLI_DECODER_RESULT_ERROR.
+ *
+ * See also ::BrotliDecoderErrorString
+ *
+ * @param state decoder instance
+ * @returns last saved error code
+ */
+BROTLI_DEC_API BrotliDecoderErrorCode BrotliDecoderGetErrorCode(
+    const BrotliDecoderState* state);
+
+/**
+ * Converts error code to a c-string.
+ */
+BROTLI_DEC_API const char* BrotliDecoderErrorString(BrotliDecoderErrorCode c);
+
+/**
+ * Gets a decoder library version.
+ *
+ * Look at BROTLI_VERSION for more information.
+ */
+BROTLI_DEC_API uint32_t BrotliDecoderVersion(void);
+
+#if defined(__cplusplus) || defined(c_plusplus)
+} /* extern "C" */
+#endif
+
+#endif  /* BROTLI_DEC_DECODE_H_ */
diff --git a/Source/ThirdParty/brotli/include/brotli/encode.h b/Source/ThirdParty/brotli/include/brotli/encode.h
new file mode 100755
index 000000000..e4cf18b72
--- /dev/null
+++ b/Source/ThirdParty/brotli/include/brotli/encode.h
@@ -0,0 +1,402 @@
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+   Distributed under MIT license.
+   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/**
+ * @file
+ * API for Brotli compression.
+ */
+
+#ifndef BROTLI_ENC_ENCODE_H_
+#define BROTLI_ENC_ENCODE_H_
+
+#include <brotli/port.h>
+#include <brotli/types.h>
+
+#if defined(__cplusplus) || defined(c_plusplus)
+extern "C" {
+#endif
+
+/** Minimal value for ::BROTLI_PARAM_LGWIN parameter. */
+#define BROTLI_MIN_WINDOW_BITS 10
+/**
+ * Maximal value for ::BROTLI_PARAM_LGWIN parameter.
+ *
+ * @note equal to @c BROTLI_MAX_DISTANCE_BITS constant.
+ */
+#define BROTLI_MAX_WINDOW_BITS 24
+/** Minimal value for ::BROTLI_PARAM_LGBLOCK parameter. */
+#define BROTLI_MIN_INPUT_BLOCK_BITS 16
+/** Maximal value for ::BROTLI_PARAM_LGBLOCK parameter. */
+#define BROTLI_MAX_INPUT_BLOCK_BITS 24
+/** Minimal value for ::BROTLI_PARAM_QUALITY parameter. */
+#define BROTLI_MIN_QUALITY 0
+/** Maximal value for ::BROTLI_PARAM_QUALITY parameter. */
+#define BROTLI_MAX_QUALITY 11
+
+/** Options for ::BROTLI_PARAM_MODE parameter. */
+typedef enum BrotliEncoderMode {
+  /**
+   * Default compression mode.
+   *
+   * In this mode compressor does not know anything in advance about the
+   * properties of the input.
+   */
+  BROTLI_MODE_GENERIC = 0,
+  /** Compression mode for UTF-8 formatted text input. */
+  BROTLI_MODE_TEXT = 1,
+  /** Compression mode used in WOFF 2.0. */
+  BROTLI_MODE_FONT = 2
+} BrotliEncoderMode;
+
+/** Default value for ::BROTLI_PARAM_QUALITY parameter. */
+#define BROTLI_DEFAULT_QUALITY 11
+/** Default value for ::BROTLI_PARAM_LGWIN parameter. */
+#define BROTLI_DEFAULT_WINDOW 22
+/** Default value for ::BROTLI_PARAM_MODE parameter. */
+#define BROTLI_DEFAULT_MODE BROTLI_MODE_GENERIC
+
+/** Operations that can be performed by streaming encoder. */
+typedef enum BrotliEncoderOperation {
+  /**
+   * Process input.
+   *
+   * Encoder may postpone producing output, until it has processed enough input.
+   */
+  BROTLI_OPERATION_PROCESS = 0,
+  /**
+   * Produce output for all processed input.
+   *
+   * Actual flush is performed when input stream is depleted and there is enough
+   * space in output stream. This means that client should repeat
+   * ::BROTLI_OPERATION_FLUSH operation until @p available_in becomes @c 0, and
+   * ::BrotliEncoderHasMoreOutput returns ::BROTLI_FALSE. If output is acquired
+   * via ::BrotliEncoderTakeOutput, then operation should be repeated after
+   * output buffer is drained.
