diff options
Diffstat (limited to 'src')
474 files changed, 8194 insertions, 8343 deletions
diff --git a/src/3rdparty/sqlite.pri b/src/3rdparty/sqlite.pri index 068764c726..6405beb3d0 100644 --- a/src/3rdparty/sqlite.pri +++ b/src/3rdparty/sqlite.pri @@ -1,5 +1,6 @@ CONFIG(release, debug|release):DEFINES *= NDEBUG -DEFINES += SQLITE_ENABLE_COLUMN_METADATA SQLITE_OMIT_LOAD_EXTENSION SQLITE_OMIT_COMPLETE SQLITE_ENABLE_FTS3 SQLITE_ENABLE_FTS3_PARENTHESIS SQLITE_ENABLE_FTS5 SQLITE_ENABLE_RTREE SQLITE_ENABLE_JSON1 +QT_FOR_CONFIG += core-private +DEFINES += SQLITE_ENABLE_COLUMN_METADATA SQLITE_OMIT_COMPLETE SQLITE_ENABLE_FTS3 SQLITE_ENABLE_FTS3_PARENTHESIS SQLITE_ENABLE_FTS5 SQLITE_ENABLE_RTREE SQLITE_ENABLE_JSON1 !contains(CONFIG, largefile):DEFINES += SQLITE_DISABLE_LFS qtConfig(posix_fallocate): DEFINES += HAVE_POSIX_FALLOCATE=1 winrt { @@ -8,6 +9,7 @@ winrt { } qnx: DEFINES += _QNX_SOURCE !win32:!winrt:!winphone: DEFINES += HAVE_USLEEP=1 +qtConfig(dlopen): QMAKE_USE += libdl integrity: QMAKE_CFLAGS += -include qplatformdefs.h INCLUDEPATH += $$PWD/sqlite SOURCES += $$PWD/sqlite/sqlite3.c diff --git a/src/concurrent/qtconcurrentcompilertest.h b/src/concurrent/qtconcurrentcompilertest.h index cddfd06ca1..72cf1670a0 100644 --- a/src/concurrent/qtconcurrentcompilertest.h +++ b/src/concurrent/qtconcurrentcompilertest.h @@ -52,7 +52,7 @@ template<class T> class HasResultType { typedef char Yes; typedef void *No; - template<typename U> static Yes test(int, const typename U::result_type * = 0); + template<typename U> static Yes test(int, const typename U::result_type * = nullptr); template<typename U> static No test(double); public: enum { Value = (sizeof(test<T>(0)) == sizeof(Yes)) }; diff --git a/src/concurrent/qtconcurrentfilterkernel.h b/src/concurrent/qtconcurrentfilterkernel.h index 9cbea2e671..e921a3d51a 100644 --- a/src/concurrent/qtconcurrentfilterkernel.h +++ b/src/concurrent/qtconcurrentfilterkernel.h @@ -266,7 +266,7 @@ public: if (keep(*it)) this->reportResult(&(*it), index); else - this->reportResult(0, index); + this->reportResult(nullptr, index); return false; } diff --git a/src/concurrent/qtconcurrentmapkernel.h b/src/concurrent/qtconcurrentmapkernel.h index 3424124118..87fcf30cf9 100644 --- a/src/concurrent/qtconcurrentmapkernel.h +++ b/src/concurrent/qtconcurrentmapkernel.h @@ -74,7 +74,7 @@ public: Iterator it = sequenceBeginIterator; std::advance(it, beginIndex); for (int i = beginIndex; i < endIndex; ++i) { - runIteration(it, i, 0); + runIteration(it, i, nullptr); std::advance(it, 1); } diff --git a/src/corelib/animation/qabstractanimation.cpp b/src/corelib/animation/qabstractanimation.cpp index 9d7a256191..e37f9a0271 100644 --- a/src/corelib/animation/qabstractanimation.cpp +++ b/src/corelib/animation/qabstractanimation.cpp @@ -152,6 +152,7 @@ #include <QtCore/qthreadstorage.h> #include <QtCore/qcoreevent.h> #include <QtCore/qpointer.h> +#include <QtCore/qscopedvaluerollback.h> #define DEFAULT_TIMER_INTERVAL 16 #define PAUSE_TIMER_COARSE_THRESHOLD 2000 @@ -315,14 +316,13 @@ void QUnifiedTimer::updateAnimationTimers(qint64 currentTick) //* it might happen in some cases that the delta is negative because the animation driver // advances faster than time.elapsed() if (delta > 0) { - insideTick = true; + QScopedValueRollback<bool> guard(insideTick, true); if (profilerCallback) profilerCallback(delta); for (currentAnimationIdx = 0; currentAnimationIdx < animationTimers.count(); ++currentAnimationIdx) { QAbstractAnimationTimer *animation = animationTimers.at(currentAnimationIdx); animation->updateAnimationsTime(delta); } - insideTick = false; currentAnimationIdx = 0; } } @@ -361,10 +361,11 @@ void QUnifiedTimer::localRestart() void QUnifiedTimer::restart() { - insideRestart = true; - for (int i = 0; i < animationTimers.count(); ++i) - animationTimers.at(i)->restartAnimationTimer(); - insideRestart = false; + { + QScopedValueRollback<bool> guard(insideRestart, true); + for (int i = 0; i < animationTimers.count(); ++i) + animationTimers.at(i)->restartAnimationTimer(); + } localRestart(); } @@ -599,14 +600,13 @@ void QAnimationTimer::updateAnimationsTime(qint64 delta) //it might happen in some cases that the time doesn't change because events are delayed //when the CPU load is high if (delta) { - insideTick = true; + QScopedValueRollback<bool> guard(insideTick, true); for (currentAnimationIdx = 0; currentAnimationIdx < animations.count(); ++currentAnimationIdx) { QAbstractAnimation *animation = animations.at(currentAnimationIdx); int elapsed = QAbstractAnimationPrivate::get(animation)->totalCurrentTime + (animation->direction() == QAbstractAnimation::Forward ? delta : -delta); animation->setCurrentTime(elapsed); } - insideTick = false; currentAnimationIdx = 0; } } diff --git a/src/corelib/animation/qabstractanimation_p.h b/src/corelib/animation/qabstractanimation_p.h index 3b6e8d6cc4..037d3be74f 100644 --- a/src/corelib/animation/qabstractanimation_p.h +++ b/src/corelib/animation/qabstractanimation_p.h @@ -78,7 +78,7 @@ public: hasRegisteredTimer(false), isPause(false), isGroup(false), - group(0) + group(nullptr) { } diff --git a/src/corelib/animation/qanimationgroup_p.h b/src/corelib/animation/qanimationgroup_p.h index ff759d11fd..215734b656 100644 --- a/src/corelib/animation/qanimationgroup_p.h +++ b/src/corelib/animation/qanimationgroup_p.h @@ -76,7 +76,7 @@ public: void disconnectUncontrolledAnimation(QAbstractAnimation *anim) { //0 for the signal here because we might be called from the animation destructor - QObject::disconnect(anim, 0, q_func(), SLOT(_q_uncontrolledAnimationFinished())); + QObject::disconnect(anim, nullptr, q_func(), SLOT(_q_uncontrolledAnimationFinished())); } void connectUncontrolledAnimation(QAbstractAnimation *anim) diff --git a/src/corelib/animation/qpropertyanimation_p.h b/src/corelib/animation/qpropertyanimation_p.h index 479762f573..cbd3ce287d 100644 --- a/src/corelib/animation/qpropertyanimation_p.h +++ b/src/corelib/animation/qpropertyanimation_p.h @@ -64,7 +64,7 @@ class QPropertyAnimationPrivate : public QVariantAnimationPrivate Q_DECLARE_PUBLIC(QPropertyAnimation) public: QPropertyAnimationPrivate() - : targetValue(0), propertyType(0), propertyIndex(-1) + : targetValue(nullptr), propertyType(0), propertyIndex(-1) { } diff --git a/src/corelib/animation/qsequentialanimationgroup_p.h b/src/corelib/animation/qsequentialanimationgroup_p.h index 88dac4f566..c082d6b524 100644 --- a/src/corelib/animation/qsequentialanimationgroup_p.h +++ b/src/corelib/animation/qsequentialanimationgroup_p.h @@ -63,7 +63,7 @@ class QSequentialAnimationGroupPrivate : public QAnimationGroupPrivate Q_DECLARE_PUBLIC(QSequentialAnimationGroup) public: QSequentialAnimationGroupPrivate() - : currentAnimation(0), currentAnimationIndex(-1), lastLoop(0) + : currentAnimation(nullptr), currentAnimationIndex(-1), lastLoop(0) { } diff --git a/src/corelib/codecs/qtextcodec_p.h b/src/corelib/codecs/qtextcodec_p.h index 0e449d994c..7fcf6df984 100644 --- a/src/corelib/codecs/qtextcodec_p.h +++ b/src/corelib/codecs/qtextcodec_p.h @@ -98,7 +98,7 @@ public: struct ConverterState { ConverterState(ConversionFlags f = DefaultConversion) - : flags(f), remainingChars(0), invalidChars(0), d(0) { state_data[0] = state_data[1] = state_data[2] = 0; } + : flags(f), remainingChars(0), invalidChars(0), d(nullptr) { state_data[0] = state_data[1] = state_data[2] = 0; } ~ConverterState() { } ConversionFlags flags; int remainingChars; diff --git a/src/corelib/configure.json b/src/corelib/configure.json index b7eefb58c8..a6091d4825 100644 --- a/src/corelib/configure.json +++ b/src/corelib/configure.json @@ -12,7 +12,7 @@ "inotify": "boolean", "journald": "boolean", "mimetype-database": "boolean", - "pcre": { "type": "enum", "values": [ "qt", "system" ] }, + "pcre": { "type": "enum", "values": [ "no", "qt", "system" ] }, "posix-ipc": { "type": "boolean", "name": "ipc_posix" }, "pps": { "type": "boolean", "name": "qqnx_pps" }, "slog2": "boolean", @@ -684,15 +684,18 @@ "condition": "features.mimetype", "output": [ "privateFeature" ] }, + "pcre2": { + "label": "PCRE2", + "disable": "input.pcre == 'no' || input.pcre == 'system'", + "enable": "input.pcre == 'qt'", + "output": [ "privateConfig" ] + }, "system-pcre2": { - "label": "Using system PCRE2", - "disable": "input.pcre == 'qt'", + "label": " Using system PCRE2", + "disable": "input.pcre == 'no' || input.pcre == 'qt'", "enable": "input.pcre == 'system'", "condition": "libs.pcre2", - "output": [ - "privateFeature", - { "type": "privateConfig", "negative": true, "name": "pcre2" } - ] + "output": [ "privateFeature" ] }, "poll_ppoll": { "label": "Native ppoll()", @@ -771,6 +774,7 @@ "label": "QRegularExpression", "purpose": "Provides an API to Perl-compatible regular expressions.", "section": "Kernel", + "condition": "features.system-pcre2 || features.pcre2", "output": [ "publicFeature", "feature" ] }, "sharedmemory": { @@ -1071,6 +1075,7 @@ Please apply the patch corresponding to your Standard Library vendor, found in "args": "qqnx_pps", "condition": "config.qnx" }, + "pcre2", "system-pcre2" ] } diff --git a/src/corelib/corelib.pro b/src/corelib/corelib.pro index 4b758532e6..dc43e56836 100644 --- a/src/corelib/corelib.pro +++ b/src/corelib/corelib.pro @@ -68,8 +68,6 @@ integrity { QMAKE_DYNAMIC_LIST_FILE = $$PWD/QtCore.dynlist -contains(DEFINES,QT_EVAL):include(eval.pri) - HOST_BINS = $$[QT_HOST_BINS] host_bins.name = host_bins host_bins.variable = HOST_BINS diff --git a/src/corelib/eval.pri b/src/corelib/eval.pri deleted file mode 100644 index efda56b16a..0000000000 --- a/src/corelib/eval.pri +++ /dev/null @@ -1,4 +0,0 @@ -SOURCES += \ - $$QT_SOURCE_TREE/src/corelib/kernel/qtcore_eval.cpp -INCLUDEPATH += \ - $$QT_BUILD_TREE/src/corelib/global diff --git a/src/corelib/global/global.pri b/src/corelib/global/global.pri index 029357ff43..428c674307 100644 --- a/src/corelib/global/global.pri +++ b/src/corelib/global/global.pri @@ -12,7 +12,6 @@ HEADERS += \ global/qendian_p.h \ global/qnumeric_p.h \ global/qnumeric.h \ - global/qfloat16_p.h \ global/qfloat16.h \ global/qglobalstatic.h \ global/qlibraryinfo.h \ diff --git a/src/corelib/global/qfloat16.cpp b/src/corelib/global/qfloat16.cpp index fd608efe55..110d7c4d7c 100644 --- a/src/corelib/global/qfloat16.cpp +++ b/src/corelib/global/qfloat16.cpp @@ -37,7 +37,7 @@ ** ****************************************************************************/ -#include "qfloat16_p.h" +#include "qfloat16.h" #include "private/qsimd_p.h" QT_BEGIN_NAMESPACE @@ -65,28 +65,31 @@ QT_BEGIN_NAMESPACE */ /*! - Returns true if the \c qfloat16 \a {f} is equivalent to infinity. + \fn bool qIsInf(qfloat16 f) \relates <QFloat16> + Returns true if the \c qfloat16 \a {f} is equivalent to infinity. + \sa qIsInf */ -Q_REQUIRED_RESULT bool qIsInf(qfloat16 f) Q_DECL_NOTHROW { return qt_is_inf(f); } /*! - Returns true if the \c qfloat16 \a {f} is not a number (NaN). + \fn bool qIsNaN(qfloat16 f) \relates <QFloat16> + Returns true if the \c qfloat16 \a {f} is not a number (NaN). + \sa qIsNaN */ -Q_REQUIRED_RESULT bool qIsNaN(qfloat16 f) Q_DECL_NOTHROW { return qt_is_nan(f); } /*! - Returns true if the \c qfloat16 \a {f} is a finite number. + \fn bool qIsFinite(qfloat16 f) \relates <QFloat16> + Returns true if the \c qfloat16 \a {f} is a finite number. + \sa qIsFinite */ -Q_REQUIRED_RESULT bool qIsFinite(qfloat16 f) Q_DECL_NOTHROW { return qt_is_finite(f); } /*! \fn int qRound(qfloat16 value) \relates <QFloat16> diff --git a/src/corelib/global/qfloat16.h b/src/corelib/global/qfloat16.h index 42cb1357f1..e823d0298b 100644 --- a/src/corelib/global/qfloat16.h +++ b/src/corelib/global/qfloat16.h @@ -67,10 +67,14 @@ QT_BEGIN_NAMESPACE class qfloat16 { public: - Q_DECL_CONSTEXPR inline qfloat16() Q_DECL_NOTHROW : b16(0) { } + constexpr inline qfloat16() Q_DECL_NOTHROW : b16(0) {} inline qfloat16(float f) Q_DECL_NOTHROW; inline operator float() const Q_DECL_NOTHROW; + // Support for qIs{Inf,NaN,Finite}: + bool isInf() const Q_DECL_NOTHROW { return ((b16 >> 8) & 0x7e) == 0x7c; } + bool isNaN() const Q_DECL_NOTHROW { return ((b16 >> 8) & 0x7e) == 0x7e; } + bool isFinite() const Q_DECL_NOTHROW { return ((b16 >> 8) & 0x7c) != 0x7c; } private: quint16 b16; @@ -89,9 +93,11 @@ Q_DECLARE_TYPEINFO(qfloat16, Q_PRIMITIVE_TYPE); Q_CORE_EXPORT void qFloatToFloat16(qfloat16 *, const float *, qsizetype length) Q_DECL_NOTHROW; Q_CORE_EXPORT void qFloatFromFloat16(float *, const qfloat16 *, qsizetype length) Q_DECL_NOTHROW; -Q_REQUIRED_RESULT Q_CORE_EXPORT bool qIsInf(qfloat16 f) Q_DECL_NOTHROW; // complements qnumeric.h -Q_REQUIRED_RESULT Q_CORE_EXPORT bool qIsNaN(qfloat16 f) Q_DECL_NOTHROW; // complements qnumeric.h -Q_REQUIRED_RESULT Q_CORE_EXPORT bool qIsFinite(qfloat16 f) Q_DECL_NOTHROW; // complements qnumeric.h +// Complement qnumeric.h: +Q_REQUIRED_RESULT inline bool qIsInf(qfloat16 f) Q_DECL_NOTHROW { return f.isInf(); } +Q_REQUIRED_RESULT inline bool qIsNaN(qfloat16 f) Q_DECL_NOTHROW { return f.isNaN(); } +Q_REQUIRED_RESULT inline bool qIsFinite(qfloat16 f) Q_DECL_NOTHROW { return f.isFinite(); } +// Q_REQUIRED_RESULT quint32 qFloatDistance(qfloat16 a, qfloat16 b); // The remainder of these utility functions complement qglobal.h Q_REQUIRED_RESULT inline int qRound(qfloat16 d) Q_DECL_NOTHROW diff --git a/src/corelib/global/qglobalstatic.h b/src/corelib/global/qglobalstatic.h index 555bdf04c1..93d71cee57 100644 --- a/src/corelib/global/qglobalstatic.h +++ b/src/corelib/global/qglobalstatic.h @@ -131,8 +131,8 @@ struct QGlobalStatic bool isDestroyed() const { return guard.load() <= QtGlobalStatic::Destroyed; } bool exists() const { return guard.load() == QtGlobalStatic::Initialized; } - operator Type *() { if (isDestroyed()) return 0; return innerFunction(); } - Type *operator()() { if (isDestroyed()) return 0; return innerFunction(); } + operator Type *() { if (isDestroyed()) return nullptr; return innerFunction(); } + Type *operator()() { if (isDestroyed()) return nullptr; return innerFunction(); } Type *operator->() { Q_ASSERT_X(!isDestroyed(), "Q_GLOBAL_STATIC", "The global static was used after being destroyed"); diff --git a/src/corelib/global/qhooks.cpp b/src/corelib/global/qhooks.cpp index bbddb1cbf1..020dee3710 100644 --- a/src/corelib/global/qhooks.cpp +++ b/src/corelib/global/qhooks.cpp @@ -67,7 +67,7 @@ quintptr Q_CORE_EXPORT qtHookData[] = { // The required sizes and offsets are tested in tests/auto/other/toolsupport. // When this fails and the change was intentional, adjust the test and // adjust this value here. - 16 + 17 }; Q_STATIC_ASSERT(QHooks::LastHookIndex == sizeof(qtHookData) / sizeof(qtHookData[0])); diff --git a/src/corelib/global/qlibraryinfo.cpp b/src/corelib/global/qlibraryinfo.cpp index 4119012d85..88cc5b0b01 100644 --- a/src/corelib/global/qlibraryinfo.cpp +++ b/src/corelib/global/qlibraryinfo.cpp @@ -717,11 +717,6 @@ void qt_core_boilerplate() QT_PREPEND_NAMESPACE(qDumpCPUFeatures)(); -#ifdef QT_EVAL - extern void qt_core_eval_init(QCoreApplicationPrivate::Type); - qt_core_eval_init(QCoreApplicationPrivate::Tty); -#endif - exit(0); } diff --git a/src/corelib/global/qnumeric.cpp b/src/corelib/global/qnumeric.cpp index fc2b052edf..e6ba62f530 100644 --- a/src/corelib/global/qnumeric.cpp +++ b/src/corelib/global/qnumeric.cpp @@ -1,6 +1,6 @@ /**************************************************************************** ** -** Copyright (C) 2016 The Qt Company Ltd. +** Copyright (C) 2019 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** ** This file is part of the QtCore module of the Qt Toolkit. @@ -46,6 +46,7 @@ QT_BEGIN_NAMESPACE /*! Returns \c true if the double \a {d} is equivalent to infinity. \relates <QtGlobal> + \sa qInf() */ Q_CORE_EXPORT bool qIsInf(double d) { return qt_is_inf(d); } @@ -64,6 +65,7 @@ Q_CORE_EXPORT bool qIsFinite(double d) { return qt_is_finite(d); } /*! Returns \c true if the float \a {f} is equivalent to infinity. \relates <QtGlobal> + \sa qInf() */ Q_CORE_EXPORT bool qIsInf(float f) { return qt_is_inf(f); } @@ -88,15 +90,36 @@ Q_CORE_EXPORT double qSNaN() { return qt_snan(); } /*! Returns the bit pattern of a quiet NaN as a double. \relates <QtGlobal> + \sa qIsNaN() */ Q_CORE_EXPORT double qQNaN() { return qt_qnan(); } /*! Returns the bit pattern for an infinite number as a double. \relates <QtGlobal> + \sa qIsInf() */ Q_CORE_EXPORT double qInf() { return qt_inf(); } +/*! + \relates <QtGlobal> + Classifies a floating-point value. + + The return values are defined in \c{<cmath>}: returns one of the following, + determined by the floating-point class of \a val: + \list + \li FP_NAN not a number + \li FP_INFINITE infinities (positive or negative) + \li FP_NORMAL finite with a full mantissa + \li FP_SUBNORMAL finite with a reduced mantissa + \endlist +*/ +Q_CORE_EXPORT int qFpClassify(double val) { return qt_fpclassify(val); } + +/*! + \overload +*/ +Q_CORE_EXPORT int qFpClassify(float val) { return qt_fpclassify(val); } /*! diff --git a/src/corelib/global/qnumeric.h b/src/corelib/global/qnumeric.h index 535a96aaec..6a0c64712f 100644 --- a/src/corelib/global/qnumeric.h +++ b/src/corelib/global/qnumeric.h @@ -1,6 +1,6 @@ /**************************************************************************** ** -** Copyright (C) 2016 The Qt Company Ltd. +** Copyright (C) 2019 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** ** This file is part of the QtCore module of the Qt Toolkit. @@ -48,9 +48,11 @@ QT_BEGIN_NAMESPACE Q_CORE_EXPORT Q_DECL_CONST_FUNCTION bool qIsInf(double d); Q_CORE_EXPORT Q_DECL_CONST_FUNCTION bool qIsNaN(double d); Q_CORE_EXPORT Q_DECL_CONST_FUNCTION bool