+   *
+   * @warning Until flush is complete, client @b SHOULD @b NOT swap,
+   *          reduce or extend input stream.
+   *
+   * When flush is complete, output data will be sufficient for decoder to
+   * reproduce all the given input.
+   */
+  BROTLI_OPERATION_FLUSH = 1,
+  /**
+   * Finalize the stream.
+   *
+   * Actual finalization is performed when input stream is depleted and there is
+   * enough space in output stream. This means that client should repeat
+   * ::BROTLI_OPERATION_FINISH operation until @p available_in becomes @c 0, and
+   * ::BrotliEncoderHasMoreOutput returns ::BROTLI_FALSE. If output is acquired
+   * via ::BrotliEncoderTakeOutput, then operation should be repeated after
+   * output buffer is drained.
+   *
+   * @warning Until finalization is complete, client @b SHOULD @b NOT swap,
+   *          reduce or extend input stream.
+   *
+   * Helper function ::BrotliEncoderIsFinished checks if stream is finalized and
+   * output fully dumped.
+   *
+   * Adding more input data to finalized stream is impossible.
+   */
+  BROTLI_OPERATION_FINISH = 2,
+  /**
+   * Emit metadata block to stream.
+   *
+   * Metadata is opaque to Brotli: neither encoder, nor decoder processes this
+   * data or relies on it. It may be used to pass some extra information from
+   * encoder client to decoder client without interfering with main data stream.
+   *
+   * @note Encoder may emit empty metadata blocks internally, to pad encoded
+   *       stream to byte boundary.
+   *
+   * @warning Until emitting metadata is complete client @b SHOULD @b NOT swap,
+   *          reduce or extend input stream.
+   *
+   * @warning The whole content of input buffer is considered to be the content
+   *          of metadata block. Do @b NOT @e append metadata to input stream,
+   *          before it is depleted with other operations.
+   *
+   * Stream is soft-flushed before metadata block is emitted. Metadata block
+   * @b MUST be no longer than than 16MiB.
+   */
+  BROTLI_OPERATION_EMIT_METADATA = 3
+} BrotliEncoderOperation;
+
+/** Options to be used with ::BrotliEncoderSetParameter. */
+typedef enum BrotliEncoderParameter {
+  /**
+   * Tune encoder for specific input.
+   *
+   * ::BrotliEncoderMode enumerates all available values.
+   */
+  BROTLI_PARAM_MODE = 0,
+  /**
+   * The main compression speed-density lever.
+   *
+   * The higher the quality, the slower the compression. Range is
+   * from ::BROTLI_MIN_QUALITY to ::BROTLI_MAX_QUALITY.
+   */
+  BROTLI_PARAM_QUALITY = 1,
+  /**
+   * Recommended sliding LZ77 window size.
+   *
+   * Encoder may reduce this value, e.g. if input is much smaller than
+   * window size.
+   *
+   * Window size is `(1 << value) - 16`.
+   *
+   * Range is from ::BROTLI_MIN_WINDOW_BITS to ::BROTLI_MAX_WINDOW_BITS.
+   */
+  BROTLI_PARAM_LGWIN = 2,
+  /**
+   * Recommended input block size.
+   *
+   * Encoder may reduce this value, e.g. if input is much smaller than input
+   * block size.
+   *
+   * Range is from ::BROTLI_MIN_INPUT_BLOCK_BITS to
+   * ::BROTLI_MAX_INPUT_BLOCK_BITS.
+   *
+   * @note Bigger input block size allows better compression, but consumes more
+   *       memory. \n The rough formula of memory used for temporary input
+   *       storage is `3 << lgBlock`.
+   */
+  BROTLI_PARAM_LGBLOCK = 3,
+  /**
+   * Flag that affects usage of "literal context modeling" format feature.
+   *
+   * This flag is a "decoding-speed vs compression ratio" trade-off.
+   */
+  BROTLI_PARAM_DISABLE_LITERAL_CONTEXT_MODELING = 4,
+  /**
+   * Estimated total input size for all ::BrotliEncoderCompressStream calls.
+   *
+   * The default value is 0, which means that the total input size is unknown.
+   */
+  BROTLI_PARAM_SIZE_HINT = 5
+} BrotliEncoderParameter;
+
+/**
+ * Opaque structure that holds encoder state.
+ *
+ * Allocated and initialized with ::BrotliEncoderCreateInstance.
+ * Cleaned up and deallocated with ::BrotliEncoderDestroyInstance.
+ */
+typedef struct BrotliEncoderStateStruct BrotliEncoderState;
+
+/**
+ * Sets the specified parameter to the given encoder instance.
+ *
+ * @param state encoder instance
+ * @param param parameter to set
+ * @param value new parameter value
+ * @returns ::BROTLI_FALSE if parameter is unrecognized, or value is invalid
+ * @returns ::BROTLI_FALSE if value of parameter can not be changed at current
+ *          encoder state (e.g. when encoding is started, window size might be
+ *          already encoded and therefore it is impossible to change it)
+ * @returns ::BROTLI_TRUE if value is accepted
+ * @warning invalid values might be accepted in case they would not break
+ *          encoding process.
+ */
+BROTLI_ENC_API BROTLI_BOOL BrotliEncoderSetParameter(
+    BrotliEncoderState* state, BrotliEncoderParameter param, uint32_t value);
+
+/**
+ * Creates an instance of ::BrotliEncoderState and initializes it.
+ *
+ * @p alloc_func and @p free_func @b MUST be both zero or both non-zero. In the
+ * case they are both zero, default memory allocators are used. @p opaque is
+ * passed to @p alloc_func and @p free_func when they are called.
+ *
+ * @param alloc_func custom memory allocation function
+ * @param free_func custom memory fee function
+ * @param opaque custom memory manager handle
+ * @returns @c 0 if instance can not be allocated or initialized
+ * @returns pointer to initialized ::BrotliEncoderState otherwise
+ */
+BROTLI_ENC_API BrotliEncoderState* BrotliEncoderCreateInstance(
+    brotli_alloc_func alloc_func, brotli_free_func free_func, void* opaque);
+
+/**
+ * Deinitializes and frees ::BrotliEncoderState instance.
+ *
+ * @param state decoder instance to be cleaned up and deallocated
+ */
+BROTLI_ENC_API void BrotliEncoderDestroyInstance(BrotliEncoderState* state);
+
+/**
+ * Calculates the output size bound for the given @p input_size.
+ *
+ * @warning Result is not applicable to ::BrotliEncoderCompressStream output,
+ *          because every "flush" adds extra overhead bytes, and some encoder
+ *          settings (e.g. quality @c 0 and @c 1) might imply a "soft flush"
+ *          after every chunk of input.
+ *
+ * @param input_size size of projected input
+ * @returns @c 0 if result does not fit @c size_t
+ */
+BROTLI_ENC_API size_t BrotliEncoderMaxCompressedSize(size_t input_size);
+
+/**
+ * Performs one-shot memory-to-memory compression.
+ *
+ * Compresses the data in @p input_buffer into @p encoded_buffer, and sets
+ * @p *encoded_size to the compressed length.
+ *
+ * @note If ::BrotliEncoderMaxCompressedSize(@p input_size) returns non-zero
+ *       value, then output is guaranteed to be no longer than that.
+ *
+ * @param quality quality parameter value, e.g. ::BROTLI_DEFAULT_QUALITY
+ * @param lgwin lgwin parameter value, e.g. ::BROTLI_DEFAULT_WINDOW
+ * @param mode mode parameter value, e.g. ::BROTLI_DEFAULT_MODE
+ * @param input_size size of @p input_buffer
+ * @param input_buffer input data buffer with at least @p input_size
+ *        addressable bytes
+ * @param[in, out] encoded_size @b in: size of @p encoded_buffer; \n
+ *                 @b out: length of compressed data written to
+ *                 @p encoded_buffer, or @c 0 if compression fails
+ * @param encoded_buffer compressed data destination buffer
+ * @returns ::BROTLI_FALSE in case of compression error
+ * @returns ::BROTLI_FALSE if output buffer is too small
+ * @returns ::BROTLI_TRUE otherwise
+ */
+BROTLI_ENC_API BROTLI_BOOL BrotliEncoderCompress(
+    int quality, int lgwin, BrotliEncoderMode mode, size_t input_size,
+    const uint8_t input_buffer[BROTLI_ARRAY_PARAM(input_size)],
+    size_t* encoded_size,
+    uint8_t encoded_buffer[BROTLI_ARRAY_PARAM(*encoded_size)]);
+
+/**
+ * Compresses input stream to output stream.