qIsFinite(double d); +Q_CORE_EXPORT Q_DECL_CONST_FUNCTION int qFpClassify(double val); Q_CORE_EXPORT Q_DECL_CONST_FUNCTION bool qIsInf(float f); Q_CORE_EXPORT Q_DECL_CONST_FUNCTION bool qIsNaN(float f); Q_CORE_EXPORT Q_DECL_CONST_FUNCTION bool qIsFinite(float f); +Q_CORE_EXPORT Q_DECL_CONST_FUNCTION int qFpClassify(float val); Q_CORE_EXPORT Q_DECL_CONST_FUNCTION double qSNaN(); Q_CORE_EXPORT Q_DECL_CONST_FUNCTION double qQNaN(); Q_CORE_EXPORT Q_DECL_CONST_FUNCTION double qInf(); diff --git a/src/corelib/global/qnumeric_p.h b/src/corelib/global/qnumeric_p.h index 4a225b2599..56e670c477 100644 --- a/src/corelib/global/qnumeric_p.h +++ b/src/corelib/global/qnumeric_p.h @@ -1,6 +1,6 @@ /**************************************************************************** ** -** Copyright (C) 2016 The Qt Company Ltd. +** Copyright (C) 2019 The Qt Company Ltd. ** Copyright (C) 2018 Intel Corporation. ** Contact: https://www.qt.io/licensing/ ** @@ -85,9 +85,11 @@ namespace qnumeric_std_wrapper { Q_DECL_CONST_FUNCTION static inline bool math_h_isnan(double d) { using namespace std; return isnan(d); } Q_DECL_CONST_FUNCTION static inline bool math_h_isinf(double d) { using namespace std; return isinf(d); } Q_DECL_CONST_FUNCTION static inline bool math_h_isfinite(double d) { using namespace std; return isfinite(d); } +Q_DECL_CONST_FUNCTION static inline int math_h_fpclassify(double d) { using namespace std; return fpclassify(d); } Q_DECL_CONST_FUNCTION static inline bool math_h_isnan(float f) { using namespace std; return isnan(f); } Q_DECL_CONST_FUNCTION static inline bool math_h_isinf(float f) { using namespace std; return isinf(f); } Q_DECL_CONST_FUNCTION static inline bool math_h_isfinite(float f) { using namespace std; return isfinite(f); } +Q_DECL_CONST_FUNCTION static inline int math_h_fpclassify(float f) { using namespace std; return fpclassify(f); } } QT_END_NAMESPACE // These macros from math.h conflict with the real functions in the std namespace. @@ -95,6 +97,7 @@ QT_END_NAMESPACE # undef isnan # undef isinf # undef isfinite +# undef fpclassify # endif // defined(isnan) #endif @@ -106,16 +109,20 @@ namespace qnumeric_std_wrapper { Q_DECL_CONST_FUNCTION static inline bool isnan(double d) { return math_h_isnan(d); } Q_DECL_CONST_FUNCTION static inline bool isinf(double d) { return math_h_isinf(d); } Q_DECL_CONST_FUNCTION static inline bool isfinite(double d) { return math_h_isfinite(d); } +Q_DECL_CONST_FUNCTION static inline int fpclassify(double d) { return math_h_fpclassify(d); } Q_DECL_CONST_FUNCTION static inline bool isnan(float f) { return math_h_isnan(f); } Q_DECL_CONST_FUNCTION static inline bool isinf(float f) { return math_h_isinf(f); } Q_DECL_CONST_FUNCTION static inline bool isfinite(float f) { return math_h_isfinite(f); } +Q_DECL_CONST_FUNCTION static inline int fpclassify(float f) { return math_h_fpclassify(f); } #else Q_DECL_CONST_FUNCTION static inline bool isnan(double d) { return std::isnan(d); } Q_DECL_CONST_FUNCTION static inline bool isinf(double d) { return std::isinf(d); } Q_DECL_CONST_FUNCTION static inline bool isfinite(double d) { return std::isfinite(d); } +Q_DECL_CONST_FUNCTION static inline int fpclassify(double d) { return std::fpclassify(d); } Q_DECL_CONST_FUNCTION static inline bool isnan(float f) { return std::isnan(f); } Q_DECL_CONST_FUNCTION static inline bool isinf(float f) { return std::isinf(f); } Q_DECL_CONST_FUNCTION static inline bool isfinite(float f) { return std::isfinite(f); } +Q_DECL_CONST_FUNCTION static inline int fpclassify(float f) { return std::fpclassify(f); } #endif } @@ -157,6 +164,11 @@ Q_DECL_CONST_FUNCTION static inline bool qt_is_finite(double d) return qnumeric_std_wrapper::isfinite(d); } +Q_DECL_CONST_FUNCTION static inline int qt_fpclassify(double d) +{ + return qnumeric_std_wrapper::fpclassify(d); +} + Q_DECL_CONST_FUNCTION static inline bool qt_is_inf(float f) { return qnumeric_std_wrapper::isinf(f); @@ -172,6 +184,11 @@ Q_DECL_CONST_FUNCTION static inline bool qt_is_finite(float f) return qnumeric_std_wrapper::isfinite(f); } +Q_DECL_CONST_FUNCTION static inline int qt_fpclassify(float f) +{ + return qnumeric_std_wrapper::fpclassify(f); +} + #ifndef Q_CLANG_QDOC namespace { /*! diff --git a/src/corelib/global/qrandom.cpp b/src/corelib/global/qrandom.cpp index 6195c324e7..90df8653a7 100644 --- a/src/corelib/global/qrandom.cpp +++ b/src/corelib/global/qrandom.cpp @@ -930,7 +930,7 @@ inline QRandomGenerator::SystemGenerator &QRandomGenerator::SystemGenerator::sel */ /*! - \fn quint32 QRandomGenerator::bounded(int highest) + \fn int QRandomGenerator::bounded(int highest) \overload Generates one random 32-bit quantity in the range between 0 (inclusive) and @@ -957,7 +957,6 @@ inline QRandomGenerator::SystemGenerator &QRandomGenerator::SystemGenerator::sel \snippet code/src_corelib_global_qrandom.cpp 14 - Note that this function cannot be used to obtain values in the full 32-bit range of quint32. Instead, use generate(). @@ -965,7 +964,7 @@ inline QRandomGenerator::SystemGenerator &QRandomGenerator::SystemGenerator::sel */ /*! - \fn quint32 QRandomGenerator::bounded(int lowest, int highest) + \fn int QRandomGenerator::bounded(int lowest, int highest) \overload Generates one random 32-bit quantity in the range between \a lowest diff --git a/src/corelib/global/qtrace_p.h b/src/corelib/global/qtrace_p.h index 3d04a7311d..56d1f9a318 100644 --- a/src/corelib/global/qtrace_p.h +++ b/src/corelib/global/qtrace_p.h @@ -114,10 +114,12 @@ QT_BEGIN_NAMESPACE #if defined(Q_TRACEPOINT) && !defined(QT_BOOTSTRAPPED) +# define Q_HAS_TRACEPOINTS 1 # define Q_TRACE(x, ...) QtPrivate::trace_ ## x(__VA_ARGS__) # define Q_UNCONDITIONAL_TRACE(x, ...) QtPrivate::do_trace_ ## x(__VA_ARGS__) # define Q_TRACE_ENABLED(x) QtPrivate::trace_ ## x ## _enabled() #else +# define Q_HAS_TRACEPOINTS 0 # define Q_TRACE(x, ...) # define Q_UNCONDITIONAL_TRACE(x, ...) # define Q_TRACE_ENABLED(x) false diff --git a/src/corelib/io/qabstractfileengine_p.h b/src/corelib/io/qabstractfileengine_p.h index 4a7fe7bff5..c88b66c7ce 100644 --- a/src/corelib/io/qabstractfileengine_p.h +++ b/src/corelib/io/qabstractfileengine_p.h @@ -193,7 +193,7 @@ public: uchar *address; }; - virtual bool extension(Extension extension, const ExtensionOption *option = 0, ExtensionReturn *output = 0); + virtual bool extension(Extension extension, const ExtensionOption *option = nullptr, ExtensionReturn *output = nullptr); virtual bool supportsExtension(Extension extension) const; // Factory diff --git a/src/corelib/io/qfileinfo_p.h b/src/corelib/io/qfileinfo_p.h index e4b28f4519..36f440812f 100644 --- a/src/corelib/io/qfileinfo_p.h +++ b/src/corelib/io/qfileinfo_p.h @@ -80,7 +80,7 @@ public: }; inline QFileInfoPrivate() - : QSharedData(), fileEngine(0), + : QSharedData(), fileEngine(nullptr), cachedFlags(0), isDefaultConstructed(true), cache_enabled(true), fileFlags(0), fileSize(0) diff --git a/src/corelib/io/qfilesystemengine_p.h b/src/corelib/io/qfilesystemengine_p.h index 09ec2d6a10..e44837747c 100644 --- a/src/corelib/io/qfilesystemengine_p.h +++ b/src/corelib/io/qfilesystemengine_p.h @@ -130,7 +130,7 @@ public: static bool removeFile(const QFileSystemEntry &entry, QSystemError &error); static bool setPermissions(const QFileSystemEntry &entry, QFile::Permissions permissions, QSystemError &error, - QFileSystemMetaData *data = 0); + QFileSystemMetaData *data = nullptr); // unused, therefore not implemented static bool setFileTime(const QFileSystemEntry &entry, const QDateTime &newDate, diff --git a/src/corelib/io/qfilesystemmetadata_p.h b/src/corelib/io/qfilesystemmetadata_p.h index 4d2a5acb9b..81f4b3ba13 100644 --- a/src/corelib/io/qfilesystemmetadata_p.h +++ b/src/corelib/io/qfilesystemmetadata_p.h @@ -76,7 +76,7 @@ class Q_AUTOTEST_EXPORT QFileSystemMetaData { public: QFileSystemMetaData() - : knownFlagsMask(0), + : knownFlagsMask(nullptr), size_(-1) { } @@ -184,7 +184,7 @@ public: void clear() { - knownFlagsMask = 0; + knownFlagsMask = nullptr; } void clearFlags(MetaDataFlags flags = AllMetaDataFlags) diff --git a/src/corelib/io/qfilesystemwatcher_win.cpp b/src/corelib/io/qfilesystemwatcher_win.cpp index 66985f8982..7f4f9d345b 100644 --- a/src/corelib/io/qfilesystemwatcher_win.cpp +++ b/src/corelib/io/qfilesystemwatcher_win.cpp @@ -108,7 +108,11 @@ public: // Call from QFileSystemWatcher::addPaths() to set up notifications on drives void addPath(const QString &path); +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + bool nativeEventFilter(const QByteArray &, void *messageIn, qintptr *) override; +#else bool nativeEventFilter(const QByteArray &, void *messageIn, long *) override; +#endif signals: void driveAdded(); @@ -255,7 +259,11 @@ inline void QWindowsRemovableDriveListener::handleDbtDriveArrivalRemoval(const M } } +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QWindowsRemovableDriveListener::nativeEventFilter(const QByteArray &, void *messageIn, qintptr *) +#else bool QWindowsRemovableDriveListener::nativeEventFilter(const QByteArray &, void *messageIn, long *) +#endif { const MSG *msg = reinterpret_cast<const MSG *>(messageIn); if (msg->message == WM_DEVICECHANGE) { diff --git a/src/corelib/io/qfsfileengine_p.h b/src/corelib/io/qfsfileengine_p.h index 6b091a8eef..0f416f4886 100644 --- a/src/corelib/io/qfsfileengine_p.h +++ b/src/corelib/io/qfsfileengine_p.h @@ -115,7 +115,7 @@ public: virtual bool isUnnamedFile() const { return false; } - bool extension(Extension extension, const ExtensionOption *option = 0, ExtensionReturn *output = 0) override; + bool extension(Extension extension, const ExtensionOption *option = nullptr, ExtensionReturn *output = nullptr) override; bool supportsExtension(Extension extension) const override; //FS only!! diff --git a/src/corelib/io/qprocess.cpp b/src/corelib/io/qprocess.cpp index d5d67d86f3..c7635cc7b4 100644 --- a/src/corelib/io/qprocess.cpp +++ b/src/corelib/io/qprocess.cpp @@ -42,6 +42,7 @@ #include <qdebug.h> #include <qdir.h> +#include <qscopedvaluerollback.h> #if defined(Q_OS_WIN) #include <qtimer.h> #endif @@ -1062,9 +1063,8 @@ bool QProcessPrivate::tryReadFromChannel(Channel *channel) if (currentReadChannel == channelIdx) { didRead = true; if (!emittedReadyRead) { - emittedReadyRead = true; + QScopedValueRollback<bool> guard(emittedReadyRead, true); emit q->readyRead(); - emittedReadyRead = false; } } emit q->channelReadyRead(int(channelIdx)); diff --git a/src/corelib/io/qprocess_p.h b/src/corelib/io/qprocess_p.h index aa7ecbe91d..1bc63240fe 100644 --- a/src/corelib/io/qprocess_p.h +++ b/src/corelib/io/qprocess_p.h @@ -247,7 +247,7 @@ public: // if you add "= 4" here, increase the number of bits below }; - Channel() : process(0), notifier(0), type(Normal), closed(false), append(false) + Channel() : process(nullptr), notifier(nullptr), type(Normal), closed(false), append(false) { pipe[0] = INVALID_Q_PIPE; pipe[1] = INVALID_Q_PIPE; diff --git a/src/corelib/io/qresource_p.h b/src/corelib/io/qresource_p.h index 7451de8809..fedf95bb33 100644 --- a/src/corelib/io/qresource_p.h +++ b/src/corelib/io/qresource_p.h @@ -108,7 +108,7 @@ public: Iterator *beginEntryList(QDir::Filters filters, const QStringList &filterNames) override; Iterator *endEntryList() override; - bool extension(Extension extension, const ExtensionOption *option = 0, ExtensionReturn *output = 0) override; + bool extension(Extension extension, const ExtensionOption *option = nullptr, ExtensionReturn *output = nullptr) override; bool supportsExtension(Extension extension) const override; }; diff --git a/src/corelib/io/qurl_p.h b/src/corelib/io/qurl_p.h index 1b9237e58a..e75de32e03 100644 --- a/src/corelib/io/qurl_p.h +++ b/src/corelib/io/qurl_p.h @@ -59,7 +59,7 @@ QT_BEGIN_NAMESPACE // in qurlrecode.cpp extern Q_AUTOTEST_EXPORT int qt_urlRecode(QString &appendTo, const QChar *begin, const QChar *end, - QUrl::ComponentFormattingOptions encoding, const ushort *tableModifications = 0); + QUrl::ComponentFormattingOptions encoding, const ushort *tableModifications = nullptr); // in qurlidna.cpp enum AceLeadingDot { AllowLeadingDot, ForbidLeadingDot }; diff --git a/src/corelib/io/qwindowspipereader.cpp b/src/corelib/io/qwindowspipereader.cpp index 15c9f52cf3..1f03ac5d5a 100644 --- a/src/corelib/io/qwindowspipereader.cpp +++ b/src/corelib/io/qwindowspipereader.cpp @@ -40,6 +40,7 @@ #include "qwindowspipereader_p.h" #include "qiodevice_p.h" #include <qelapsedtimer.h> +#include <qscopedvaluerollback.h> QT_BEGIN_NAMESPACE @@ -301,9 +302,8 @@ void QWindowsPipeReader::emitPendingReadyRead() { if (readyReadPending) { readyReadPending = false; - inReadyRead = true; + QScopedValueRollback<bool> guard(inReadyRead, true); emit readyRead(); - inReadyRead = false; } } diff --git a/src/corelib/io/qwindowspipewriter.cpp b/src/corelib/io/qwindowspipewriter.cpp index 92e8b6db52..32536f495b 100644 --- a/src/corelib/io/qwindowspipewriter.cpp +++ b/src/corelib/io/qwindowspipewriter.cpp @@ -39,6 +39,7 @@ #include "qwindowspipewriter_p.h" #include "qiodevice_p.h" +#include <qscopedvaluerollback.h> QT_BEGIN_NAMESPACE @@ -111,9 +112,8 @@ void QWindowsPipeWriter::emitPendingBytesWrittenValue() emit canWrite(); if (!inBytesWritten) { - inBytesWritten = true; + QScopedValueRollback<bool> guard(inBytesWritten, true); emit bytesWritten(bytes); - inBytesWritten = false; } } } diff --git a/src/corelib/itemmodels/qabstractitemmodel_p.h b/src/corelib/itemmodels/qabstractitemmodel_p.h index e6085eca94..92a440a125 100644 --- a/src/corelib/itemmodels/qabstractitemmodel_p.h +++ b/src/corelib/itemmodels/qabstractitemmodel_p.h @@ -98,7 +98,7 @@ public: void itemsMoved(const QModelIndex &srcParent, int srcFirst, int srcLast, const QModelIndex &destinationParent, int destinationChild, Qt::Orientation orientation); bool allowMove(const QModelIndex &srcParent, int srcFirst, int srcLast, const QModelIndex &destinationParent, int destinationChild, Qt::Orientation orientation); - inline QModelIndex createIndex(int row, int column, void *data = 0) const { + inline QModelIndex createIndex(int row, int column, void *data = nullptr) const { return q_func()->createIndex(row, column, data); } diff --git a/src/corelib/itemmodels/qabstractproxymodel_p.h b/src/corelib/itemmodels/qabstractproxymodel_p.h index f7bd5cc691..a95687c970 100644 --- a/src/corelib/itemmodels/qabstractproxymodel_p.h +++ b/src/corelib/itemmodels/qabstractproxymodel_p.h @@ -62,7 +62,7 @@ class Q_CORE_EXPORT QAbstractProxyModelPrivate : public QAbstractItemModelPrivat { Q_DECLARE_PUBLIC(QAbstractProxyModel) public: - QAbstractProxyModelPrivate() : QAbstractItemModelPrivate(), model(0) {} + QAbstractProxyModelPrivate() : QAbstractItemModelPrivate(), model(nullptr) {} QAbstractItemModel *model; virtual void _q_sourceModelDestroyed(); void mapDropCoordinatesToSource(int row, int column, const QModelIndex &parent, diff --git a/src/corelib/itemmodels/qitemselectionmodel_p.h b/src/corelib/itemmodels/qitemselectionmodel_p.h index e12a0c2928..ba85f22be3 100644 --- a/src/corelib/itemmodels/qitemselectionmodel_p.h +++ b/src/corelib/itemmodels/qitemselectionmodel_p.h @@ -62,7 +62,7 @@ class QItemSelectionModelPrivate: public QObjectPrivate Q_DECLARE_PUBLIC(QItemSelectionModel) public: QItemSelectionModelPrivate() - : model(0), + : model(nullptr), currentCommand(QItemSelectionModel::NoUpdate), tableSelected(false), tableColCount(0), tableRowCount(0) {} diff --git a/src/corelib/kernel/kernel.pri b/src/corelib/kernel/kernel.pri index 3f7bf3cd47..789bcb7927 100644 --- a/src/corelib/kernel/kernel.pri +++ b/src/corelib/kernel/kernel.pri @@ -7,7 +7,7 @@ HEADERS += \ kernel/qdeadlinetimer.h \ kernel/qdeadlinetimer_p.h \ kernel/qelapsedtimer.h \ - kernel/qeventloop.h\ + kernel/qeventloop.h \ kernel/qpointer.h \ kernel/qcorecmdlineargs_p.h \ kernel/qcoreapplication.h \ diff --git a/src/corelib/kernel/qabstracteventdispatcher.cpp b/src/corelib/kernel/qabstracteventdispatcher.cpp index 8e1b560874..0ecfc7a8c7 100644 --- a/src/corelib/kernel/qabstracteventdispatcher.cpp +++ b/src/corelib/kernel/qabstracteventdispatcher.cpp @@ -470,7 +470,11 @@ void QAbstractEventDispatcher::removeNativeEventFilter(QAbstractNativeEventFilte \sa installNativeEventFilter(), QAbstractNativeEventFilter::nativeEventFilter() \since 5.0 */ +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QAbstractEventDispatcher::filterNativeEvent(const QByteArray &eventType, void *message, qintptr *result) +#else bool QAbstractEventDispatcher::filterNativeEvent(const QByteArray &eventType, void *message, long *result) +#endif { Q_D(QAbstractEventDispatcher); if (!d->eventFilters.isEmpty()) { diff --git a/src/corelib/kernel/qabstracteventdispatcher.h b/src/corelib/kernel/qabstracteventdispatcher.h index bd8da5c35d..4ef9c068df 100644 --- a/src/corelib/kernel/qabstracteventdispatcher.h +++ b/src/corelib/kernel/qabstracteventdispatcher.h @@ -110,7 +110,11 @@ public: void installNativeEventFilter(QAbstractNativeEventFilter *filterObj); void removeNativeEventFilter(QAbstractNativeEventFilter *filterObj); +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + bool filterNativeEvent(const QByteArray &eventType, void *message, qintptr *result); +#else bool filterNativeEvent(const QByteArray &eventType, void *message, long *result); +#endif #if QT_DEPRECATED_SINCE(5, 0) QT_DEPRECATED bool filterEvent(void *message) { return filterNativeEvent("", message, nullptr); } diff --git a/src/corelib/kernel/qabstractnativeeventfilter.cpp b/src/corelib/kernel/qabstractnativeeventfilter.cpp index dcbb92f044..eaadea4c12 100644 --- a/src/corelib/kernel/qabstractnativeeventfilter.cpp +++ b/src/corelib/kernel/qabstractnativeeventfilter.cpp @@ -74,6 +74,7 @@ QAbstractNativeEventFilter::~QAbstractNativeEventFilter() eventDispatcher->removeNativeEventFilter(this); } +// ### fixme Qt 6: result will be qintptr * /*! \fn bool QAbstractNativeEventFilter::nativeEventFilter(const QByteArray &eventType, void *message, long *result) diff --git a/src/corelib/kernel/qabstractnativeeventfilter.h b/src/corelib/kernel/qabstractnativeeventfilter.h index d7baa42513..a468bffd61 100644 --- a/src/corelib/kernel/qabstractnativeeventfilter.h +++ b/src/corelib/kernel/qabstractnativeeventfilter.h @@ -52,7 +52,11 @@ public: QAbstractNativeEventFilter(); virtual ~QAbstractNativeEventFilter(); +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + virtual bool nativeEventFilter(const QByteArray &eventType, void *message, qintptr *result) = 0; +#else virtual bool nativeEventFilter(const QByteArray &eventType, void *message, long *result) = 0; +#endif private: Q_DISABLE_COPY(QAbstractNativeEventFilter) diff --git a/src/corelib/kernel/qcore_unix_p.h b/src/corelib/kernel/qcore_unix_p.h index 5a2a29a327..32ef6408c2 100644 --- a/src/corelib/kernel/qcore_unix_p.h +++ b/src/corelib/kernel/qcore_unix_p.h @@ -171,7 +171,7 @@ inline void qt_ignore_sigpipe() struct sigaction noaction; memset(&noaction, 0, sizeof(noaction)); noaction.sa_handler = SIG_IGN; - ::sigaction(SIGPIPE, &noaction, 0); + ::sigaction(SIGPIPE, &noaction, nullptr); atom.store(1); } } diff --git a/src/corelib/kernel/qcoreapplication.cpp b/src/corelib/kernel/qcoreapplication.cpp index c06af79cc7..5da33a5aae 100644 --- a/src/corelib/kernel/qcoreapplication.cpp +++ b/src/corelib/kernel/qcoreapplication.cpp @@ -256,15 +256,6 @@ void QCoreApplicationPrivate::processCommandLineArguments() // Support for introspection -#ifndef QT_NO_QOBJECT -QSignalSpyCallbackSet Q_CORE_EXPORT qt_signal_spy_callback_set = { 0, 0, 0, 0 }; - -void qt_register_signal_spy_callbacks(const QSignalSpyCallbackSet &callback_set) -{ - qt_signal_spy_callback_set = callback_set; -} -#endif - extern "C" void Q_CORE_EXPORT qt_startup_hook() { } @@ -866,11 +857,6 @@ void QCoreApplicationPrivate::init() eventDispatcherReady(); #endif -#ifdef QT_EVAL - extern void qt_core_eval_init(QCoreApplicationPrivate::Type); - qt_core_eval_init(application_type); -#endif - processCommandLineArguments(); qt_call_pre_routines(); diff --git a/src/corelib/kernel/qcoreapplication_p.h b/src/corelib/kernel/qcoreapplication_p.h index b3479414ab..14ca3efd7f 100644 --- a/src/corelib/kernel/qcoreapplication_p.h +++ b/src/corelib/kernel/qcoreapplication_p.h @@ -149,7 +149,7 @@ public: QString cachedApplicationDirPath; static QString *cachedApplicationFilePath; static void setApplicationFilePath(const QString &path); - static inline void clearApplicationFilePath() { delete cachedApplicationFilePath; cachedApplicationFilePath = 0; } + static inline void clearApplicationFilePath() { delete cachedApplicationFilePath; cachedApplicationFilePath = nullptr; } #ifndef QT_NO_QOBJECT void execCleanup(); diff --git a/src/corelib/kernel/qeventdispatcher_glib_p.h b/src/corelib/kernel/qeventdispatcher_glib_p.h index 88ff316ee5..313825d0a7 100644 --- a/src/corelib/kernel/qeventdispatcher_glib_p.h +++ b/src/corelib/kernel/qeventdispatcher_glib_p.h @@ -66,8 +66,8 @@ class Q_CORE_EXPORT QEventDispatcherGlib : public QAbstractEventDispatcher Q_DECLARE_PRIVATE(QEventDispatcherGlib) public: - explicit QEventDispatcherGlib(QObject *parent = 0); - explicit QEventDispatcherGlib(GMainContext *context, QObject *parent = 0); + explicit QEventDispatcherGlib(QObject *parent = nullptr); + explicit QEventDispatcherGlib(GMainContext *context, QObject *parent = nullptr); ~QEventDispatcherGlib(); bool processEvents(QEventLoop::ProcessEventsFlags flags) override; @@ -102,7 +102,7 @@ class Q_CORE_EXPORT QEventDispatcherGlibPrivate : public QAbstractEventDispatche { public: - QEventDispatcherGlibPrivate(GMainContext *context = 0); + QEventDispatcherGlibPrivate(GMainContext *context = nullptr); GMainContext *mainContext; GPostEventSource *postEventSource; GSocketNotifierSource *socketNotifierSource; diff --git a/src/corelib/kernel/qeventdispatcher_unix_p.h b/src/corelib/kernel/qeventdispatcher_unix_p.h index 0fd068b074..8cfa4bbdf7 100644 --- a/src/corelib/kernel/qeventdispatcher_unix_p.h +++ b/src/corelib/kernel/qeventdispatcher_unix_p.h @@ -102,7 +102,7 @@ class Q_CORE_EXPORT QEventDispatcherUNIX : public QAbstractEventDispatcher Q_DECLARE_PRIVATE(QEventDispatcherUNIX) public: - explicit QEventDispatcherUNIX(QObject *parent = 0); + explicit QEventDispatcherUNIX(QObject *parent = nullptr); ~QEventDispatcherUNIX(); bool processEvents(QEventLoop::ProcessEventsFlags flags) override; @@ -123,7 +123,7 @@ public: void flush() override; protected: - QEventDispatcherUNIX(QEventDispatcherUNIXPrivate &dd, QObject *parent = 0); + QEventDispatcherUNIX(QEventDispatcherUNIXPrivate &dd, QObject *parent = nullptr); }; class Q_CORE_EXPORT QEventDispatcherUNIXPrivate : public QAbstractEventDispatcherPrivate @@ -152,9 +152,9 @@ public: inline QSocketNotifierSetUNIX::QSocketNotifierSetUNIX() Q_DECL_NOTHROW { - notifiers[0] = 0; - notifiers[1] = 0; - notifiers[2] = 0; + notifiers[0] = nullptr; + notifiers[1] = nullptr; + notifiers[2] = nullptr; } inline bool QSocketNotifierSetUNIX::isEmpty() const Q_DECL_NOTHROW diff --git a/src/corelib/kernel/qeventdispatcher_win.cpp b/src/corelib/kernel/qeventdispatcher_win.cpp index 685d765adb..84378454ca 100644 --- a/src/corelib/kernel/qeventdispatcher_win.cpp +++ b/src/corelib/kernel/qeventdispatcher_win.cpp @@ -136,7 +136,11 @@ LRESULT QT_WIN_CALLBACK qt_internal_proc(HWND hwnd, UINT message, WPARAM wp, LPA msg.wParam = wp; msg.lParam = lp; QAbstractEventDispatcher* dispatcher = QAbstractEventDispatcher::instance(); +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + qintptr result; +#else long result; +#endif if (!dispatcher) { if (message == WM_TIMER) KillTimer(hwnd, wp); diff --git a/src/corelib/kernel/qmetaobject_moc_p.h b/src/corelib/kernel/qmetaobject_moc_p.h index ad258acfcd..8c7900767b 100644 --- a/src/corelib/kernel/qmetaobject_moc_p.h +++ b/src/corelib/kernel/qmetaobject_moc_p.h @@ -138,7 +138,7 @@ static QByteArray normalizeTypeInternal(const char *t, const char *e, bool fixSc { "struct ", 7 }, { "class ", 6 }, { "enum ", 5 }, - { 0, 0 } + { nullptr, 0 } }; int i = 0; do { @@ -146,7 +146,7 @@ static QByteArray normalizeTypeInternal(const char *t, const char *e, bool fixSc t += optional[i].len; break; } - } while (optional[++i].keyword != 0); + } while (optional[++i].keyword != nullptr); } bool star = false; diff --git a/src/corelib/kernel/qmetaobject_p.h b/src/corelib/kernel/qmetaobject_p.h index 522bd78e42..0cd9da2eac 100644 --- a/src/corelib/kernel/qmetaobject_p.h +++ b/src/corelib/kernel/qmetaobject_p.h @@ -54,6 +54,7 @@ #include <QtCore/qglobal.h> #include <QtCore/qobjectdefs.h> +#include <QtCore/qmutex.h> #ifndef QT_NO_QOBJECT #include <private/qobject_p.h> // For QObjectPrivate::Connection #endif @@ -168,7 +169,6 @@ Q_DECLARE_TYPEINFO(QArgumentType, Q_MOVABLE_TYPE); typedef QVarLengthArray<QArgumentType, 10> QArgumentTypeArray; class QMetaMethodPrivate; -class QMutex; struct QMetaObjectPrivate { @@ -226,15 +226,15 @@ struct QMetaObjectPrivate static QObjectPrivate::Connection *connect(const QObject *sender, int signal_index, const QMetaObject *smeta, const QObject *receiver, int method_index_relative, - const QMetaObject *rmeta = 0, - int type = 0, int *types = 0); + const QMetaObject *rmeta = nullptr, + int type = 0, int *types = nullptr); static bool disconnect(const QObject *sender, int signal_index, const QMetaObject *smeta, const QObject *receiver, int method_index, void **slot, DisconnectType = DisconnectAll); - static inline bool disconnectHelper(QObjectPrivate::Connection *c, + static inline bool disconnectHelper(QObjectPrivate::ConnectionData *connections, int signalIndex, const QObject *receiver, int method_index, void **slot, - QMutex *senderMutex, DisconnectType = DisconnectAll); + QBasicMutex *senderMutex, DisconnectType = DisconnectAll); #endif }; diff --git a/src/corelib/kernel/qmetaobjectbuilder_p.h b/src/corelib/kernel/qmetaobjectbuilder_p.h index 6100835bad..6d43be7811 100644 --- a/src/corelib/kernel/qmetaobjectbuilder_p.h +++ b/src/corelib/kernel/qmetaobjectbuilder_p.h @@ -173,7 +173,7 @@ public: void setStaticMetacallFunction(QMetaObjectBuilder::StaticMetacallFunction value); QMetaObject *toMetaObject() const; - QByteArray toRelocatableData(bool * = 0) const; + QByteArray toRelocatableData(bool * = nullptr) const; static void fromRelocatableData(QMetaObject *, const QMetaObject *, const QByteArray &); #ifndef QT_NO_DATASTREAM @@ -196,7 +196,7 @@ private: class Q_CORE_EXPORT QMetaMethodBuilder { public: - QMetaMethodBuilder() : _mobj(0), _index(0) {} + QMetaMethodBuilder() : _mobj(nullptr), _index(0) {} int index() const; @@ -238,7 +238,7 @@ private: class Q_CORE_EXPORT QMetaPropertyBuilder { public: - QMetaPropertyBuilder() : _mobj(0), _index(0) {} + QMetaPropertyBuilder() : _mobj(nullptr), _index(0) {} int index() const { return _index; } @@ -294,7 +294,7 @@ private: class Q_CORE_EXPORT QMetaEnumBuilder { public: - QMetaEnumBuilder() : _mobj(0), _index(0) {} + QMetaEnumBuilder() : _mobj(nullptr), _index(0) {} int index() const { return _index; } diff --git a/src/corelib/kernel/qobject.cpp b/src/corelib/kernel/qobject.cpp index 15955e1665..45e88a2082 100644 --- a/src/corelib/kernel/qobject.cpp +++ b/src/corelib/kernel/qobject.cpp @@ -1,6 +1,6 @@ /**************************************************************************** ** -** Copyright (C) 2016 The Qt Company Ltd. +** Copyright (C) 2019 The Qt Company Ltd. ** Copyright (C) 2016 Intel Corporation. ** Copyright (C) 2013 Olivier Goffart <ogoffart@woboq.com> ** Contact: https://www.qt.io/licensing/ @@ -77,6 +77,12 @@ QT_BEGIN_NAMESPACE static int DIRECT_CONNECTION_ONLY = 0; +Q_CORE_EXPORT QBasicAtomicPointer<QSignalSpyCallbackSet> qt_signal_spy_callback_set = Q_BASIC_ATOMIC_INITIALIZER(nullptr); + +void qt_register_signal_spy_callbacks(QSignalSpyCallbackSet *callback_set) +{ + qt_signal_spy_callback_set.store(callback_set); +} QDynamicMetaObjectData::~QDynamicMetaObjectData() { @@ -146,10 +152,9 @@ static QBasicMutex _q_ObjectMutexPool[131]; * \internal * mutex to be locked when accessing the connectionlists or the senders list */ -static inline QMutex *signalSlotLock(const QObject *o) +static inline QBasicMutex *signalSlotLock(const QObject *o) { - return static_cast<QMutex *>(&_q_ObjectMutexPool[ - uint(quintptr(o)) % sizeof(_q_ObjectMutexPool)/sizeof(QBasicMutex)]); + return &_q_ObjectMutexPool[uint(quintptr(o)) % sizeof(_q_ObjectMutexPool)/sizeof(QBasicMutex)]; } #if QT_VERSION < 0x60000 @@ -160,39 +165,6 @@ extern "C" Q_CORE_EXPORT void qt_removeObject(QObject *) {} #endif -struct QConnectionSenderSwitcher { - QObject *receiver; - QObjectPrivate::Sender *previousSender; - QObjectPrivate::Sender currentSender; - bool switched; - - inline QConnectionSenderSwitcher() : switched(false) {} - - inline QConnectionSenderSwitcher(QObject *receiver, QObject *sender, int signal_absolute_id) - { - switchSender(receiver, sender, signal_absolute_id); - } - - inline void switchSender(QObject *receiver, QObject *sender, int signal_absolute_id) - { - this->receiver = receiver; - currentSender.sender = sender; - currentSender.signal = signal_absolute_id; - currentSender.ref = 1; - previousSender = QObjectPrivate::setCurrentSender(receiver, ¤tSender); - switched = true; - } - - inline ~QConnectionSenderSwitcher() - { - if (switched) - QObjectPrivate::resetCurrentSender(receiver, ¤tSender, previousSender); - } -private: - Q_DISABLE_COPY(QConnectionSenderSwitcher) -}; - - void (*QAbstractDeclarativeData::destroyed)(QAbstractDeclarativeData *, QObject *) = 0; void (*QAbstractDeclarativeData::destroyed_qml1)(QAbstractDeclarativeData *, QObject *) = 0; void (*QAbstractDeclarativeData::parentChanged)(QAbstractDeclarativeData *, QObject *, QObject *) = 0; @@ -209,7 +181,7 @@ QMetaObject *QObjectData::dynamicMetaObject() const } QObjectPrivate::QObjectPrivate(int version) - : threadData(0), connectionLists(0), senders(0), currentSender(0), currentChildBeingDeleted(0) + : threadData(0), currentChildBeingDeleted(0) { #ifdef QT_BUILD_INTERNAL // Don't check the version parameter in internal builds. @@ -232,7 +204,6 @@ QObjectPrivate::QObjectPrivate(int version) receiveChildEvents = true; postedEvents = 0; extraData = 0; - connectedSignals[0] = connectedSignals[1] = 0; metaObject = 0; isWindow = false; deleteLaterCalled = false; @@ -285,59 +256,22 @@ static void computeOffsets(const QMetaObject *metaobject, int *signalOffset, int } } -/* - This vector contains the all connections from an object. - - Each object may have one vector containing the lists of - connections for a given signal. The index in the vector correspond - to the signal index. The signal index is the one returned by - QObjectPrivate::signalIndex (not QMetaObject::indexOfSignal). - Negative index means connections to all signals. - - This vector is protected by the object mutex (signalSlotMutexes()) - - Each Connection is also part of a 'senders' linked list. The mutex - of the receiver must be locked when touching the pointers of this - linked list. -*/ -class QObjectConnectionListVector : public QVector<QObjectPrivate::ConnectionList> -{ -public: - bool orphaned; //the QObject owner of this vector has been destroyed while the vector was inUse - bool dirty; //some Connection have been disconnected (their receiver is 0) but not removed from the list yet - int inUse; //number of functions that are currently accessing this object or its connections - QObjectPrivate::ConnectionList allsignals; - - QObjectConnectionListVector() - : QVector<QObjectPrivate::ConnectionList>(), orphaned(false), dirty(false), inUse(0) - { } - - QObjectPrivate::ConnectionList &operator[](int at) - { - if (at < 0) - return allsignals; - return QVector<QObjectPrivate::ConnectionList>::operator[](at); - } -}; - // Used by QAccessibleWidget bool QObjectPrivate::isSender(const QObject *receiver, const char *signal) const { Q_Q(const QObject); int signal_index = signalIndex(signal); - if (signal_index < 0) + ConnectionData *cd = connections.load(); + if (signal_index < 0 || !cd) return false; - QMutexLocker locker(signalSlotLock(q)); - if (connectionLists) { - if (signal_index < connectionLists->count()) { - const QObjectPrivate::Connection *c = - connectionLists->at(signal_index).first; - - while (c) { - if (c->receiver == receiver) - return true; - c = c->nextConnectionList; - } + QBasicMutexLocker locker(signalSlotLock(q)); + if (signal_index < cd->signalVectorCount()) { + const QObjectPrivate::Connection *c = cd->signalVector.load()->at(signal_index).first.load(); + + while (c) { + if (c->receiver.load() == receiver) + return true; + c = c->nextConnectionList.load(); } } return false; @@ -346,21 +280,19 @@ bool QObjectPrivate::isSender(const QObject *receiver, const char *signal) const // Used by QAccessibleWidget QObjectList QObjectPrivate::receiverList(const char *signal) const { - Q_Q(const QObject); QObjectList returnValue; int signal_index = signalIndex(signal); - if (signal_index < 0) + ConnectionData *cd = connections.load(); + if (signal_index < 0 || !cd) return returnValue; - QMutexLocker locker(signalSlotLock(q)); - if (connectionLists) { - if (signal_index < connectionLists->count()) { - const QObjectPrivate::Connection *c = connectionLists->at(signal_index).first; - - while (c) { - if (c->receiver) - returnValue << c->receiver; - c = c->nextConnectionList; - } + if (signal_index < cd->signalVectorCount()) { + const QObjectPrivate::Connection *c = cd->signalVector.load()->at(signal_index).first.load(); + + while (c) { + QObject *r = c->receiver.load(); + if (r) + returnValue << r; + c = c->nextConnectionList.load(); } } return returnValue; @@ -370,9 +302,12 @@ QObjectList QObjectPrivate::receiverList(const char *signal) const QObjectList QObjectPrivate::senderList() const { QObjectList returnValue; - QMutexLocker locker(signalSlotLock(q_func())); - for (Connection *c = senders; c; c = c->next) - returnValue << c->sender; + ConnectionData *cd = connections.load(); + if (cd) { + QBasicMutexLocker locker(signalSlotLock(q_func())); + for (Connection *c = cd->senders; c; c = c->next) + returnValue << c->sender; + } return returnValue; } @@ -389,79 +324,187 @@ QObjectList QObjectPrivate::senderList() const void QObjectPrivate::addConnection(int signal, Connection *c) { Q_ASSERT(c->sender == q_ptr); - if (!connectionLists) - connectionLists = new QObjectConnectionListVector(); - if (signal >= connectionLists->count()) - connectionLists->resize(signal + 1); - - ConnectionList &connectionList = (*connectionLists)[signal]; - if (connectionList.last) { - connectionList.last->nextConnectionList = c; + ensureConnectionData(); + ConnectionData *cd = connections.load(); + cd->resizeSignalVector(signal + 1); + + ConnectionList &connectionList = cd->connectionsForSignal(signal); + if (connectionList.last.load()) { + Q_ASSERT(connectionList.last.load()->receiver.load()); + connectionList.last.load()->nextConnectionList.store(c); } else { - connectionList.first = c; + connectionList.first.store(c); } - connectionList.last = c; + c->id = ++cd->currentConnectionId; + c->prevConnectionList = connectionList.last.load(); + connectionList.last.store(c); - cleanConnectionLists(); + QObjectPrivate *rd = QObjectPrivate::get(c->receiver.load()); + rd->ensureConnectionData(); - c->prev = &(QObjectPrivate::get(c->receiver)->senders); + c->prev = &(rd->connections.load()->senders); c->next = *c->prev; *c->prev = c; if (c->next) c->next->prev = &c->next; +} + +void QObjectPrivate::ConnectionData::removeConnection(QObjectPrivate::Connection *c) +{ + Q_ASSERT(c->receiver.load()); + ConnectionList &connections = signalVector.load()->at(c->signal_index); + c->receiver.store(nullptr); + QThreadData *td = c->receiverThreadData.load(); + if (td) + td->deref(); + c->receiverThreadData.store(nullptr); - if (signal < 0) { - connectedSignals[0] = connectedSignals[1] = ~0; - } else if (signal < (int)sizeof(connectedSignals) * 8) { - connectedSignals[signal >> 5] |= (1 << (signal & 0x1f)); +#ifndef QT_NO_DEBUG + bool found = false; + for (Connection *cc = connections.first.load(); cc; cc = cc->nextConnectionList.load()) { + if (cc == c) { + found = true; + break; + } } + Q_ASSERT(found); +#endif + + // remove from the senders linked list + *c->prev = c->next; + if (c->next) + c->next->prev = c->prev; + c->prev = nullptr; + + if (connections.first.load() == c) + connections.first.store(c->nextConnectionList.load()); + if (connections.last.load() == c) + connections.last.store(c->prevConnectionList); + Q_ASSERT(signalVector.load()->at(c->signal_index).first.load() != c); + Q_ASSERT(signalVector.load()->at(c->signal_index).last.load() != c); + + // keep c->nextConnectionList intact, as it might still get accessed by activate + Connection *n = c->nextConnectionList.load(); + if (n) + n->prevConnectionList = c->prevConnectionList; + if (c->prevConnectionList) + c->prevConnectionList->nextConnectionList.store(n); + c->prevConnectionList = nullptr; + + Q_ASSERT(c != orphaned.load()); + // add c to orphanedConnections + c->nextInOrphanList = orphaned.load(); + orphaned.store(c); + +#ifndef QT_NO_DEBUG + found = false; + for (Connection *cc = connections.first.load(); cc; cc = cc->nextConnectionList.load()) { + if (cc == c) { + found = true; + break; + } + } + Q_ASSERT(!found); +#endif + } -void QObjectPrivate::cleanConnectionLists() +void QObjectPrivate::ConnectionData::cleanOrphanedConnectionsImpl(QObject *sender) { - if (connectionLists->dirty && !connectionLists->inUse) { - // remove broken connections - bool allConnected = false; - for (int signal = -1; signal < connectionLists->count(); ++signal) { - QObjectPrivate::ConnectionList &connectionList = - (*connectionLists)[signal]; - - // Set to the last entry in the connection list that was *not* - // deleted. This is needed to update the list's last pointer - // at the end of the cleanup. - QObjectPrivate::Connection *last = 0; - - QObjectPrivate::Connection **prev = &connectionList.first; - QObjectPrivate::Connection *c = *prev; - bool connected = false; // whether the signal is still connected somewhere - while (c) { - if (c->receiver) { - last = c; - prev = &c->nextConnectionList; - c = *prev; - connected = true; - } else { - QObjectPrivate::Connection *next = c->nextConnectionList; - *prev = next; - c->deref(); - c = next; - } - } + ConnectionOrSignalVector *c = nullptr; + { + QBasicMutexLocker l(signalSlotLock(sender)); + if (ref > 1) + return; - // Correct the connection list's last pointer. - // As conectionList.last could equal last, this could be a noop - connectionList.last = last; + // Since ref == 1, no activate() is in process since we locked the mutex. That implies, + // that nothing can reference the orphaned connection objects anymore and they can + // be safely deleted + c = orphaned.load(); + orphaned.store(nullptr); + } + deleteOrphaned(c); +} - if (!allConnected && !connected && signal >= 0 - && size_t(signal) < sizeof(connectedSignals) * 8) { - // This signal is no longer connected - connectedSignals[signal >> 5] &= ~(1 << (signal & 0x1f)); - } else if (signal == -1) { - allConnected = connected; - } +void QObjectPrivate::ConnectionData::deleteOrphaned(QObjectPrivate::ConnectionOrSignalVector *o) +{ + while (o) { + QObjectPrivate::ConnectionOrSignalVector *next = nullptr; + if (SignalVector *v = ConnectionOrSignalVector::asSignalVector(o)) { + next = v->nextInOrphanList; + free(v); + } else { + QObjectPrivate::Connection *c = static_cast<Connection *>(o); + next = c->nextInOrphanList; + Q_ASSERT(!c->receiver.load()); + Q_ASSERT(!c->prev); + c->freeSlotObject(); + c->deref(); } - connectionLists->dirty = false; + o = next; + } +} + +/*! \internal + + Returns \c true if the signal with index \a signal_index from object \a sender is connected. + + \a signal_index must be the index returned by QObjectPrivate::signalIndex; +*/ +bool QObjectPrivate::isSignalConnected(uint signalIndex, bool checkDeclarative) const +{ + if (checkDeclarative && isDeclarativeSignalConnected(signalIndex)) + return true; + + ConnectionData *cd = connections.load(); + if (!cd) + return false; + SignalVector *signalVector = cd->signalVector.load(); + if (!signalVector) + return false; + + if (signalVector->at(-1).first.load()) + return true; + + if (signalIndex < uint(cd->signalVectorCount())) { + const QObjectPrivate::Connection *c = signalVector->at(signalIndex).first.load(); + while (c) { + if (c->receiver.load()) + return true; + c = c->nextConnectionList.load(); + } + } + return false; +} + +bool QObjectPrivate::maybeSignalConnected(uint signalIndex) const +{ + ConnectionData *cd = connections.load(); + if (!cd) + return false; + SignalVector *signalVector = cd->signalVector.load(); + if (!signalVector) + return false; + + if (signalVector->at(-1).first) + return true; + + if (signalIndex < uint(cd->signalVectorCount())) { + const QObjectPrivate::Connection *c = signalVector->at(signalIndex).first; + return c != nullptr; } + return false; +} + +/*! + \internal + */ +QAbstractMetaCallEvent::~QAbstractMetaCallEvent() +{ +#if QT_CONFIG(thread) + if (semaphore_) + semaphore_->release(); +#endif } /*! @@ -470,8 +513,8 @@ void QObjectPrivate::cleanConnectionLists() QMetaCallEvent::QMetaCallEvent(ushort method_offset, ushort method_relative, QObjectPrivate::StaticMetaCallFunction callFunction, const QObject *sender, int signalId, int nargs, int *types, void **args, QSemaphore *semaphore) - : QEvent(MetaCall), slotObj_(0), sender_(sender), signalId_(signalId), - nargs_(nargs), types_(types), args_(args), semaphore_(semaphore), + : QAbstractMetaCallEvent(sender, signalId, semaphore), + slotObj_(nullptr), nargs_(nargs), types_(types), args_(args), callFunction_(callFunction), method_offset_(method_offset), method_relative_(method_relative) { } @@ -480,9 +523,9 @@ QMetaCallEvent::QMetaCallEvent(ushort method_offset, ushort method_relative, QOb */ QMetaCallEvent::QMetaCallEvent(QtPrivate::QSlotObjectBase *slotO, const QObject *sender, int signalId, int nargs, int *types, void **args, QSemaphore *semaphore) - : QEvent(MetaCall), slotObj_(slotO), sender_(sender), signalId_(signalId), - nargs_(nargs), types_(types), args_(args), semaphore_(semaphore), - callFunction_(0), method_offset_(0), method_relative_(ushort(-1)) + : QAbstractMetaCallEvent(sender, signalId, semaphore), + slotObj_(slotO), nargs_(nargs), types_(types), args_(args), + callFunction_(nullptr), method_offset_(0), method_relative_(ushort(-1)) { if (slotObj_) slotObj_->ref(); @@ -501,10 +544,6 @@ QMetaCallEvent::~QMetaCallEvent() free(types_); free(args_); } -#if QT_CONFIG(thread) - if (semaphore_) - semaphore_->release(); -#endif if (slotObj_) slotObj_->destroyIfLastRef(); } @@ -921,92 +960,56 @@ QObject::~QObject() } } - // set ref to zero to indicate that this object has been deleted - if (d->currentSender != 0) - d->currentSender->ref = 0; - d->currentSender = 0; + QObjectPrivate::ConnectionData *cd = d->connections.load(); + if (cd) { + if (cd->currentSender) { + cd->currentSender->receiverDeleted(); + cd->currentSender = nullptr; + } - if (d->connectionLists || d->senders) { - QMutex *signalSlotMutex = signalSlotLock(this); - QMutexLocker locker(signalSlotMutex); + QBasicMutex *signalSlotMutex = signalSlotLock(this); + QBasicMutexLocker locker(signalSlotMutex); // disconnect all receivers - if (d->connectionLists) { - ++d->connectionLists->inUse; - int connectionListsCount = d->connectionLists->count(); - for (int signal = -1; signal < connectionListsCount; ++signal) { - QObjectPrivate::ConnectionList &connectionList = - (*d->connectionLists)[signal]; - - while (QObjectPrivate::Connection *c = connectionList.first) { - if (!c->receiver) { - connectionList.first = c->nextConnectionList; - c->deref(); - continue; - } + int receiverCount = cd->signalVectorCount(); + for (int signal = -1; signal < receiverCount; ++signal) { + QObjectPrivate::ConnectionList &connectionList = cd->connectionsForSignal(signal); - QMutex *m = signalSlotLock(c->receiver); - bool needToUnlock = QOrderedMutexLocker::relock(signalSlotMutex, m); + while (QObjectPrivate::Connection *c = connectionList.first.load()) { + Q_ASSERT(c->receiver); - if (c->receiver) { - *c->prev = c->next; - if (c->next) c->next->prev = c->prev; - } - c->receiver = 0; - if (needToUnlock) - m->unlock(); - - connectionList.first = c->nextConnectionList; - - // The destroy operation must happen outside the lock - if (c->isSlotObject) { - c->isSlotObject = false; - locker.unlock(); - c->slotObj->destroyIfLastRef(); - locker.relock(); - } - c->deref(); + QBasicMutex *m = signalSlotLock(c->receiver.load()); + bool needToUnlock = QOrderedMutexLocker::relock(signalSlotMutex, m); + if (c->receiver) { + cd->removeConnection(c); + Q_ASSERT(connectionList.first.load() != c); } + if (needToUnlock) + m->unlock(); } - - if (!--d->connectionLists->inUse) { - delete d->connectionLists; - } else { - d->connectionLists->orphaned = true; - } - d->connectionLists = 0; } /* Disconnect all senders: - * This loop basically just does - * for (node = d->senders; node; node = node->next) { ... } - * - * We need to temporarily unlock the receiver mutex to destroy the functors or to lock the - * sender's mutex. And when the mutex is released, node->next might be destroyed by another - * thread. That's why we set node->prev to &node, that way, if node is destroyed, node will - * be updated. */ - QObjectPrivate::Connection *node = d->senders; - while (node) { + while (QObjectPrivate::Connection *node = cd->senders) { + Q_ASSERT(node->receiver); QObject *sender = node->sender; // Send disconnectNotify before removing the connection from sender's connection list. // This ensures any eventual destructor of sender will block on getting receiver's lock // and not finish until we release it. sender->disconnectNotify(QMetaObjectPrivate::signal(sender->metaObject(), node->signal_index)); - QMutex *m = signalSlotLock(sender); - node->prev = &node; + QBasicMutex *m = signalSlotLock(sender); bool needToUnlock = QOrderedMutexLocker::relock(signalSlotMutex, m); //the node has maybe been removed while the mutex was unlocked in relock? - if (!node || node->sender != sender) { + if (node != cd->senders) { // We hold the wrong mutex Q_ASSERT(needToUnlock); m->unlock(); continue; } - node->receiver = 0; - QObjectConnectionListVector *senderLists = sender->d_func()->connectionLists; - if (senderLists) - senderLists->dirty = true; + + QObjectPrivate::ConnectionData *senderData = sender->d_func()->connections.load(); + Q_ASSERT(senderData); QtPrivate::QSlotObjectBase *slotObj = nullptr; if (node->isSlotObject) { @@ -1014,19 +1017,24 @@ QObject::~QObject() node->isSlotObject = false; } - node = node->next; + senderData->removeConnection(node); if (needToUnlock) m->unlock(); if (slotObj) { - if (node) - node->prev = &node; locker.unlock(); slotObj->destroyIfLastRef(); locker.relock(); } } + + // invalidate all connections on the object and make sure + // activate() will skip them + cd->currentConnectionId.store(0); } + if (cd && !cd->ref.deref()) + delete cd; + d->connections.store(nullptr); if (!d->children.isEmpty()) d->deleteChildren(); @@ -1253,9 +1261,13 @@ bool QObject::event(QEvent *e) case QEvent::MetaCall: { - QMetaCallEvent *mce = static_cast<QMetaCallEvent*>(e); + QAbstractMetaCallEvent *mce = static_cast<QAbstractMetaCallEvent*>(e); - QConnectionSenderSwitcher sw(this, const_cast<QObject*>(mce->sender()), mce->signalId()); + if (!d_func()->connections.load()) { + QBasicMutexLocker locker(signalSlotLock(this)); + d_func()->ensureConnectionData(); + } + QObjectPrivate::Sender sender(this, const_cast<QObject*>(mce->sender()), mce->signalId()); mce->placeMetaCall(this); break; @@ -1510,6 +1522,9 @@ void QObject::moveToThread(QThread *targetThread) if (!targetData) targetData = new QThreadData(0); + // make sure nobody adds/removes connections to this object while we're moving it + QMutexLocker l(signalSlotLock(this)); + QOrderedMutexLocker locker(¤tData->postEventList.mutex, &targetData->postEventList.mutex); @@ -1559,9 +1574,31 @@ void QObjectPrivate::setThreadData_helper(QThreadData *currentData, QThreadData } // the current emitting thread shouldn't restore currentSender after calling moveToThread() - if (currentSender) - currentSender->ref = 0; - currentSender = 0; + ConnectionData *cd = connections.load(); + if (cd) { + if (cd->currentSender) { + cd->currentSender->receiverDeleted(); + cd->currentSender = nullptr; + } + + // adjust the receiverThreadId values in the Connections + if (cd) { + auto *c = cd->senders; + while (c) { + QObject *r = c->receiver.load(); + if (r) { + Q_ASSERT(r == q); + targetData->ref(); + QThreadData *old = c->receiverThreadData.load(); + if (old) + old->deref(); + c->receiverThreadData.store(targetData); + } + c = c->next; + } + } + + } // set new thread data targetData->ref(); @@ -2370,13 +2407,14 @@ QObject *QObject::sender() const { Q_D(const QObject); - QMutexLocker locker(signalSlotLock(this)); - if (!d->currentSender) - return 0; + QBasicMutexLocker locker(signalSlotLock(this)); + QObjectPrivate::ConnectionData *cd = d->connections.load(); + if (!cd || !cd->currentSender) + return nullptr; - for (QObjectPrivate::Connection *c = d->senders; c; c = c->next) { - if (c->sender == d->currentSender->sender) - return d->currentSender->sender; + for (QObjectPrivate::Connection *c = cd->senders; c; c = c->next) { + if (c->sender == cd->currentSender->sender) + return cd->currentSender->sender; } return 0; @@ -2411,14 +2449,15 @@ int QObject::senderSignalIndex() const { Q_D(const QObject); - QMutexLocker locker(signalSlotLock(this)); - if (!d->currentSender) + QBasicMutexLocker locker(signalSlotLock(this)); + QObjectPrivate::ConnectionData *cd = d->connections.load(); + if (!cd || !cd->currentSender) return -1; - for (QObjectPrivate::Connection *c = d->senders; c; c = c->next) { - if (c->sender == d->currentSender->sender) { + for (QObjectPrivate::Connection *c = cd->senders; c; c = c->next) { + if (c->sender == cd->currentSender->sender) { // Convert from signal range to method range - return QMetaObjectPrivate::signal(c->sender->metaObject(), d->currentSender->signal).methodIndex(); + return QMetaObjectPrivate::signal(c->sender->metaObject(), cd->currentSender->signal).methodIndex(); } } @@ -2474,15 +2513,13 @@ int QObject::receivers(const char *signal) const signal_index); } - QMutexLocker locker(signalSlotLock(this)); - if (d->connectionLists) { - if (signal_index < d->connectionLists->count()) { - const QObjectPrivate::Connection *c = - d->connectionLists->at(signal_index).first; - while (c) { - receivers += c->receiver ? 1 : 0; - c = c->nextConnectionList; - } + QObjectPrivate::ConnectionData *cd = d->connections.load(); + QBasicMutexLocker locker(signalSlotLock(this)); + if (cd && signal_index < cd->signalVectorCount()) { + const QObjectPrivate::Connection *c = cd->signalVector.load()->at(signal_index).first.load(); + while (c) { + receivers += c->receiver.load() ? 