+ *
+ * The values @p *available_in and @p *available_out must specify the number of
+ * bytes addressable at @p *next_in and @p *next_out respectively.
+ * When @p *available_out is @c 0, @p next_out is allowed to be @c NULL.
+ *
+ * After each call, @p *available_in will be decremented by the amount of input
+ * bytes consumed, and the @p *next_in pointer will be incremented by that
+ * amount. Similarly, @p *available_out will be decremented by the amount of
+ * output bytes written, and the @p *next_out pointer will be incremented by
+ * that amount.
+ *
+ * @p total_out, if it is not a null-pointer, will be set to the number
+ * of bytes decompressed since the last @p state initialization.
+ *
+ *
+ *
+ * Internally workflow consists of 3 tasks:
+ *  -# (optionally) copy input data to internal buffer
+ *  -# actually compress data and (optionally) store it to internal buffer
+ *  -# (optionally) copy compressed bytes from internal buffer to output stream
+ *
+ * Whenever all 3 tasks can't move forward anymore, or error occurs, this
+ * method returns the control flow to caller.
+ *
+ * @p op is used to perform flush, finish the stream, or inject metadata block.
+ * See ::BrotliEncoderOperation for more information.
+ *
+ * Flushing the stream means forcing encoding of all input passed to encoder and
+ * completing the current output block, so it could be fully decoded by stream
+ * decoder. To perform flush set @p op to ::BROTLI_OPERATION_FLUSH.
+ * Under some circumstances (e.g. lack of output stream capacity) this operation
+ * would require several calls to ::BrotliEncoderCompressStream. The method must
+ * be called again until both input stream is depleted and encoder has no more
+ * output (see ::BrotliEncoderHasMoreOutput) after the method is called.
+ *
+ * Finishing the stream means encoding of all input passed to encoder and
+ * adding specific "final" marks, so stream decoder could determine that stream
+ * is complete. To perform finish set @p op to ::BROTLI_OPERATION_FINISH.
+ * Under some circumstances (e.g. lack of output stream capacity) this operation
+ * would require several calls to ::BrotliEncoderCompressStream. The method must
+ * be called again until both input stream is depleted and encoder has no more
+ * output (see ::BrotliEncoderHasMoreOutput) after the method is called.
+ *
+ * @warning When flushing and finishing, @p op should not change until operation
+ *          is complete; input stream should not be swapped, reduced or
+ *          extended as well.
+ *
+ * @param state encoder instance
+ * @param op requested operation
+ * @param[in, out] available_in @b in: amount of available input; \n
+ *                 @b out: amount of unused input
+ * @param[in, out] next_in pointer to the next input byte
+ * @param[in, out] available_out @b in: length of output buffer; \n
+ *                 @b out: remaining size of output buffer
+ * @param[in, out] next_out compressed output buffer cursor;
+ *                 can be @c NULL if @p available_out is @c 0
+ * @param[out] total_out number of bytes produced so far; can be @c NULL
+ * @returns ::BROTLI_FALSE if there was an error
+ * @returns ::BROTLI_TRUE otherwise
+ */
+BROTLI_ENC_API BROTLI_BOOL BrotliEncoderCompressStream(
+    BrotliEncoderState* state, BrotliEncoderOperation op, size_t* available_in,
+    const uint8_t** next_in, size_t* available_out, uint8_t** next_out,
+    size_t* total_out);
+
+/**
+ * Checks if encoder instance reached the final state.
+ *
+ * @param state encoder instance
+ * @returns ::BROTLI_TRUE if encoder is in a state where it reached the end of
+ *          the input and produced all of the output
+ * @returns ::BROTLI_FALSE otherwise
+ */
+BROTLI_ENC_API BROTLI_BOOL BrotliEncoderIsFinished(BrotliEncoderState* state);
+
+/**
+ * Checks if encoder has more output.
+ *
+ * @param state encoder instance
+ * @returns ::BROTLI_TRUE, if encoder has some unconsumed output
+ * @returns ::BROTLI_FALSE otherwise
+ */
+BROTLI_ENC_API BROTLI_BOOL BrotliEncoderHasMoreOutput(
+    BrotliEncoderState* state);
+
+/**
+ * Acquires pointer to internal output buffer.
+ *
+ * This method is used to make language bindings easier and more efficient:
+ *  -# push data to ::BrotliEncoderCompressStream,
+ *     until ::BrotliEncoderHasMoreOutput returns BROTL_TRUE
+ *  -# use ::BrotliEncoderTakeOutput to peek bytes and copy to language-specific
+ *     entity
+ *
+ * Also this could be useful if there is an output stream that is able to
+ * consume all the provided data (e.g. when data is saved to file system).
+ *
+ * @attention After every call to ::BrotliEncoderTakeOutput @p *size bytes of
+ *            output are considered consumed for all consecutive calls to the
+ *            instance methods; returned pointer becomes invalidated as well.
+ *
+ * @note Encoder output is not guaranteed to be contiguous. This means that
+ *       after the size-unrestricted call to ::BrotliEncoderTakeOutput,
+ *       immediate next call to ::BrotliEncoderTakeOutput may return more data.
+ *
+ * @param state encoder instance
+ * @param[in, out] size @b in: number of bytes caller is ready to take, @c 0 if
+ *                 any amount could be handled; \n
+ *                 @b out: amount of data pointed by returned pointer and
+ *                 considered consumed; \n
+ *                 out value is never greater than in value, unless it is @c 0
+ * @returns pointer to output data
+ */
+BROTLI_ENC_API const uint8_t* BrotliEncoderTakeOutput(
+    BrotliEncoderState* state, size_t* size);
+
+
+/**
+ * Gets an encoder library version.
+ *
+ * Look at BROTLI_VERSION for more information.
+ */
+BROTLI_ENC_API uint32_t BrotliEncoderVersion(void);
+
+#if defined(__cplusplus) || defined(c_plusplus)
+}  /* extern "C" */
+#endif
+
+#endif  /* BROTLI_ENC_ENCODE_H_ */
diff --git a/Source/ThirdParty/brotli/include/brotli/port.h b/Source/ThirdParty/brotli/include/brotli/port.h
new file mode 100755
index 000000000..16c31d426
--- /dev/null
+++ b/Source/ThirdParty/brotli/include/brotli/port.h
@@ -0,0 +1,146 @@
+/* Copyright 2016 Google Inc. All Rights Reserved.
+
+   Distributed under MIT license.
+   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/* Macros for compiler / platform specific features and build options. */
+
+#ifndef BROTLI_COMMON_PORT_H_
+#define BROTLI_COMMON_PORT_H_
+
+/* Compatibility with non-clang compilers. */
+#ifndef __has_builtin
+#define __has_builtin(x) 0
+#endif
+
+#ifndef __has_attribute
+#define __has_attribute(x) 0
+#endif
+
+#ifndef __has_feature
+#define __has_feature(x) 0
+#endif
+
+#if defined(__GNUC__) && defined(__GNUC_MINOR__)
+#define BROTLI_GCC_VERSION (__GNUC__ * 100 + __GNUC_MINOR__)
+#else
+#define BROTLI_GCC_VERSION 0
+#endif
+
+#if defined(__ICC)
+#define BROTLI_ICC_VERSION __ICC
+#else
+#define BROTLI_ICC_VERSION 0
+#endif
+
+#if defined(BROTLI_BUILD_MODERN_COMPILER)
+#define BROTLI_MODERN_COMPILER 1
+#elif BROTLI_GCC_VERSION >= 304 || BROTLI_ICC_VERSION >= 1600
+#define BROTLI_MODERN_COMPILER 1
+#else
+#define BROTLI_MODERN_COMPILER 0
+#endif
+
+/* Define "BROTLI_PREDICT_TRUE" and "BROTLI_PREDICT_FALSE" macros for capable
+   compilers.