1 : 0; + c = c->nextConnectionList.load(); } } } @@ -2522,22 +2559,8 @@ bool QObject::isSignalConnected(const QMetaMethod &signal) const signalIndex += QMetaObjectPrivate::signalOffset(signal.mobj); - QMutexLocker locker(signalSlotLock(this)); - if (d->connectionLists) { - if (signalIndex < sizeof(d->connectedSignals) * 8 && !d->connectionLists->dirty) - return d->isSignalConnected(signalIndex); - - if (signalIndex < uint(d->connectionLists->count())) { - const QObjectPrivate::Connection *c = - d->connectionLists->at(signalIndex).first; - while (c) { - if (c->receiver) - return true; - c = c->nextConnectionList; - } - } - } - return d->isDeclarativeSignalConnected(signalIndex); + QBasicMutexLocker locker(signalSlotLock(this)); + return d->isSignalConnected(signalIndex, true); } /*! @@ -3300,24 +3323,22 @@ QObjectPrivate::Connection *QMetaObjectPrivate::connect(const QObject *sender, int method_offset = rmeta ? rmeta->methodOffset() : 0; Q_ASSERT(!rmeta || QMetaObjectPrivate::get(rmeta)->revision >= 6); - QObjectPrivate::StaticMetaCallFunction callFunction = - rmeta ? rmeta->d.static_metacall : 0; + QObjectPrivate::StaticMetaCallFunction callFunction = rmeta ? rmeta->d.static_metacall : nullptr; QOrderedMutexLocker locker(signalSlotLock(sender), signalSlotLock(receiver)); - if (type & Qt::UniqueConnection) { - QObjectConnectionListVector *connectionLists = QObjectPrivate::get(s)->connectionLists; - if (connectionLists && connectionLists->count() > signal_index) { - const QObjectPrivate::Connection *c2 = - (*connectionLists)[signal_index].first; + QObjectPrivate::ConnectionData *scd = QObjectPrivate::get(s)->connections.load(); + if (type & Qt::UniqueConnection && scd) { + if (scd->signalVectorCount() > signal_index) { + const QObjectPrivate::Connection *c2 = scd->signalVector.load()->at(signal_index).first.load(); int method_index_absolute = method_index + method_offset; while (c2) { - if (!c2->isSlotObject && c2->receiver == receiver && c2->method() == method_index_absolute) - return 0; - c2 = c2->nextConnectionList; + if (!c2->isSlotObject && c2->receiver.load() == receiver && c2->method() == method_index_absolute) + return nullptr; + c2 = c2->nextConnectionList.load(); } } type &= Qt::UniqueConnection - 1; @@ -3326,13 +3347,15 @@ QObjectPrivate::Connection *QMetaObjectPrivate::connect(const QObject *sender, QScopedPointer<QObjectPrivate::Connection> c(new QObjectPrivate::Connection); c->sender = s; c->signal_index = signal_index; - c->receiver = r; + c->receiver.store(r); + QThreadData *td = r->d_func()->threadData; + td->ref(); + c->receiverThreadData.store(td); c->method_relative = method_index; c->method_offset = method_offset; c->connectionType = type; c->isSlotObject = false; c->argumentTypes.store(types); - c->nextConnectionList = 0; c->callFunction = callFunction; QObjectPrivate::get(s)->addConnection(signal_index, c.data()); @@ -3378,47 +3401,38 @@ bool QMetaObject::disconnectOne(const QObject *sender, int signal_index, \internal Helper function to remove the connection from the senders list and setting the receivers to 0 */ -bool QMetaObjectPrivate::disconnectHelper(QObjectPrivate::Connection *c, +bool QMetaObjectPrivate::disconnectHelper(QObjectPrivate::ConnectionData *connections, int signalIndex, const QObject *receiver, int method_index, void **slot, - QMutex *senderMutex, DisconnectType disconnectType) + QBasicMutex *senderMutex, DisconnectType disconnectType) { bool success = false; + + auto &connectionList = connections->connectionsForSignal(signalIndex); + auto *c = connectionList.first.load(); while (c) { - if (c->receiver - && (receiver == 0 || (c->receiver == receiver + QObject *r = c->receiver.load(); + if (r && (receiver == nullptr || (r == receiver && (method_index < 0 || (!c->isSlotObject && c->method() == method_index)) - && (slot == 0 || (c->isSlotObject && c->slotObj->compare(slot)))))) { + && (slot == nullptr || (c->isSlotObject && c->slotObj->compare(slot)))))) { bool needToUnlock = false; - QMutex *receiverMutex = 0; - if (c->receiver) { - receiverMutex = signalSlotLock(c->receiver); + QBasicMutex *receiverMutex = nullptr; + if (r) { + receiverMutex = signalSlotLock(r); // need to relock this receiver and sender in the correct order needToUnlock = QOrderedMutexLocker::relock(senderMutex, receiverMutex); } - if (c->receiver) { - *c->prev = c->next; - if (c->next) - c->next->prev = c->prev; - } + if (c->receiver.load()) + connections->removeConnection(c); if (needToUnlock) receiverMutex->unlock(); - c->receiver = 0; - - if (c->isSlotObject) { - c->isSlotObject = false; - senderMutex->unlock(); - c->slotObj->destroyIfLastRef(); - senderMutex->lock(); - } - success = true; if (disconnectType == DisconnectOne) return success; } - c = c->nextConnectionList; + c = c->nextConnectionList.load(); } return success; } @@ -3437,43 +3451,34 @@ bool QMetaObjectPrivate::disconnect(const QObject *sender, QObject *s = const_cast<QObject *>(sender); - QMutex *senderMutex = signalSlotLock(sender); - QMutexLocker locker(senderMutex); + QBasicMutex *senderMutex = signalSlotLock(sender); + QBasicMutexLocker locker(senderMutex); - QObjectConnectionListVector *connectionLists = QObjectPrivate::get(s)->connectionLists; - if (!connectionLists) + QObjectPrivate::ConnectionData *scd = QObjectPrivate::get(s)->connections.load(); + if (!scd) return false; - // prevent incoming connections changing the connectionLists while unlocked - ++connectionLists->inUse; - bool success = false; - if (signal_index < 0) { - // remove from all connection lists - for (int sig_index = -1; sig_index < connectionLists->count(); ++sig_index) { - QObjectPrivate::Connection *c = - (*connectionLists)[sig_index].first; - if (disconnectHelper(c, receiver, method_index, slot, senderMutex, disconnectType)) { - success = true; - connectionLists->dirty = true; + { + // prevent incoming connections changing the connections->receivers while unlocked + QObjectPrivate::ConnectionDataPointer connections(scd); + + if (signal_index < 0) { + // remove from all connection lists + for (int sig_index = -1; sig_index < scd->signalVectorCount(); ++sig_index) { + if (disconnectHelper(connections.data(), sig_index, receiver, method_index, slot, senderMutex, disconnectType)) + success = true; } - } - } else if (signal_index < connectionLists->count()) { - QObjectPrivate::Connection *c = - (*connectionLists)[signal_index].first; - if (disconnectHelper(c, receiver, method_index, slot, senderMutex, disconnectType)) { - success = true; - connectionLists->dirty = true; + } else if (signal_index < scd->signalVectorCount()) { + if (disconnectHelper(connections.data(), signal_index, receiver, method_index, slot, senderMutex, disconnectType)) + success = true; } } - --connectionLists->inUse; - Q_ASSERT(connectionLists->inUse >= 0); - if (connectionLists->orphaned && !connectionLists->inUse) - delete connectionLists; - locker.unlock(); if (success) { + scd->cleanOrphanedConnections(s); + QMetaMethod smethod = QMetaObjectPrivate::signal(smeta, signal_index); if (smethod.isValid()) s->disconnectNotify(smethod); @@ -3589,8 +3594,7 @@ void QMetaObject::connectSlotsByName(QObject *o) \a signal must be in the signal index range (see QObjectPrivate::signalIndex()). */ -static void queued_activate(QObject *sender, int signal, QObjectPrivate::Connection *c, void **argv, - QMutexLocker &locker) +static void queued_activate(QObject *sender, int signal, QObjectPrivate::Connection *c, void **argv) { const int *argumentTypes = c->argumentTypes.load(); if (!argumentTypes) { @@ -3620,134 +3624,111 @@ static void queued_activate(QObject *sender, int signal, QObjectPrivate::Connect for (int n = 1; n < nargs; ++n) types[n] = argumentTypes[n-1]; - locker.unlock(); for (int n = 1; n < nargs; ++n) args[n] = QMetaType::create(types[n], argv[n]); - locker.relock(); - - if (!c->receiver) { - locker.unlock(); - // we have been disconnected while the mutex was unlocked - for (int n = 1; n < nargs; ++n) - QMetaType::destroy(types[n], args[n]); - free(types); - free(args); - locker.relock(); - return; - } + } + + QBasicMutexLocker locker(signalSlotLock(c->receiver.load())); + if (!c->receiver.load()) { + // the connection has been disconnected before we got the lock + locker.unlock(); + for (int n = 1; n < nargs; ++n) + QMetaType::destroy(types[n], args[n]); + free(types); + free(args); + return; } QMetaCallEvent *ev = c->isSlotObject ? new QMetaCallEvent(c->slotObj, sender, signal, nargs, types, args) : new QMetaCallEvent(c->method_offset, c->method_relative, c->callFunction, sender, signal, nargs, types, args); - QCoreApplication::postEvent(c->receiver, ev); + QCoreApplication::postEvent(c->receiver.load(), ev); } -/*! - \internal - */ -void QMetaObject::activate(QObject *sender, const QMetaObject *m, int local_signal_index, - void **argv) -{ - activate(sender, QMetaObjectPrivate::signalOffset(m), local_signal_index, argv); -} - -/*! - \internal - */ -void QMetaObject::activate(QObject *sender, int signalOffset, int local_signal_index, void **argv) +template <bool callbacks_enabled> +void doActivate(QObject *sender, int signal_index, void **argv) { - int signal_index = signalOffset + local_signal_index; + QObjectPrivate *sp = QObjectPrivate::get(sender); - if (sender->d_func()->blockSig) + if (sp->blockSig) return; - if (sender->d_func()->isDeclarativeSignalConnected(signal_index) + if (sp->isDeclarativeSignalConnected(signal_index) && QAbstractDeclarativeData::signalEmitted) { Q_TRACE(QMetaObject_activate_begin_declarative_signal, sender, signal_index); - QAbstractDeclarativeData::signalEmitted(sender->d_func()->declarativeData, sender, + QAbstractDeclarativeData::signalEmitted(sp->declarativeData, sender, signal_index, argv); Q_TRACE(QMetaObject_activate_end_declarative_signal, sender, signal_index); } - if (!sender->d_func()->isSignalConnected(signal_index, /*checkDeclarative =*/ false) - && !qt_signal_spy_callback_set.signal_begin_callback - && !qt_signal_spy_callback_set.signal_end_callback - && !Q_TRACE_ENABLED(QMetaObject_activate_begin_signal) - && !Q_TRACE_ENABLED(QMetaObject_activate_end_signal)) { - // The possible declarative connection is done, and nothing else is connected, so: - return; - } + const QSignalSpyCallbackSet *signal_spy_set = callbacks_enabled ? qt_signal_spy_callback_set.load() : nullptr; void *empty_argv[] = { nullptr }; if (!argv) argv = empty_argv; - if (qt_signal_spy_callback_set.signal_begin_callback != 0) { - qt_signal_spy_callback_set.signal_begin_callback(sender, signal_index, argv); + if (!sp->maybeSignalConnected(signal_index)) { + // The possible declarative connection is done, and nothing else is connected + if (callbacks_enabled && signal_spy_set->signal_begin_callback != nullptr) + signal_spy_set->signal_begin_callback(sender, signal_index, argv); + Q_TRACE(QMetaObject_activate_begin_signal, sender, signal_index); + Q_TRACE(QMetaObject_activate_end_signal, sender, signal_index); + if (callbacks_enabled && signal_spy_set->signal_end_callback != nullptr) + signal_spy_set->signal_end_callback(sender, signal_index); + return; } + + if (callbacks_enabled && signal_spy_set->signal_begin_callback != nullptr) + signal_spy_set->signal_begin_callback(sender, signal_index, argv); Q_TRACE(QMetaObject_activate_begin_signal, sender, signal_index); + bool senderDeleted = false; { - QMutexLocker locker(signalSlotLock(sender)); - struct ConnectionListsRef { - QObjectConnectionListVector *connectionLists; - ConnectionListsRef(QObjectConnectionListVector *connectionLists) : connectionLists(connectionLists) - { - if (connectionLists) - ++connectionLists->inUse; - } - ~ConnectionListsRef() - { - if (!connectionLists) - return; - - --connectionLists->inUse; - Q_ASSERT(connectionLists->inUse >= 0); - if (connectionLists->orphaned) { - if (!connectionLists->inUse) - delete connectionLists; - } - } - - QObjectConnectionListVector *operator->() const { return connectionLists; } - }; - ConnectionListsRef connectionLists = sender->d_func()->connectionLists; - if (!connectionLists.connectionLists) { - locker.unlock(); - if (qt_signal_spy_callback_set.signal_end_callback != 0) - qt_signal_spy_callback_set.signal_end_callback(sender, signal_index); - Q_TRACE(QMetaObject_activate_end_signal, sender, signal_index); - return; - } + Q_ASSERT(sp->connections); + QObjectPrivate::ConnectionDataPointer connections(sp->connections.load()); + QObjectPrivate::SignalVector *signalVector = connections->signalVector.load(); const QObjectPrivate::ConnectionList *list; - if (signal_index < connectionLists->count()) - list = &connectionLists->at(signal_index); + if (signal_index < signalVector->count()) + list = &signalVector->at(signal_index); else - list = &connectionLists->allsignals; + list = &signalVector->at(-1); Qt::HANDLE currentThreadId = QThread::currentThreadId(); + bool inSenderThread = currentThreadId == QObjectPrivate::get(sender)->threadData->threadId.load(); + // We need to check against the highest connection id to ensure that signals added + // during the signal emission are not emitted in this emission. + uint highestConnectionId = connections->currentConnectionId.load(); do { - QObjectPrivate::Connection *c = list->first; - if (!c) continue; - // We need to check against last here to ensure that signals added - // during the signal emission are not emitted in this emission. - QObjectPrivate::Connection *last = list->last; + QObjectPrivate::Connection *c = list->first.load(); + if (!c) + continue; do { - if (!c->receiver) + QObject * const receiver = c->receiver.load(); + if (!receiver) continue; - QObject * const receiver = c->receiver; - const bool receiverInSameThread = currentThreadId == receiver->d_func()->threadData->threadId.load(); + QThreadData *td = c->receiverThreadData.load(); + if (!td) + continue; + + bool receiverInSameThread; + if (inSenderThread) { + receiverInSameThread = currentThreadId == td->threadId.load(); + } else { + // need to lock before reading the threadId, because moveToThread() could interfere + QMutexLocker lock(signalSlotLock(receiver)); + receiverInSameThread = currentThreadId == td->threadId.load(); + } + // determine if this connection should be sent immediately or // put into the event queue if ((c->connectionType == Qt::AutoConnection && !receiverInSameThread) || (c->connectionType == Qt::QueuedConnection)) { - queued_activate(sender, signal_index, c, argv, locker); + queued_activate(sender, signal_index, c, argv); continue; #if QT_CONFIG(thread) } else if (c->connectionType == Qt::BlockingQueuedConnection) { @@ -3758,89 +3739,103 @@ void QMetaObject::activate(QObject *sender, int signalOffset, int local_signal_i receiver->metaObject()->className(), receiver); } QSemaphore semaphore; - QMetaCallEvent *ev = c->isSlotObject ? - new QMetaCallEvent(c->slotObj, sender, signal_index, 0, 0, argv, &semaphore) : - new QMetaCallEvent(c->method_offset, c->method_relative, c->callFunction, sender, signal_index, 0, 0, argv, &semaphore); - QCoreApplication::postEvent(receiver, ev); - locker.unlock(); + { + QBasicMutexLocker locker(signalSlotLock(sender)); + if (!c->receiver) + continue; + QMetaCallEvent *ev = c->isSlotObject ? + new QMetaCallEvent(c->slotObj, sender, signal_index, 0, 0, argv, &semaphore) : + new QMetaCallEvent(c->method_offset, c->method_relative, c->callFunction, sender, signal_index, 0, 0, argv, &semaphore); + QCoreApplication::postEvent(receiver, ev); + } semaphore.acquire(); - locker.relock(); continue; #endif } - QConnectionSenderSwitcher sw; + QObjectPrivate::Sender senderData(receiverInSameThread ? receiver : nullptr, sender, signal_index); - if (receiverInSameThread) { - sw.switchSender(receiver, sender, signal_index); - } if (c->isSlotObject) { c->slotObj->ref(); QScopedPointer<QtPrivate::QSlotObjectBase, QSlotObjectBaseDeleter> obj(c->slotObj); - locker.unlock(); Q_TRACE(QMetaObject_activate_begin_slot_functor, obj.data()); obj->call(receiver, argv); Q_TRACE(QMetaObject_activate_end_slot_functor, obj.data()); - - // Make sure the slot object gets destroyed before the mutex is locked again, as the - // destructor of the slot object might also lock a mutex from the signalSlotLock() mutex pool, - // and that would deadlock if the pool happens to return the same mutex. - obj.reset(); - - locker.relock(); } else if (c->callFunction && c->method_offset <= receiver->metaObject()->methodOffset()) { //we compare the vtable to make sure we are not in the destructor of the object. - const int methodIndex = c->method(); const int method_relative = c->method_relative; const auto callFunction = c->callFunction; - locker.unlock(); - if (qt_signal_spy_callback_set.slot_begin_callback != 0) - qt_signal_spy_callback_set.slot_begin_callback(receiver, methodIndex, argv); + const int methodIndex = (Q_HAS_TRACEPOINTS || callbacks_enabled) ? c->method() : 0; + if (callbacks_enabled && signal_spy_set->slot_begin_callback != nullptr) + signal_spy_set->slot_begin_callback(receiver, methodIndex, argv); Q_TRACE(QMetaObject_activate_begin_slot, receiver, methodIndex); callFunction(receiver, QMetaObject::InvokeMetaMethod, method_relative, argv); Q_TRACE(QMetaObject_activate_end_slot, receiver, methodIndex); - if (qt_signal_spy_callback_set.slot_end_callback != 0) - qt_signal_spy_callback_set.slot_end_callback(receiver, methodIndex); - locker.relock(); + if (callbacks_enabled && signal_spy_set->slot_end_callback != nullptr) + signal_spy_set->slot_end_callback(receiver, methodIndex); } else { const int method = c->method_relative + c->method_offset; - locker.unlock(); - if (qt_signal_spy_callback_set.slot_begin_callback != 0) { - qt_signal_spy_callback_set.slot_begin_callback(receiver, method, argv); + if (callbacks_enabled && signal_spy_set->slot_begin_callback != nullptr) { + signal_spy_set->slot_begin_callback(receiver, method, argv); } Q_TRACE(QMetaObject_activate_begin_slot, receiver, method); - metacall(receiver, QMetaObject::InvokeMetaMethod, method, argv); + QMetaObject::metacall(receiver, QMetaObject::InvokeMetaMethod, method, argv); Q_TRACE(QMetaObject_activate_end_slot, receiver, method); - if (qt_signal_spy_callback_set.slot_end_callback != 0) - qt_signal_spy_callback_set.slot_end_callback(receiver, method); - - locker.relock(); + if (callbacks_enabled && signal_spy_set->slot_end_callback != nullptr) + signal_spy_set->slot_end_callback(receiver, method); } + } while ((c = c->nextConnectionList.load()) != nullptr && c->id <= highestConnectionId); - if (connectionLists->orphaned) - break; - } while (c != last && (c = c->nextConnectionList) != 0); - - if (connectionLists->orphaned) - break; - } while (list != &connectionLists->allsignals && + } while (list != &signalVector->at(-1) && //start over for all signals; - ((list = &connectionLists->allsignals), true)); + ((list = &signalVector->at(-1)), true)); + if (connections->currentConnectionId.load() == 0) + senderDeleted = true; } + if (!senderDeleted) + sp->connections.load()->cleanOrphanedConnections(sender); - if (qt_signal_spy_callback_set.signal_end_callback != 0) - qt_signal_spy_callback_set.signal_end_callback(sender, signal_index); + if (callbacks_enabled && signal_spy_set->signal_end_callback != nullptr) + signal_spy_set->signal_end_callback(sender, signal_index); Q_TRACE(QMetaObject_activate_end_signal, sender, signal_index); + +} + +/*! + \internal + */ +void QMetaObject::activate(QObject *sender, const QMetaObject *m, int local_signal_index, + void **argv) +{ + int signal_index = local_signal_index + QMetaObjectPrivate::signalOffset(m); + + if (Q_UNLIKELY(qt_signal_spy_callback_set.load())) + doActivate<true>(sender, signal_index, argv); + else + doActivate<false>(sender, signal_index, argv); } /*! \internal + */ +void QMetaObject::activate(QObject *sender, int signalOffset, int local_signal_index, void **argv) +{ + int signal_index = signalOffset + local_signal_index; + + if (Q_UNLIKELY(qt_signal_spy_callback_set.load())) + doActivate<true>(sender, signal_index, argv); + else + doActivate<false>(sender, signal_index, argv); + } + +/*! + \internal signal_index comes from indexOfMethod() */ void QMetaObject::activate(QObject *sender, int signal_index, void **argv) @@ -3853,7 +3848,7 @@ void QMetaObject::activate(QObject *sender, int signal_index, void **argv) /*! \internal - Returns the signal index used in the internal connectionLists vector. + Returns the signal index used in the internal connections->receivers vector. It is different from QMetaObject::indexOfSignal(): indexOfSignal is the same as indexOfMethod while QObjectPrivate::signalIndex is smaller because it doesn't give index to slots. @@ -4093,37 +4088,40 @@ void QObject::dumpObjectInfo() const objectName().isEmpty() ? "unnamed" : objectName().toLocal8Bit().data()); Q_D(const QObject); - QMutexLocker locker(signalSlotLock(this)); + QBasicMutexLocker locker(signalSlotLock(this)); // first, look for connections where this object is the sender qDebug(" SIGNALS OUT"); - if (d->connectionLists) { - for (int signal_index = 0; signal_index < d->connectionLists->count(); ++signal_index) { + QObjectPrivate::ConnectionData *cd = d->connections.load(); + if (cd && cd->signalVectorCount()) { + QObjectPrivate::SignalVector *signalVector = cd->signalVector.load(); + for (int signal_index = 0; signal_index < signalVector->count(); ++signal_index) { + const QObjectPrivate::Connection *c = signalVector->at(signal_index).first.load(); + if (!c) + continue; const QMetaMethod signal = QMetaObjectPrivate::signal(metaObject(), signal_index); qDebug(" signal: %s", signal.methodSignature().constData()); // receivers - const QObjectPrivate::Connection *c = - d->connectionLists->at(signal_index).first; while (c) { - if (!c->receiver) { + if (!c->receiver.load()) { qDebug(" <Disconnected receiver>"); - c = c->nextConnectionList; + c = c->nextConnectionList.load(); continue; } if (c->isSlotObject) { qDebug(" <functor or function pointer>"); - c = c->nextConnectionList; + c = c->nextConnectionList.load(); continue; } - const QMetaObject *receiverMetaObject = c->receiver->metaObject(); + const QMetaObject *receiverMetaObject = c->receiver.load()->metaObject(); const QMetaMethod method = receiverMetaObject->method(c->method()); qDebug(" --> %s::%s %s", receiverMetaObject->className(), - c->receiver->objectName().isEmpty() ? "unnamed" : qPrintable(c->receiver->objectName()), + c->receiver.load()->objectName().isEmpty() ? "unnamed" : qPrintable(c->receiver.load()->objectName()), method.methodSignature().constData()); - c = c->nextConnectionList; + c = c->nextConnectionList.load(); } } } else { @@ -4133,8 +4131,8 @@ void QObject::dumpObjectInfo() const // now look for connections where this object is the receiver qDebug(" SIGNALS IN"); - if (d->senders) { - for (QObjectPrivate::Connection *s = d->senders; s; s = s->next) { + if (cd && cd->senders) { + for (QObjectPrivate::Connection *s = cd->senders; s; s = s->next) { QByteArray slotName = QByteArrayLiteral("<unknown>"); if (!s->isSlotObject) { const QMetaMethod slot = metaObject()->method(s->method()); @@ -4869,18 +4867,17 @@ QMetaObject::Connection QObjectPrivate::connectImpl(const QObject *sender, int s QOrderedMutexLocker locker(signalSlotLock(sender), signalSlotLock(receiver)); - if (type & Qt::UniqueConnection && slot) { - QObjectConnectionListVector *connectionLists = QObjectPrivate::get(s)->connectionLists; - if (connectionLists && connectionLists->count() > signal_index) { - const QObjectPrivate::Connection *c2 = - (*connectionLists)[signal_index].first; + if (type & Qt::UniqueConnection && slot && QObjectPrivate::get(s)->connections.load()) { + QObjectPrivate::ConnectionData *connections = QObjectPrivate::get(s)->connections.load(); + if (connections->signalVectorCount() > signal_index) { + const QObjectPrivate::Connection *c2 = connections->signalVector.load()->at(signal_index).first.load(); while (c2) { - if (c2->receiver == receiver && c2->isSlotObject && c2->slotObj->compare(slot)) { + if (c2->receiver.load() == receiver && c2->isSlotObject && c2->slotObj->compare(slot)) { slotObj->destroyIfLastRef(); return QMetaObject::Connection(); } - c2 = c2->nextConnectionList; + c2 = c2->nextConnectionList.load(); } } type = static_cast<Qt::ConnectionType>(type ^ Qt::UniqueConnection); @@ -4889,7 +4886,10 @@ QMetaObject::Connection QObjectPrivate::connectImpl(const QObject *sender, int s QScopedPointer<QObjectPrivate::Connection> c(new QObjectPrivate::Connection); c->sender = s; c->signal_index = signal_index; - c->receiver = r; + QThreadData *td = r->d_func()->threadData; + td->ref(); + c->receiverThreadData.store(td); + c->receiver.store(r); c->slotObj = slotObj; c->connectionType = type; c->isSlotObject = true; @@ -4921,35 +4921,35 @@ bool QObject::disconnect(const QMetaObject::Connection &connection) { QObjectPrivate::Connection *c = static_cast<QObjectPrivate::Connection *>(connection.d_ptr); - if (!c || !c->receiver) + if (!c) + return false; + QObject *receiver = c->receiver.load(); + if (!receiver) return false; - QMutex *senderMutex = signalSlotLock(c->sender); - QMutex *receiverMutex = signalSlotLock(c->receiver); + QBasicMutex *senderMutex = signalSlotLock(c->sender); + QBasicMutex *receiverMutex = signalSlotLock(receiver); + QObjectPrivate::ConnectionData *connections; { QOrderedMutexLocker locker(senderMutex, receiverMutex); - QObjectConnectionListVector *connectionLists = QObjectPrivate::get(c->sender)->connectionLists; - Q_ASSERT(connectionLists); - connectionLists->dirty = true; + // load receiver once again and recheck to ensure nobody else has removed the connection in the meantime + receiver = c->receiver.load(); + if (!receiver) + return false; - *c->prev = c->next; - if (c->next) - c->next->prev = c->prev; - c->receiver = 0; + connections = QObjectPrivate::get(c->sender)->connections.load(); + Q_ASSERT(connections); + connections->removeConnection(c); } - // destroy the QSlotObject, if possible - if (c->isSlotObject) { - c->slotObj->destroyIfLastRef(); - c->isSlotObject = false; - } + connections->cleanOrphanedConnections(c->sender); c->sender->disconnectNotify(QMetaObjectPrivate::signal(c->sender->metaObject(), c->signal_index)); - const_cast<QMetaObject::Connection &>(connection).d_ptr = 0; + const_cast<QMetaObject::Connection &>(connection).d_ptr = nullptr; c->deref(); // has been removed from the QMetaObject::Connection object return true; @@ -5131,7 +5131,7 @@ bool QMetaObject::Connection::isConnected_helper() const Q_ASSERT(d_ptr); // we're only called from operator RestrictedBool() const QObjectPrivate::Connection *c = static_cast<QObjectPrivate::Connection *>(d_ptr); - return c->receiver; + return c->receiver.load(); } diff --git a/src/corelib/kernel/qobject_p.h b/src/corelib/kernel/qobject_p.h index a762e6f529..2fb11ecc64 100644 --- a/src/corelib/kernel/qobject_p.h +++ b/src/corelib/kernel/qobject_p.h @@ -1,6 +1,6 @@ /**************************************************************************** ** -** Copyright (C) 2017 The Qt Company Ltd. +** Copyright (C) 2019 The Qt Company Ltd. ** Copyright (C) 2013 Olivier Goffart <ogoffart@woboq.com> ** Contact: https://www.qt.io/licensing/ ** @@ -79,9 +79,9 @@ struct QSignalSpyCallbackSet EndCallback signal_end_callback, slot_end_callback; }; -void Q_CORE_EXPORT qt_register_signal_spy_callbacks(const QSignalSpyCallbackSet &callback_set); +void Q_CORE_EXPORT qt_register_signal_spy_callbacks(QSignalSpyCallbackSet *callback_set); -extern QSignalSpyCallbackSet Q_CORE_EXPORT qt_signal_spy_callback_set; +extern Q_CORE_EXPORT QBasicAtomicPointer<QSignalSpyCallbackSet> qt_signal_spy_callback_set; enum { QObjectPrivateVersion = QT_VERSION }; @@ -124,54 +124,199 @@ public: }; typedef void (*StaticMetaCallFunction)(QObject *, QMetaObject::Call, int, void **); - struct Connection + struct Connection; + struct SignalVector; + + struct ConnectionOrSignalVector { + union { + // linked list of orphaned connections that need cleaning up + ConnectionOrSignalVector *nextInOrphanList; + // linked list of connections connected to slots in this object + Connection *next; + }; + + static SignalVector *asSignalVector(ConnectionOrSignalVector *c) { + if (reinterpret_cast<quintptr>(c) & 1) + return reinterpret_cast<SignalVector *>(reinterpret_cast<quintptr>(c) & ~quintptr(1u)); + return nullptr; + } + static Connection *fromSignalVector(SignalVector *v) { + return reinterpret_cast<Connection *>(reinterpret_cast<quintptr>(v) | quintptr(1u)); + } + }; + + struct Connection : public ConnectionOrSignalVector { + // linked list of connections connected to slots in this object, next is in base class + Connection **prev; + // linked list of connections connected to signals in this object + QAtomicPointer<Connection> nextConnectionList; + Connection *prevConnectionList; + QObject *sender; - QObject *receiver; + QAtomicPointer<QObject> receiver; + QAtomicPointer<QThreadData> receiverThreadData; union { StaticMetaCallFunction callFunction; QtPrivate::QSlotObjectBase *slotObj; }; - // The next pointer for the singly-linked ConnectionList - Connection *nextConnectionList; - //senders linked list - Connection *next; - Connection **prev; QAtomicPointer<const int> argumentTypes; QAtomicInt ref_; + uint id = 0; ushort method_offset; ushort method_relative; - uint signal_index : 27; // In signal range (see QObjectPrivate::signalIndex()) + int signal_index : 27; // In signal range (see QObjectPrivate::signalIndex()) ushort connectionType : 3; // 0 == auto, 1 == direct, 2 == queued, 4 == blocking ushort isSlotObject : 1; ushort ownArgumentTypes : 1; - Connection() : nextConnectionList(nullptr), ref_(2), ownArgumentTypes(true) { + Connection() : ref_(2), ownArgumentTypes(true) { //ref_ is 2 for the use in the internal lists, and for the use in QMetaObject::Connection } ~Connection(); int method() const { Q_ASSERT(!isSlotObject); return method_offset + method_relative; } void ref() { ref_.ref(); } + void freeSlotObject() + { + if (isSlotObject) { + slotObj->destroyIfLastRef(); + isSlotObject = false; + } + } void deref() { if (!ref_.deref()) { - Q_ASSERT(!receiver); + Q_ASSERT(!receiver.load()); + Q_ASSERT(!isSlotObject); delete this; } } }; // ConnectionList is a singly-linked list struct ConnectionList { - ConnectionList() : first(nullptr), last(nullptr) {} - Connection *first; - Connection *last; + QAtomicPointer<Connection> first; + QAtomicPointer<Connection> last; }; struct Sender { + Sender(QObject *receiver, QObject *sender, int signal) + : receiver(receiver), sender(sender), signal(signal) + { + if (receiver) { + ConnectionData *cd = receiver->d_func()->connections.load(); + previous = cd->currentSender; + cd->currentSender = this; + } + } + ~Sender() + { + if (receiver) + receiver->d_func()->connections.load()->currentSender = previous; + } + void receiverDeleted() + { + Sender *s = this; + while (s) { + s->receiver = nullptr; + s = s->previous; + } + } + Sender *previous; + QObject *receiver; QObject *sender; int signal; - int ref; }; + struct SignalVector : public ConnectionOrSignalVector { + quintptr allocated; + // ConnectionList signals[] + ConnectionList &at(int i) + { + return reinterpret_cast<ConnectionList *>(this + 1)[i + 1]; + } + const ConnectionList &at(int i) const + { + return reinterpret_cast<const ConnectionList *>(this + 1)[i + 1]; + } + int count() { return static_cast<int>(allocated); } + }; + + + + /* + This contains the all connections from and to an object. + + The signalVector contains the lists of connections for a given signal. The index in the vector correspond + to the signal index. The signal index is the one returned by QObjectPrivate::signalIndex (not + QMetaObject::indexOfSignal). allsignals contains a list of special connections that will get invoked on + any signal emission. This is done by connecting to signal index -1. + + This vector is protected by the object mutex (signalSlotLock()) + + Each Connection is also part of a 'senders' linked list. This one contains all connections connected + to a slot in this object. The mutex of the receiver must be locked when touching the pointers of this + linked list. + */ + struct ConnectionData { + // the id below is used to avoid activating new connections. When the object gets + // deleted it's set to 0, so that signal emission stops + QAtomicInteger<uint> currentConnectionId; + QAtomicInt ref; + QAtomicPointer<SignalVector> signalVector; + Connection *senders = nullptr; + Sender *currentSender = nullptr; // object currently activating the object + QAtomicPointer<Connection> orphaned; + + ~ConnectionData() + { + deleteOrphaned(orphaned.load()); + SignalVector *v = signalVector.load(); + if (v) + free(v); + } + + // must be called on the senders connection data + // assumes the senders and receivers lock are held + void removeConnection(Connection *c); + void cleanOrphanedConnections(QObject *sender) + { + if (orphaned.load() && ref == 1) + cleanOrphanedConnectionsImpl(sender); + } + void cleanOrphanedConnectionsImpl(QObject *sender); + + ConnectionList &connectionsForSignal(int signal) + { + return signalVector.load()->at(signal); + } + + void resizeSignalVector(uint size) { + SignalVector *vector = this->signalVector.load(); + if (vector && vector->allocated > size) + return; + size = (size + 7) & ~7; + SignalVector *newVector = reinterpret_cast<SignalVector *>(malloc(sizeof(SignalVector) + (size + 1) * sizeof(ConnectionList))); + int start = -1; + if (vector) { + memcpy(newVector, vector, sizeof(SignalVector) + (vector->allocated + 1) * sizeof(ConnectionList)); + start = vector->count(); + } + for (int i = start; i < int(size); ++i) + newVector->at(i) = ConnectionList(); + newVector->next = nullptr; + newVector->allocated = size; + + signalVector.store(newVector); + if (vector) { + vector->nextInOrphanList = orphaned.load(); + orphaned.store(ConnectionOrSignalVector::fromSignalVector(vector)); + } + } + int signalVectorCount() const { + return signalVector ? signalVector.load()->count() : -1; + } + + static void deleteOrphaned(ConnectionOrSignalVector *c); + }; QObjectPrivate(int version = QObjectPrivateVersion); virtual ~QObjectPrivate(); @@ -187,13 +332,6 @@ public: QObjectList senderList() const; void addConnection(int signal, Connection *c); - void cleanConnectionLists(); - - static inline Sender *setCurrentSender(QObject *receiver, - Sender *sender); - static inline void resetCurrentSender(QObject *receiver, - Sender *currentSender, - Sender *previousSender); static QObjectPrivate *get(QObject *o) { return o->d_func(); @@ -201,7 +339,8 @@ public: static const QObjectPrivate *get(const QObject *o) { return o->d_func(); } int signalIndex(const char *signalName, const QMetaObject **meta = nullptr) const; - inline bool isSignalConnected(uint signalIdx, bool checkDeclarative = true) const; + bool isSignalConnected(uint signalIdx, bool checkDeclarative = true) const; + bool maybeSignalConnected(uint signalIndex) const; inline bool isDeclarativeSignalConnected(uint signalIdx) const; // To allow abitrary objects to call connectNotify()/disconnectNotify() without making @@ -224,15 +363,21 @@ public: const int *types, const QMetaObject *senderMetaObject); static QMetaObject::Connection connect(const QObject *sender, int signal_index, QtPrivate::QSlotObjectBase *slotObj, Qt::ConnectionType type); static bool disconnect(const QObject *sender, int signal_index, void **slot); + + void ensureConnectionData() + { + if (connections.load()) + return; + ConnectionData *cd = new ConnectionData; + cd->ref.ref(); + connections.store(cd); + } public: ExtraData *extraData; // extra data set by the user QThreadData *threadData; // id of the thread that owns the object - QObjectConnectionListVector *connectionLists; - - Connection *senders; // linked list of connections connected to this object - Sender *currentSender; // object currently activating the object - mutable quint32 connectedSignals[2]; + using ConnectionDataPointer = QExplicitlySharedDataPointer<ConnectionData>; + QAtomicPointer<ConnectionData> connections; union { QObject *currentChildBeingDeleted; // should only be used when QObjectData::isDeletingChildren is set @@ -246,47 +391,12 @@ public: Q_DECLARE_TYPEINFO(QObjectPrivate::ConnectionList, Q_MOVABLE_TYPE); -/*! \internal - - Returns \c true if the signal with index \a signal_index from object \a sender is connected. - Signals with indices above a certain range are always considered connected (see connectedSignals - in QObjectPrivate). - - \a signal_index must be the index returned by QObjectPrivate::signalIndex; -*/ -inline bool QObjectPrivate::isSignalConnected(uint signal_index, bool checkDeclarative) const -{ - return signal_index >= sizeof(connectedSignals) * 8 - || (connectedSignals[signal_index >> 5] & (1 << (signal_index & 0x1f)) - || (checkDeclarative && isDeclarativeSignalConnected(signal_index))); -} - inline bool QObjectPrivate::isDeclarativeSignalConnected(uint signal_index) const { return declarativeData && QAbstractDeclarativeData::isSignalConnected && QAbstractDeclarativeData::isSignalConnected(declarativeData, q_func(), signal_index); } -inline QObjectPrivate::Sender *QObjectPrivate::setCurrentSender(QObject *receiver, - Sender *sender) -{ - Sender *previousSender = receiver->d_func()->currentSender; - receiver->d_func()->currentSender = sender; - return previousSender; -} - -inline void QObjectPrivate::resetCurrentSender(QObject *receiver, - Sender *currentSender, - Sender *previousSender) -{ - // ref is set to zero when this object is deleted during the metacall - if (currentSender->ref == 1) - receiver->d_func()->currentSender = previousSender; - // if we've recursed, we need to tell the caller about the objects deletion - if (previousSender) - previousSender->ref = currentSender->ref; -} - inline void QObjectPrivate::connectNotify(const QMetaMethod &signal) { q_ptr->connectNotify(signal); @@ -372,7 +482,26 @@ Q_DECLARE_TYPEINFO(QObjectPrivate::Connection, Q_MOVABLE_TYPE); Q_DECLARE_TYPEINFO(QObjectPrivate::Sender, Q_MOVABLE_TYPE); class QSemaphore; -class Q_CORE_EXPORT QMetaCallEvent : public QEvent +class Q_CORE_EXPORT QAbstractMetaCallEvent : public QEvent +{ +public: + QAbstractMetaCallEvent(const QObject *sender, int signalId, QSemaphore *semaphore = nullptr) + : QEvent(MetaCall), signalId_(signalId), sender_(sender), semaphore_(semaphore) + {} + ~QAbstractMetaCallEvent(); + + virtual void placeMetaCall(QObject *object) = 0; + + inline const QObject *sender() const { return sender_; } + inline int signalId() const { return signalId_; } + +private: + int signalId_; + const QObject *sender_; + QSemaphore *semaphore_; +}; + +class Q_CORE_EXPORT QMetaCallEvent : public QAbstractMetaCallEvent { public: QMetaCallEvent(ushort method_offset, ushort method_relative, QObjectPrivate::StaticMetaCallFunction callFunction , const QObject *sender, int signalId, @@ -383,23 +512,18 @@ public: QMetaCallEvent(QtPrivate::QSlotObjectBase *slotObj, const QObject *sender, int signalId, int nargs = 0, int *types = nullptr, void **args = nullptr, QSemaphore *semaphore = nullptr); - ~QMetaCallEvent(); + ~QMetaCallEvent() override; inline int id() const { return method_offset_ + method_relative_; } - inline const QObject *sender() const { return sender_; } - inline int signalId() const { return signalId_; } inline void **args() const { return args_; } - virtual void placeMetaCall(QObject *object); + virtual void placeMetaCall(QObject *object) override; private: QtPrivate::QSlotObjectBase *slotObj_; - const QObject *sender_; - int signalId_; int nargs_; int *types_; void **args_; - QSemaphore *semaphore_; QObjectPrivate::StaticMetaCallFunction callFunction_; ushort method_offset_; ushort method_relative_; diff --git a/src/corelib/kernel/qsharedmemory_p.h b/src/corelib/kernel/qsharedmemory_p.h index 95fe0d1083..59802eb6ce 100644 --- a/src/corelib/kernel/qsharedmemory_p.h +++ b/src/corelib/kernel/qsharedmemory_p.h @@ -98,7 +98,7 @@ public: { if (q_sm && q_sm->lock()) return true; - q_sm = 0; + q_sm = nullptr; return false; } diff --git a/src/corelib/kernel/qtcore_eval.cpp b/src/corelib/kernel/qtcore_eval.cpp deleted file mode 100644 index 5437210699..0000000000 --- a/src/corelib/kernel/qtcore_eval.cpp +++ /dev/null @@ -1,560 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 The Qt Company Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the QtCore module of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - -#include <qcoreevent.h> -#include <qdatetime.h> -#include <qlibraryinfo.h> -#include <qobject.h> -#include <qcoreapplication.h> -#include <private/qcoreapplication_p.h> - -#include "stdio.h" -#include "stdlib.h" - -QT_BEGIN_NAMESPACE - -#include "qconfig_eval.cpp" - -static const char boilerplate_supported_but_time_limited[] = - "\nQt %1 Evaluation License\n" - "Copyright (C) 2016 The Qt Company Ltd.\n" - "This trial version may only be used for evaluation purposes\n" - "and will shut down after 120 minutes.\n" - "Registered to:\n" - " Licensee: %2\n\n" - "The evaluation expires in %4 days\n\n" - "Contact http://www.qt.io/contact-us for pricing and purchasing information.\n"; - -static const char boilerplate_supported[] = - "\nQt %1 Evaluation License\n" - "Copyright (C) 2016 The Qt Company Ltd.\n" - "This trial version may only be used for evaluation purposes\n" - "Registered to:\n" - " Licensee: %2\n\n" - "The evaluation expires in %4 days\n\n" - "Contact http://www.qt.io/contact-us for pricing and purchasing information.\n"; - -static const char boilerplate_expired[] = - "This software is using the trial version of the Qt GUI toolkit.\n" - "The trial period has expired. If you need more time to\n" - "evaluate Qt, or if you have any questions about Qt, contact us\n" - "at: http://www.qt.io/contact-us.\n\n"; - -static const char will_shutdown_1min[] = - "\nThe evaluation of Qt will SHUT DOWN in 1 minute.\n" - "Contact http://www.qt.io/contact-us for pricing and purchasing information.\n"; - -static const char will_shutdown_now[] = - "\nThe evaluation of Qt has now reached its automatic\n" - "timeout and will shut down.\n" - "Contact http://www.qt.io/contact-us for pricing and purchasing information.\n"; - -enum EvaluationStatus { - EvaluationNotSupported = 0, - EvaluationSupportedButTimeLimited, - EvaluationSupported -}; - -static EvaluationStatus qt_eval_is_supported() -{ - const volatile char *const license_key = qt_eval_key_data + 12; - - // fast fail - if (!qt_eval_key_data[0] || !*license_key) - return EvaluationNotSupported; - - // is this an unsupported evaluation? - const volatile char *typecode = license_key; - int field = 2; - for ( ; field && *typecode; ++typecode) - if (*typecode == '-') - --field; - - if (!field && typecode[1] == '4' && typecode[2] == 'M') { - if (typecode[0] == 'Q') - return EvaluationSupportedButTimeLimited; - else if (typecode[0] == 'R' || typecode[0] == 'Z') - return EvaluationSupported; - } - return EvaluationNotSupported; -} - -static int qt_eval_days_left() -{ - const volatile char *const expiry_date = qt_eval_expiry_date + 12; - - QDate today = QDate::currentDate(); - QDate lastday = QDate::fromString( - QString::fromLatin1(const_cast<const char*>(expiry_date)), Qt::ISODate); - return today.daysTo(lastday); -} - -static bool qt_eval_is_expired() -{ - return qt_eval_days_left() < 0; -} - -static QString qt_eval_string() -{ - const char *msg; - switch (qt_eval_is_supported()) { - case EvaluationSupportedButTimeLimited: - msg = boilerplate_supported_but_time_limited; - break; - case EvaluationSupported: - msg = boilerplate_supported; - break; - default: - return QString(); - } - - return QString::fromLatin1(msg) - .arg(QLatin1String(QT_VERSION_STR)) - .arg(QLibraryInfo::licensee()) - .arg(qt_eval_days_left()); -} - -#define WARN_TIMEOUT 60 * 1000 * 119 -#define KILL_DELAY 60 * 1000 * 1 - -class QCoreFuriCuri : public QObject -{ -public: - - int warn; - int kill; - - QCoreFuriCuri() : QObject(), warn(-1), kill(-1) - { - if (qt_eval_is_supported() == EvaluationSupportedButTimeLimited) { - warn = startTimer(WARN_TIMEOUT); - kill = 0; - } - } - - void timerEvent(QTimerEvent *e) override { - if (e->timerId() == warn) { - killTimer(warn); - fprintf(stderr, "%s\n", will_shutdown_1min); - kill = startTimer(KILL_DELAY); - } else if (e->timerId() == kill) { - fprintf(stderr, "%s\n", will_shutdown_now); - QCoreApplication::instance()->quit(); - } - } -}; - -#if defined(QT_BUILD_CORE_LIB) || defined (QT_BOOTSTRAPPED) - -void qt_core_eval_init(QCoreApplicationPrivate::Type type) -{ - if (type != QCoreApplicationPrivate::Tty) - return; - - if (!qt_eval_is_supported()) - return; - - if (qt_eval_is_expired()) { - fprintf(stderr, "%s\n", boilerplate_expired); - exit(0); - } else { - fprintf(stderr, "%s\n", qPrintable(qt_eval_string())); - Q_UNUSED(new QCoreFuriCuri()); - } -} -#endif - -#ifdef QT_BUILD_WIDGETS_LIB - -QT_BEGIN_INCLUDE_NAMESPACE -#include <qdialog.h> -#include <qlabel.h> -#include <qlayout.h> -#include <qmessagebox.h> -#if QT_CONFIG(pushbutton) -#include <qpushbutton.h> -#endif -#include <qtimer.h> -#include <qapplication.h> -QT_END_INCLUDE_NAMESPACE - - -static const char * const qtlogo_eval_xpm[] = { -/* columns rows colors chars-per-pixel */ -"46 55 174 2", -" c #002E02", -". c #00370D", -"X c #003A0E", -"o c #003710", -"O c #013C13", -"+ c #043E1A", -"@ c #084F0A", -"# c #0B520C", -"$ c #054413", -"% c #0C4C17", -"& c #07421D", -"* c #09451D", -"= c #0D491E", -"- c #125515", -"; c #13541A", -": c #17591B", -"> c #1B5C1D", -", c #1F611F", -"< c #20621E", -"1 c #337B1E", -"2 c #0B4521", -"3 c #0F4923", -"4 c #114B24", -"5 c #154D2A", -"6 c #175323", -"7 c #1C5924", -"8 c #1C532F", -"9 c #1E5432", -"0 c #245936", -"q c #265938", -"w c #295C3B", -"e c #246324", -"r c #266823", -"t c #2A6C24", -"y c #276628", -"u c #2D7026", -"i c #327427", -"p c #367927", -"a c #37782A", -"s c #397C2A", -"d c #2E613E", -"f c #336C37", -"g c #2F6040", -"h c #356545", -"j c #3C6B4E", -"k c #3F6C51", -"l c #406E4F", -"z c #406D52", -"x c #477457", -"c c #497557", -"v c #4B7857", -"b c #517B5E", -"n c #3C8423", -"m c #3E812C", -"M c #53A61D", -"N c #41862C", -"B c #458A2D", -"V c #498F2D", -"C c #479324", -"Z c #489226", -"A c #4D952C", -"S c #478B30", -"D c #488C30", -"F c #4D9232", -"G c #509632", -"H c #549A33", -"J c #589F35", -"K c #56A526", -"L c #57A821", -"P c #5BAA27", -"I c #57A32A", -"U c #5CA72E", -"Y c #5DAB2A", -"T c #5CA336", -"R c #60AD2E", -"E c #63B12D", -"W c #65AF35", -"Q c #62A53F", -"! c #65AE39", -"~ c #66B036", -"^ c #6AB437", -"/ c #67B138", -"( c #6AB339", -") c #6DB838", -"_ c #70BA3C", -"` c #4D8545", -"' c #4E8942", -"] c #548851", -"[ c #6FAF4A", -"{ c #6DB243", -"} c #71B546", -"| c #70B840", -" . c #73B648", -".. c #79BA4E", -"X. c #7CBB53", -"o. c #598266", -"O. c #62886D", -"+. c #6A8F75", -"@. c #6B9173", -"#. c #70937A", -"$. c #799F79", -"%. c #7BAF66", -"&. c #81BD5B", -"*. c #85BF60", -"=. c #85AC7F", -"-. c #8DBA7B", -";. c #87C061", -":. c #8AC364", -">. c #8DC46A", -",. c #90C56E", -"<. c #93C771", -"1. c #96CA73", -"2. c #9ACB7C", -"3. c #9FD07D", -"4. c #779981", -"5. c #7F9F89", -"6. c #809F88", -"7. c #82A18B", -"8. c #86A192", -"9. c #8DA994", -"0. c #8FA998", -"q. c #94AF9B", -"w. c #97B991", -"e. c #97B19E", -"r. c #9DB6A3", -"t. c #A3BCA7", -"y. c #A6BCAB", -"u. c #A9BEB1", -"i. c #9ECD81", -"p. c #A2CF85", -"a. c #A5D284", -"s. c #A6D189", -"d. c #A9D28E", -"f. c #ABD491", -"g. c #B1D797", -"h. c #B1D699", -"j. c #B5D89E", -"k. c #ADC5AC", -"l. c #B1CAAE", -"z. c #B9DAA3", -"x. c #BDDDA8", -"c. c #ADC1B4", -"v. c #B2C6B6", -"b. c #B5C6BC", -"n. c #B6C9BA", -"m. c #BCD1BA", -"M. c #C6E1B4", -"N. c #CDE5BD", -"B. c #C2D2C6", -"V. c #CADEC2", -"C. c #C6D3CC", -"Z. c #C8D7CB", -"A. c #CEDAD2", -"S. c #D2DDD4", -"D. c #D3E9C6", -"F. c #D7EBC9", -"G. c #D9EBCD", -"H. c #DEEED4", -"J. c #D6E0D9", -"K. c #DAE4DC", -"L. c #E0EFD7", -"P. c #E5F2DD", -"I. c #DFE8E0", -"U. c #E4EBE5", -"Y. c #E9EFEA", -"T. c #EDF4EB", -"R. c #F0FAE6", -"E. c #F1F8EC", -"W. c #EDF0F0", -"Q. c #F4F7F3", -"!. c #F6F9F4", -"~. c #F8FAF7", -"^. c #FEFEFE", -"/. c None", -/* pixels */ -"/././././.c h ' Q / W _ &.p././././././././././././././././././././././././././././././././.", -"/././.4 O % Z ~ ~ W ~ W R U R R ( X.>.p././././././././././././././././././././././././././.", -"/./.. * = J _ ~ ~ ~ ~ ~ / / / / W W U P P U W .;.2././././././././././././././././././././.", -"/.= = & a ) W ~ ~ ~ ~ ~ / W / ~ ~ ~ ^ ( ( ^ ~ R R U P Y ~ .;.2././././././././././././././.", -"O.O = = T ^ W ~ ~ ~ ~ ~ ~ W W / W ~ ~ ~ ~ ~ ~ ~ ( ( ( ( ~ W Y Y Y Y W { &.1././././././././.", -"0 = * 7 ~ ~ ~ ~ ~ ~ ~ ~ ~ / / W ~ ~ ~ ~ ~ ~ ~ ~ W W W ~ ~ ~ ~ ( ( ( W W R U P U W { X.1.f./.", -"= = & e ^ W ~ ~ ~ ~ ~ ~ ~ ~ / / ~ ~ ~ ~ ~ ~ ~ ~ W ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ^ ( ( / ~ W R U U Y ", -"= = & e ^ W ~ ~ ~ ~ ~ ~ ~ ~ W W ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ W ( W ~ ~ ~ ^ ^ ( ", -"= = * e ^ W ~ ~ ~ ~ ~ ~ / W / W ! ( / ~ W ^ ( ( ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ W ~ W W ~ ~ ~ ~ ~ ~ ", -"= = & e ^ ! ~ ~ ~ ~ ~ ~ W W ^ _ ~ K Y W W R P Y W ( ~ ~ ~ ~ ~ ~ ~ W / ~ ~ ~ ^ W ~ ~ ~ ~ ~ ~ ", -"= = & e ^ W ~ ~ ~ ~ ~ ~ W ) W 1 ` w.V.L.H.D.z.,.~ Y ^ ~ ~ ~ ~ ~ W ~ ~ ~ ( ~ W W ~ ~ ~ ~ ~ ~ ", -"= = & e ^ W ~ ~ ~ ~ ~ W ) V = 8.~.^.^.^.^.^.^.^.U.<.Y ~ ~ ~ ~ ~ W W ! ~ Y W ^ W ~ ~ ~ ~ ~ ~ ", -"= = & e ^ W ~ ~ ~ ~ W ^ B O u.^.~.^.^.^.^.~.~.^.^.^.h.Y ^ ~ ~ ^ F $ k.R.G.1.Y / ~ ~ ~ ~ ~ ~ ", -"= = & e ^ ~ ~ ~ / W ( J X 7.^.~.^.^.^.^.^.^.^.^.^.^.^.s.Y / W ) a 2 U.^.^.d.U ( ~ ~ ~ ~ ~ ~ ", -"= = & e ^ W / ~ ~ ~ ^ > w ~.^.^.^.^.^.F.%.v c.^.^.^.^.~.X.W ~ ^ > h ^.^.^.d.P ( ~ ~ ~ ~ ~ ~ ", -"= = & e ^ W ~ ~ W ^ H o e.^.^.^.^.^.G.Y E n . y.^.^.^.^.M.Y ( ! $ @.^.~.^.f.U ( / ~ ~ W ~ ~ ", -"= = & e ^ W ~ W ! ) t 4 U.^.^.^.^.^.>.U ( _ , 9 ~.^.^.^.~...^ A y.^.~.^.s.M W Y ~ ~ ~ ~ ~ ", -"= 3 & e ^ W ~ ( ^ ( $ c ^.^.^.^.^.E.) ~ ~ ^ S o n.^.^.^.^.=.- l.v.Y.^.^.^.M.:.:.X.~ ~ ~ ~ ~ ", -"= = & e ^ ! W W ( J X 7.^.^.^.^.^.F.Y ( W ^ T X 6.^.^.~.^.c.. J.^.^.^.^.^.^.^.^.P.~ ~ ~ ~ ~ ", -"= = & r ^ W / W ) B o v.^.~.^.^.^.M.U / ~ ~ ! $ o.^.^.^.^.K.* S.^.^.^.^.^.^.^.^.P.~ ~ ~ ~ ~ ", -"= = & e ^ ! ~ W ) a + S.^.^.^.^.^.z.P ( W ~ ( % z ^.^.^.^.~.f t.U.^.^.^.^.~.^.^.P.~ ~ ~ ~ ~ ", -"* = & e ^ W ~ W ) t 3 Y.^.^.^.^.^.f.P ( ~ ~ ^ ; h ^.^.^.^.^.:.@ j ^.^.^.^.h.{ X.&.~ ~ ~ ~ ~ ", -"3 = & e ^ W ~ ~ ^ e 8 Q.^.^.^.^.^.s.P ~ ~ W ^ > 0 ~.^.^.^.^.1.# z ^.^.^.^.d.L W R ~ ~ ~ ~ ~ ", -"= = & e ^ W ~ ~ ^ > q ~.^.^.^.^.^.p.U ^ ~ W ) e 9 ~.^.^.^.^.3.# k ^.^.^.^.f.Y ( / ~ ~ ~ ~ ~ ", -"= = & e ^ W / W ^ > w ~.^.^.^.^.^.i.Y / ~ W ^ e 8 Q.^.^.^.^.a.# z ^.^.^.^.f.Y / ~ ~ ~ ~ ~ ~ ", -"= = & e ^ W / W ^ > w ^.^.^.^.^.^.2.Y / ~ ~ ) e 8 Q.^.^.^.^.s.# z ^.^.^.^.d.P ( ~ ~ ~ ~ ~ ~ ", -"= = & e ^ W W W ^ > q ^.^.^.^.^.^.p.Y / ~ ~ ^ e 9 Q.^.^.^.^.a.@ z ^.^.^.^.f.U / ~ ~ ~ ~ ~ ~ ", -"= = & e ^ W / W ) 7 9 Q.^.^.^.^.^.a.P / ~ W ) , 9 Q.^.^.^.^.3.# z ^.^.~.^.f.P ^ ~ ~ ~ ~ ~ ~ ", -"= = & e ^ W / W ) r 5 T.^.^.^.^.^.d.Y / ~ W ) > q ~.^.^.^.^.1.# k ^.^.^.^.f.Y ( ~ ~ ~ ~ ~ ~ ", -"= = & e ^ / / W ) i 2 I.^.^.^.^.^.h.P ( ~ W ( > g ^.^.^.^.^.:.# z ^.^.^.^.f.P / ~ ~ ~ ~ ~ ~ ", -"= = & e ( W / W ) m O Z.^.^.^.^.^.x.P / ~ ~ ( ; j ^.^.^.^.~.&.- k ^.^.~.^.f.P / ~ ~ ~ ~ ~ ~ ", -"= = & e ( W / W ) F o y.^.~.^.^.^.N.U ( ~ ~ W $ b ^.^.^.^.R._ - k ^.^.^.^.f.Y ( ~ ~ ~ ~ ~ ~ ", -"= = & e ^ W ~ ~ ^ J X 4.^.^.^.^.^.L.~ ~ W ^ T X #.^.^.^.^.F.~ ; j ^.^.^.^.f.U ( ~ ~ ~ ~ ~ ~ ", -"= = & e ^ ~ ~ ~ / ^ % l ^.^.^.^.^.!. .R ^ ^ G . r.^.~.^.^.j.E : j ^.^.^.^.f.P ) ( ~ ~ ~ ~ ~ ", -"= = & e ^ W ~ ~ W ) u = U.^.^.^.^.^.1.Y ! ) a & K.^.^.^.^.;.~ : j ^.^.~.^.z.M I I / ~ ~ W ~ ", -"= = & e ( W ~ ~ W ( G . q.^.^.^.^.^.D.U ^ ! X o.^.^.^.^.P.~ ^ > g ^.^.^.^.E.-.$.m.X.W ~ ~ ~ ", -"= = & e ^ / ~ ~ ^ ! ( > w ~.^.^.^.^.^.h.T > j T.^.^.~.^.a.Y _ i 3 U.^.^.^.^.^.^.^.X.R ~ ~ ~ ", -"= = & e ^ / ~ ~ W W ^ H . 9.^.~.^.^.^.^.K.C.~.^.^.^.^.H.W W ^ T . q.^.~.^.^.^.^.^.X.R ~ ~ ~ ", -"= = + e ^ W / ~ W W W ) m + B.^.~.^.^.^.^.^.^.^.^.^.E.X.Y ( W ^ B 6 y.^.^.^.E.D.2.( ~ ~ ~ ~ ", -"= = * e ^ ! / ! W ^ W W ) a 4 b.^.^.^.^.^.^.^.^.^.P...Y ( ! W ! ^ W Z [ *.X.{ Y U ~ ~ ~ ~ ~ ", -"= = & e ( W ~ ~ W / W / W ) A < +.A.~.^.^.^.^.!.p.W R ~ ~ ~ ~ ~ W / ) E U W W / ^ ~ ~ ~ ~ ~ ", -"= = & e ^ W ~ ~ / W / / / W ( _ Z X 6.^.^.^.^.E.W ~ ^ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ / ~ ~ ~ ~ ~ ~ ~ ~ ", -"= = & e ^ ~ ~ ~ W W / W ~ ~ ~ ~ ) ; h ^.^.^.^.^.d.M U ~ / ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ W ", -"= = & e ^ W ~ ~ ^ W W / ~ ~ ~ W ) p + S.^.^.^.^.~.M.f. .W ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ .", -"= = & e ^ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ W ( T O +.^.~.^.^.^.^.^.&.Y ( ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ W ( Y 2.", -"= = & e ( W ~ ~ ~ ~ ~ ~ ~ ~ ~ / W ) N + b.^.^.^.^.^.^.&.R ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ W /.", -"= = & e ^ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ W ^ N 7 r.W.^.^.^.!.X.W ~ ~ W ~ W ~ ~ ~ ~ ~ ~ / ( ( K p./.", -"= = & e ( W ~ ~ W ~ ~ ~ ~ ~ ~ ~ ~ ~ W ( W C Q &.:.X.| ~ ~ ~ ~ W ~ / ~ ( / ( ~ W E U P 1././.", -"= = + e ^ / / / ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ W / ) ^ R Y W W ~ ~ ( / ( / W R Y Y U R ( X.,././././.", -"= = * e ( / ~ / ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ W W W ! ( ( ( W W E U P Y W ( X.,.d./././././././././.", -"= = * e ( W ~ ~ ~ ~ W ! ~ W ~ W ~ ( ( / ^ W W U Y P W ( X.,.d./././././././././././././././.", -"8 $ * e ( W ~ ~ ~ ! ( ( ( / ( W R Y Y Y R ( X.>.d./././././././././././././././././././././.", -"/.d . y ^ / / / ( W Y Y P P W ( X.>.d./././././././././././././././././././././././././././.", -"/./.h : ^ R R R W ( X.