+
+To apply compiler hint, enclose the branching condition into macros, like this:
+
+  if (BROTLI_PREDICT_TRUE(zero == 0)) {
+    // main execution path
+  } else {
+    // compiler should place this code outside of main execution path
+  }
+
+OR:
+
+  if (BROTLI_PREDICT_FALSE(something_rare_or_unexpected_happens)) {
+    // compiler should place this code outside of main execution path
+  }
+
+*/
+#if BROTLI_MODERN_COMPILER || __has_builtin(__builtin_expect)
+#define BROTLI_PREDICT_TRUE(x) (__builtin_expect(!!(x), 1))
+#define BROTLI_PREDICT_FALSE(x) (__builtin_expect(x, 0))
+#else
+#define BROTLI_PREDICT_FALSE(x) (x)
+#define BROTLI_PREDICT_TRUE(x) (x)
+#endif
+
+#if BROTLI_MODERN_COMPILER || __has_attribute(always_inline)
+#define BROTLI_ATTRIBUTE_ALWAYS_INLINE __attribute__ ((always_inline))
+#else
+#define BROTLI_ATTRIBUTE_ALWAYS_INLINE
+#endif
+
+#if defined(_WIN32) || defined(__CYGWIN__)
+#define BROTLI_ATTRIBUTE_VISIBILITY_HIDDEN
+#elif BROTLI_MODERN_COMPILER || __has_attribute(visibility)
+#define BROTLI_ATTRIBUTE_VISIBILITY_HIDDEN \
+    __attribute__ ((visibility ("hidden")))
+#else
+#define BROTLI_ATTRIBUTE_VISIBILITY_HIDDEN
+#endif
+
+#ifndef BROTLI_INTERNAL
+#define BROTLI_INTERNAL BROTLI_ATTRIBUTE_VISIBILITY_HIDDEN
+#endif
+
+#if defined(BROTLI_SHARED_COMPILATION) && defined(_WIN32)
+#if defined(BROTLICOMMON_SHARED_COMPILATION)
+#define BROTLI_COMMON_API __declspec(dllexport)
+#else
+#define BROTLI_COMMON_API __declspec(dllimport)
+#endif  /* BROTLICOMMON_SHARED_COMPILATION */
+#if defined(BROTLIDEC_SHARED_COMPILATION)
+#define BROTLI_DEC_API __declspec(dllexport)
+#else
+#define BROTLI_DEC_API __declspec(dllimport)
+#endif  /* BROTLIDEC_SHARED_COMPILATION */
+#if defined(BROTLIENC_SHARED_COMPILATION)
+#define BROTLI_ENC_API __declspec(dllexport)
+#else
+#define BROTLI_ENC_API __declspec(dllimport)
+#endif  /* BROTLIENC_SHARED_COMPILATION */
+#else  /* BROTLI_SHARED_COMPILATION && _WIN32 */
+#define BROTLI_COMMON_API
+#define BROTLI_DEC_API
+#define BROTLI_ENC_API
+#endif
+
+#ifndef _MSC_VER
+#if defined(__cplusplus) || !defined(__STRICT_ANSI__) || \
+    (defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L)
+#define BROTLI_INLINE inline BROTLI_ATTRIBUTE_ALWAYS_INLINE
+#else
+#define BROTLI_INLINE
+#endif
+#else  /* _MSC_VER */
+#define BROTLI_INLINE __forceinline
+#endif  /* _MSC_VER */
+
+#if !defined(__cplusplus) && !defined(c_plusplus) && \
+    (defined(__STDC_VERSION__) && __STDC_VERSION__ >= 199901L)
+#define BROTLI_RESTRICT restrict
+#elif BROTLI_GCC_VERSION > 295 || defined(__llvm__)
+#define BROTLI_RESTRICT __restrict
+#else
+#define BROTLI_RESTRICT
+#endif
+
+#if BROTLI_MODERN_COMPILER || __has_attribute(noinline)
+#define BROTLI_NOINLINE __attribute__((noinline))
+#else
+#define BROTLI_NOINLINE
+#endif
+
+#if BROTLI_MODERN_COMPILER || __has_attribute(deprecated)
+#define BROTLI_DEPRECATED __attribute__((deprecated))
+#else
+#define BROTLI_DEPRECATED
+#endif
+
+#define BROTLI_UNUSED(X) (void)(X)
+
+#endif  /* BROTLI_COMMON_PORT_H_ */
diff --git a/Source/ThirdParty/brotli/include/brotli/types.h b/Source/ThirdParty/brotli/include/brotli/types.h
new file mode 100755
index 000000000..fcb271028
--- /dev/null
+++ b/Source/ThirdParty/brotli/include/brotli/types.h
@@ -0,0 +1,90 @@
+/* Copyright 2013 Google Inc. All Rights Reserved.
+
+   Distributed under MIT license.
+   See file LICENSE for detail or copy at https://opensource.org/licenses/MIT
+*/
+
+/**
+ * @file
+ * Common types used in decoder and encoder API.
+ */
+
+#ifndef BROTLI_COMMON_TYPES_H_
+#define BROTLI_COMMON_TYPES_H_
+
+#include <stddef.h>  /* for size_t */
+
+#if defined(_MSC_VER) && (_MSC_VER < 1600)
+typedef __int8 int8_t;
+typedef unsigned __int8 uint8_t;
+typedef __int16 int16_t;
+typedef unsigned __int16 uint16_t;
+typedef __int32 int32_t;
+typedef unsigned __int32 uint32_t;
+typedef unsigned __int64 uint64_t;
+typedef __int64 int64_t;
+#else
+#include <stdint.h>
+#endif  /* defined(_MSC_VER) && (_MSC_VER < 1600) */
+
+/**
+ * A portable @c bool replacement.
+ *
+ * ::BROTLI_BOOL is a "documentation" type: actually it is @c int, but in API it
+ * denotes a type, whose only values are ::BROTLI_TRUE and ::BROTLI_FALSE.
+ *
+ * ::BROTLI_BOOL values passed to Brotli should either be ::BROTLI_TRUE or
+ * ::BROTLI_FALSE, or be a result of ::TO_BROTLI_BOOL macros.
+ *
+ * ::BROTLI_BOOL values returned by Brotli should not be tested for equality
+ * with @c true, @c false, ::BROTLI_TRUE, ::BROTLI_FALSE, but rather should be
+ * evaluated, for example: @code{.cpp}
+ * if (SomeBrotliFunction(encoder, BROTLI_TRUE) &&
+ *     !OtherBrotliFunction(decoder, BROTLI_FALSE)) {
+ *   bool x = !!YetAnotherBrotliFunction(encoder, TO_BROLTI_BOOL(2 * 2 == 4));
+ *   DoSomething(x);
+ * }
+ * @endcode
+ */
+#define BROTLI_BOOL int
+/** Portable @c true replacement. */
+#define BROTLI_TRUE 1
+/** Portable @c false replacement. */
+#define BROTLI_FALSE 0
+/** @c bool to ::BROTLI_BOOL conversion macros. */
+#define TO_BROTLI_BOOL(X) (!!(X) ? BROTLI_TRUE : BROTLI_FALSE)
+
+#define BROTLI_MAKE_UINT64_T(high, low) ((((uint64_t)(high)) << 32) | low)
+
+#define BROTLI_UINT32_MAX (~((uint32_t)0))
+#define BROTLI_SIZE_MAX (~((size_t)0))
+
+/**
+ * Allocating function pointer type.
+ *
+ * @param opaque custom memory manager handle provided by client
+ * @param size requested memory region size; can not be @c 0
+ * @returns @c 0 in the case of failure
+ * @returns a valid pointer to a memory region of at least @p size bytes
+ *          long otherwise
+ */
+typedef void* (*brotli_alloc_func)(void* opaque, size_t size);
+
+/**
+ * Deallocating function pointer type.
+ *
+ * This function @b SHOULD do nothing if @p address is @c 0.
+ *
+ * @param opaque custom memory manager handle provided by client
+ * @param address memory region pointer returned by ::brotli_alloc_func, or @c 0
+ */
+typedef void (*brotli_free_func)(void* opaque, void* address);
+
+#if defined(__STDC_VERSION__) && (__STDC_VERSION__ >= 199901L) && \
+    !defined(__cplusplus) && !defined(__PGI)
+#define BROTLI_ARRAY_PARAM(L) L
+#else
+#define BROTLI_ARRAY_PARAM(L)
+#endif
+
+#endif  /* BROTLI_COMMON_TYPES_H_ */
diff --git a/Source/ThirdParty/brotli/update.sh b/Source/ThirdParty/brotli/update.sh
index 752a47884..5b6aeebb6 100755
--- a/Source/ThirdParty/brotli/update.sh
+++ b/Source/ThirdParty/brotli/update.sh
@@ -10,8 +10,10 @@ git clone https://github.com/google/brotli ${MY_TEMP_DIR}/brotli
 COMMIT=`(cd ${MY_TEMP_DIR}/brotli && git log | head -n 1)`
 perl -p -i -e "s/\[commit [0-9a-f]{40}\]/[${COMMIT}]/" README.webkit;
 
-rm -rf dec
-mv ${MY_TEMP_DIR}/brotli/dec dec
+rm -rf dec common include/brotli
+mv ${MY_TEMP_DIR}/brotli/c/dec dec
+mv ${MY_TEMP_DIR}/brotli/c/common common
+mv ${MY_TEMP_DIR}/brotli/c/include/brotli include/brotli
 rm -rf ${MY_TEMP_DIR}
 
 echo "###"