<.f./././././././././././././././././././././././././././././././././.", -"/././.] _ *.3./././././././././././././././././././././././././././././././././././././././." -}; - -class EvalMessageBox : public QDialog -{ -public: - EvalMessageBox(bool expired) - { - setWindowTitle(QLatin1String(" ")); - - QString str = expired ? QLatin1String(boilerplate_expired) : qt_eval_string(); - str = str.trimmed(); - - QFrame *border = new QFrame(this); - - QLabel *pixmap_label = new QLabel(border); - pixmap_label->setPixmap(QPixmap(qtlogo_eval_xpm)); - pixmap_label->setAlignment(Qt::AlignTop); - - QLabel *text_label = new QLabel(str, border); - - QHBoxLayout *pm_and_text_layout = new QHBoxLayout(); - pm_and_text_layout->addWidget(pixmap_label); - pm_and_text_layout->addWidget(text_label); - - QVBoxLayout *master_layout = new QVBoxLayout(border); - master_layout->addLayout(pm_and_text_layout); - - QVBoxLayout *border_layout = new QVBoxLayout(this); - border_layout->setMargin(0); - border_layout->addWidget(border); - - if (expired) { - QPushButton *cmd = new QPushButton(QLatin1String("OK"), border); - cmd->setSizePolicy(QSizePolicy::Fixed, QSizePolicy::Fixed); - cmd->setDefault(true); - - QHBoxLayout *button_layout = new QHBoxLayout(); - master_layout->addLayout(button_layout); - button_layout->addWidget(cmd); - - connect(cmd, SIGNAL(clicked()), this, SLOT(close())); - } else { - border->setFrameShape(QFrame::WinPanel); - border->setFrameShadow(QFrame::Raised); - setParent(parentWidget(), Qt::FramelessWindowHint | Qt::WindowStaysOnTopHint); - QTimer::singleShot(7000, this, SLOT(close())); - setAttribute(Qt::WA_DeleteOnClose); - setAttribute(Qt::WA_QuitOnClose, false); - } - - setFixedSize(sizeHint()); - } -}; - -class QGuiFuriCuri : public QCoreFuriCuri -{ -public: - void timerEvent(QTimerEvent *e) { - if (e->timerId() == warn) { - killTimer(warn); - QMessageBox::information(0, QLatin1String("Automatic Timeout"), QLatin1String(will_shutdown_1min)); - kill = startTimer(KILL_DELAY); - } else if (e->timerId() == kill) { - killTimer(kill); - QMessageBox::information(0, QLatin1String("Automatic Timeout"), QLatin1String(will_shutdown_now)); - qApp->quit(); - } - } -}; - - -void qt_gui_eval_init(QCoreApplicationPrivate::Type type) -{ - Q_UNUSED(type); - - if (!qt_eval_is_supported()) - return; - - if (qt_eval_is_expired()) { - EvalMessageBox box(true); - box.exec(); - ::exit(0); - } else { - Q_UNUSED(new QGuiFuriCuri()); - } -} - -static QString qt_eval_title_prefix() -{ - return QLatin1String("[Qt Evaluation] "); -} - -QString qt_eval_adapt_window_title(const QString &title) -{ - if (!qt_eval_is_supported()) - return title; - return qt_eval_title_prefix() + title; -} - -void qt_eval_init_widget(QWidget *w) -{ - if (!qt_eval_is_supported()) - return; - if (w->isTopLevel() && w->windowTitle().isEmpty() && w->windowType() != Qt::Desktop ) { - w->setWindowTitle(QLatin1String(" ")); - } -} -#endif - -QT_END_NAMESPACE diff --git a/src/corelib/kernel/qvariant.cpp b/src/corelib/kernel/qvariant.cpp index 18c7f7648d..77d2c8cbe1 100644 --- a/src/corelib/kernel/qvariant.cpp +++ b/src/corelib/kernel/qvariant.cpp @@ -1,6 +1,6 @@ /**************************************************************************** ** -** Copyright (C) 2016 The Qt Company Ltd. +** Copyright (C) 2019 The Qt Company Ltd. ** Copyright (C) 2018 Intel Corporation. ** Copyright (C) 2015 Olivier Goffart <ogoffart@woboq.com> ** Contact: https://www.qt.io/licensing/ @@ -1462,6 +1462,7 @@ static void customConstruct(QVariant::Private *d, const void *copy) if (size <= sizeof(QVariant::Private::Data) && (type.flags() & (QMetaType::MovableType | QMetaType::IsEnumeration))) { type.construct(&d->data.ptr, copy); + d->is_null = d->data.ptr == nullptr; d->is_shared = false; } else { // Private::Data contains long long, and long double is the biggest standard type. @@ -1472,6 +1473,7 @@ static void customConstruct(QVariant::Private *d, const void *copy) void *data = operator new(offset + size); void *ptr = static_cast<char *>(data) + offset; type.construct(ptr, copy); + d->is_null = ptr == nullptr; d->is_shared = true; d->data.shared = new (data) QVariant::PrivateShared(ptr); } @@ -4002,8 +4004,8 @@ static int numericCompare(const QVariant::Private *d1, const QVariant::Private * return 0; // only do fuzzy comparisons for finite, non-zero numbers - int c1 = std::fpclassify(r1); - int c2 = std::fpclassify(r2); + int c1 = qFpClassify(r1); + int c2 = qFpClassify(r2); if ((c1 == FP_NORMAL || c1 == FP_SUBNORMAL) && (c2 == FP_NORMAL || c2 == FP_SUBNORMAL)) { if (qFuzzyCompare(r1, r2)) return 0; diff --git a/src/corelib/kernel/qvariant_p.h b/src/corelib/kernel/qvariant_p.h index b22b7c231e..3d87beac83 100644 --- a/src/corelib/kernel/qvariant_p.h +++ b/src/corelib/kernel/qvariant_p.h @@ -88,7 +88,7 @@ inline T *v_cast(const QVariant::Private *nd, T * = 0) #else // every other compiler in this world template <typename T> -inline const T *v_cast(const QVariant::Private *d, T * = 0) +inline const T *v_cast(const QVariant::Private *d, T * = nullptr) { return !QVariantIntegrator<T>::CanUseInternalSpace ? static_cast<const T *>(d->data.shared->ptr) @@ -96,7 +96,7 @@ inline const T *v_cast(const QVariant::Private *d, T * = 0) } template <typename T> -inline T *v_cast(QVariant::Private *d, T * = 0) +inline T *v_cast(QVariant::Private *d, T * = nullptr) { return !QVariantIntegrator<T>::CanUseInternalSpace ? static_cast<T *>(d->data.shared->ptr) @@ -154,7 +154,7 @@ inline void v_construct(QVariant::Private *x, const T &t) // constructs a new variant if copy is 0, otherwise copy-constructs template <class T> -inline void v_construct(QVariant::Private *x, const void *copy, T * = 0) +inline void v_construct(QVariant::Private *x, const void *copy, T * = nullptr) { if (copy) v_construct<T>(x, *static_cast<const T *>(copy)); @@ -164,7 +164,7 @@ inline void v_construct(QVariant::Private *x, const void *copy, T * = 0) // deletes the internal structures template <class T> -inline void v_clear(QVariant::Private *d, T* = 0) +inline void v_clear(QVariant::Private *d, T* = nullptr) { if (!QVariantIntegrator<T>::CanUseInternalSpace) { @@ -264,7 +264,7 @@ class QVariantIsNull struct No { char unused[2]; }; Q_STATIC_ASSERT(sizeof(Yes) != sizeof(No)); - template<class C> static decltype(static_cast<const C*>(0)->isNull(), Yes()) test(int); + template<class C> static decltype(static_cast<const C*>(nullptr)->isNull(), Yes()) test(int); template<class C> static No test(...); public: static const bool Value = (sizeof(test<T>(0)) == sizeof(Yes)); diff --git a/src/corelib/mimetypes/qmimeprovider.cpp b/src/corelib/mimetypes/qmimeprovider.cpp index 37c8e3b157..7e2696b719 100644 --- a/src/corelib/mimetypes/qmimeprovider.cpp +++ b/src/corelib/mimetypes/qmimeprovider.cpp @@ -460,6 +460,7 @@ void QMimeBinaryProvider::addAllMimeTypes(QList<QMimeType> &result) void QMimeBinaryProvider::loadMimeTypePrivate(QMimeTypePrivate &data) { #ifdef QT_NO_XMLSTREAMREADER + Q_UNUSED(data); qWarning("Cannot load mime type since QXmlStreamReader is not available."); return; #else diff --git a/src/corelib/mimetypes/qmimetypeparser.cpp b/src/corelib/mimetypes/qmimetypeparser.cpp index d10575cfe9..815e0aa03b 100644 --- a/src/corelib/mimetypes/qmimetypeparser.cpp +++ b/src/corelib/mimetypes/qmimetypeparser.cpp @@ -194,8 +194,9 @@ static CreateMagicMatchRuleResult createMagicMatchRule(const QXmlStreamAttribute bool QMimeTypeParserBase::parse(QIODevice *dev, const QString &fileName, QString *errorMessage) { #ifdef QT_NO_XMLSTREAMREADER + Q_UNUSED(dev); if (errorMessage) - *errorMessage = QString::fromLatin1("QXmlStreamReader is not available, cannot parse."); + *errorMessage = QString::fromLatin1("QXmlStreamReader is not available, cannot parse '%1'.").arg(fileName); return false; #else QMimeTypePrivate data; diff --git a/src/corelib/plugin/qlibrary_p.h b/src/corelib/plugin/qlibrary_p.h index 3f650501c8..1a216c98b5 100644 --- a/src/corelib/plugin/qlibrary_p.h +++ b/src/corelib/plugin/qlibrary_p.h @@ -96,7 +96,7 @@ public: void setLoadHints(QLibrary::LoadHints lh); static QLibraryPrivate *findOrCreate(const QString &fileName, const QString &version = QString(), - QLibrary::LoadHints loadHints = 0); + QLibrary::LoadHints loadHints = nullptr); static QStringList suffixes_sys(const QString &fullVersion); static QStringList prefixes_sys(); diff --git a/src/corelib/serialization/qdatastream.cpp b/src/corelib/serialization/qdatastream.cpp index ead6ed5083..3ea518907b 100644 --- a/src/corelib/serialization/qdatastream.cpp +++ b/src/corelib/serialization/qdatastream.cpp @@ -561,6 +561,7 @@ void QDataStream::setByteOrder(ByteOrder bo) \value Qt_5_11 Same as Qt_5_6 \value Qt_5_12 Version 18 (Qt 5.12) \value Qt_5_13 Version 19 (Qt 5.13) + \value Qt_5_14 Same as Qt_5_13 \omitvalue Qt_DefaultCompiledVersion \sa setVersion(), version() diff --git a/src/corelib/serialization/qdatastream.h b/src/corelib/serialization/qdatastream.h index 81134f74b0..6e358df02e 100644 --- a/src/corelib/serialization/qdatastream.h +++ b/src/corelib/serialization/qdatastream.h @@ -100,10 +100,11 @@ public: Qt_5_11 = Qt_5_10, Qt_5_12 = 18, Qt_5_13 = 19, -#if QT_VERSION >= 0x050e00 + Qt_5_14 = Qt_5_13, +#if QT_VERSION >= 0x050f00 #error Add the datastream version for this Qt version and update Qt_DefaultCompiledVersion #endif - Qt_DefaultCompiledVersion = Qt_5_13 + Qt_DefaultCompiledVersion = Qt_5_14 }; enum ByteOrder { diff --git a/src/corelib/serialization/qjson_p.h b/src/corelib/serialization/qjson_p.h index 40b2414e4a..a9e7059cbe 100644 --- a/src/corelib/serialization/qjson_p.h +++ b/src/corelib/serialization/qjson_p.h @@ -686,7 +686,7 @@ public: { } inline Data(int reserved, QJsonValue::Type valueType) - : rawData(0), compactionCounter(0), ownsData(true) + : rawData(nullptr), compactionCounter(0), ownsData(true) { Q_ASSERT(valueType == QJsonValue::Array || valueType == QJsonValue::Object); @@ -728,7 +728,7 @@ public: size = qMax(size + reserve, qMin(size *2, (int)Value::MaxSize)); if (size > Value::MaxSize) { qWarning("QJson: Document too large to store in data structure"); - return 0; + return nullptr; } } char *raw = (char *)malloc(size); diff --git a/src/corelib/serialization/qtextstream.cpp b/src/corelib/serialization/qtextstream.cpp index c9ba183a50..0d83bb6cd4 100644 --- a/src/corelib/serialization/qtextstream.cpp +++ b/src/corelib/serialization/qtextstream.cpp @@ -135,30 +135,30 @@ static const int QTEXTSTREAM_BUFFERSIZE = 16384; \table \header \li Manipulator \li Description - \row \li \c bin \li Same as setIntegerBase(2). - \row \li \c oct \li Same as setIntegerBase(8). - \row \li \c dec \li Same as setIntegerBase(10). - \row \li \c hex \li Same as setIntegerBase(16). - \row \li \c showbase \li Same as setNumberFlags(numberFlags() | ShowBase). - \row \li \c forcesign \li Same as setNumberFlags(numberFlags() | ForceSign). - \row \li \c forcepoint \li Same as setNumberFlags(numberFlags() | ForcePoint). - \row \li \c noshowbase \li Same as setNumberFlags(numberFlags() & ~ShowBase). - \row \li \c noforcesign \li Same as setNumberFlags(numberFlags() & ~ForceSign). - \row \li \c noforcepoint \li Same as setNumberFlags(numberFlags() & ~ForcePoint). - \row \li \c uppercasebase \li Same as setNumberFlags(numberFlags() | UppercaseBase). - \row \li \c uppercasedigits \li Same as setNumberFlags(numberFlags() | UppercaseDigits). - \row \li \c lowercasebase \li Same as setNumberFlags(numberFlags() & ~UppercaseBase). - \row \li \c lowercasedigits \li Same as setNumberFlags(numberFlags() & ~UppercaseDigits). - \row \li \c fixed \li Same as setRealNumberNotation(FixedNotation). - \row \li \c scientific \li Same as setRealNumberNotation(ScientificNotation). - \row \li \c left \li Same as setFieldAlignment(AlignLeft). - \row \li \c right \li Same as setFieldAlignment(AlignRight). - \row \li \c center \li Same as setFieldAlignment(AlignCenter). - \row \li \c endl \li Same as operator<<('\\n') and flush(). - \row \li \c flush \li Same as flush(). - \row \li \c reset \li Same as reset(). - \row \li \c ws \li Same as skipWhiteSpace(). - \row \li \c bom \li Same as setGenerateByteOrderMark(true). + \row \li \c Qt::bin \li Same as setIntegerBase(2). + \row \li \c Qt::oct \li Same as setIntegerBase(8). + \row \li \c Qt::dec \li Same as setIntegerBase(10). + \row \li \c Qt::hex \li Same as setIntegerBase(16). + \row \li \c Qt::showbase \li Same as setNumberFlags(numberFlags() | ShowBase). + \row \li \c Qt::forcesign \li Same as setNumberFlags(numberFlags() | ForceSign). + \row \li \c Qt::forcepoint \li Same as setNumberFlags(numberFlags() | ForcePoint). + \row \li \c Qt::noshowbase \li Same as setNumberFlags(numberFlags() & ~ShowBase). + \row \li \c Qt::noforcesign \li Same as setNumberFlags(numberFlags() & ~ForceSign). + \row \li \c Qt::noforcepoint \li Same as setNumberFlags(numberFlags() & ~ForcePoint). + \row \li \c Qt::uppercasebase \li Same as setNumberFlags(numberFlags() | UppercaseBase). + \row \li \c Qt::uppercasedigits \li Same as setNumberFlags(numberFlags() | UppercaseDigits). + \row \li \c Qt::lowercasebase \li Same as setNumberFlags(numberFlags() & ~UppercaseBase). + \row \li \c Qt::lowercasedigits \li Same as setNumberFlags(numberFlags() & ~UppercaseDigits). + \row \li \c Qt::fixed \li Same as setRealNumberNotation(FixedNotation). + \row \li \c Qt::scientific \li Same as setRealNumberNotation(ScientificNotation). + \row \li \c Qt::left \li Same as setFieldAlignment(AlignLeft). + \row \li \c Qt::right \li Same as setFieldAlignment(AlignRight). + \row \li \c Qt::center \li Same as setFieldAlignment(AlignCenter). + \row \li \c Qt::endl \li Same as operator<<('\\n') and flush(). + \row \li \c Qt::flush \li Same as flush(). + \row \li \c Qt::reset \li Same as reset(). + \row \li \c Qt::ws \li Same as skipWhiteSpace(). + \row \li \c Qt::bom \li Same as setGenerateByteOrderMark(true). \endtable In addition, Qt provides three global manipulators that take a @@ -2689,6 +2689,11 @@ QTextStream &QTextStream::operator<<(const void *ptr) d->params.numberFlags = oldFlags; return *this; } +#if defined(Q_QDOC) || QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +namespace Qt { +#else +namespace QTextStreamFunctions { +#endif /*! \relates QTextStream @@ -3015,6 +3020,8 @@ QTextStream &ws(QTextStream &stream) return stream; } +} // namespace QTextStreamFunctions + /*! \fn QTextStreamManipulator qSetFieldWidth(int width) \relates QTextStream @@ -3037,6 +3044,12 @@ QTextStream &ws(QTextStream &stream) */ #if QT_CONFIG(textcodec) + +#if defined(Q_QDOC) || QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +namespace Qt { +#else +namespace QTextStreamFunctions { +#endif /*! \relates QTextStream @@ -3051,6 +3064,8 @@ QTextStream &bom(QTextStream &stream) return stream; } +} // namespace QTextStreamFunctions + /*! Sets the codec for this stream to \a codec. The codec is used for decoding any data that is read from the assigned device, and for @@ -3200,6 +3215,43 @@ QLocale QTextStream::locale() const return d->locale; } +#if QT_VERSION < QT_VERSION_CHECK(6, 0, 0) && !defined(Q_QDOC) +// Binary compatible definitions for Qt<5.14 +Q_CORE_EXPORT QTextStream &bin(QTextStream &s) { return Qt::bin(s); } +Q_CORE_EXPORT QTextStream &oct(QTextStream &s) { return Qt::oct(s); } +Q_CORE_EXPORT QTextStream &dec(QTextStream &s) { return Qt::dec(s); } +Q_CORE_EXPORT QTextStream &hex(QTextStream &s) { return Qt::hex(s); } + +Q_CORE_EXPORT QTextStream &showbase(QTextStream &s) { return Qt::showbase(s); } +Q_CORE_EXPORT QTextStream &forcesign(QTextStream &s) { return Qt::forcesign(s); } +Q_CORE_EXPORT QTextStream &forcepoint(QTextStream &s) { return Qt::forcepoint(s); } +Q_CORE_EXPORT QTextStream &noshowbase(QTextStream &s) { return Qt::noshowbase(s); } +Q_CORE_EXPORT QTextStream &noforcesign(QTextStream &s) { return Qt::noforcesign(s); } +Q_CORE_EXPORT QTextStream &noforcepoint(QTextStream &s) { return Qt::noforcepoint(s); } + +Q_CORE_EXPORT QTextStream &uppercasebase(QTextStream &s) { return Qt::uppercasebase(s); } +Q_CORE_EXPORT QTextStream &uppercasedigits(QTextStream &s) { return Qt::uppercasedigits(s); } +Q_CORE_EXPORT QTextStream &lowercasebase(QTextStream &s) { return Qt::lowercasebase(s); } +Q_CORE_EXPORT QTextStream &lowercasedigits(QTextStream &s) { return Qt::lowercasedigits(s); } + +Q_CORE_EXPORT QTextStream &fixed(QTextStream &s) { return Qt::fixed(s); } +Q_CORE_EXPORT QTextStream &scientific(QTextStream &s) { return Qt::scientific(s); } + +Q_CORE_EXPORT QTextStream &left(QTextStream &s) { return Qt::left(s); } +Q_CORE_EXPORT QTextStream &right(QTextStream &s) { return Qt::right(s); } +Q_CORE_EXPORT QTextStream ¢er(QTextStream &s) { return Qt::center(s); } + +Q_CORE_EXPORT QTextStream &endl(QTextStream &s) { return Qt::endl(s); } +Q_CORE_EXPORT QTextStream &flush(QTextStream &s) { return Qt::flush(s); } +Q_CORE_EXPORT QTextStream &reset(QTextStream &s) { return Qt::reset(s); } + +Q_CORE_EXPORT QTextStream &ws(QTextStream &s) { return Qt::ws(s); } + +#if QT_CONFIG(textcodec) +Q_CORE_EXPORT QTextStream &bom(QTextStream &s) { return Qt::bom(s); } +#endif +#endif + QT_END_NAMESPACE #ifndef QT_NO_QOBJECT diff --git a/src/corelib/serialization/qtextstream.h b/src/corelib/serialization/qtextstream.h index 1d86a18b9c..7673e5d87e 100644 --- a/src/corelib/serialization/qtextstream.h +++ b/src/corelib/serialization/qtextstream.h @@ -233,6 +233,13 @@ inline QTextStream &operator<<(QTextStream &s, QTextStreamFunction f) inline QTextStream &operator<<(QTextStream &s, QTextStreamManipulator m) { m.exec(s); return s; } +#if defined(Q_QDOC) || QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +namespace Qt { +#else +// This namespace only exists for 'using namespace' declarations. +namespace QTextStreamFunctions { +#endif + Q_CORE_EXPORT QTextStream &bin(QTextStream &s); Q_CORE_EXPORT QTextStream &oct(QTextStream &s); Q_CORE_EXPORT QTextStream &dec(QTextStream &s); @@ -265,6 +272,18 @@ Q_CORE_EXPORT QTextStream &bom(QTextStream &s); Q_CORE_EXPORT QTextStream &ws(QTextStream &s); +} // namespace QTextStreamFunctions + +#if QT_VERSION < QT_VERSION_CHECK(6, 0, 0) && !defined(Q_QDOC) +namespace Qt { +using namespace QTextStreamFunctions; +} + +// We use 'using namespace' as that doesn't cause +// conflicting definitions compiler errors. +using namespace QTextStreamFunctions; +#endif // QT_VERSION < QT_VERSION_CHECK(6, 0, 0) && !defined(Q_QDOC) + inline QTextStreamManipulator qSetFieldWidth(int width) { QTSMFI func = &QTextStream::setFieldWidth; diff --git a/src/corelib/serialization/qxmlstream_p.h b/src/corelib/serialization/qxmlstream_p.h index 61f501f81b..cde66a48a3 100644 --- a/src/corelib/serialization/qxmlstream_p.h +++ b/src/corelib/serialization/qxmlstream_p.h @@ -162,12 +162,12 @@ public: const char *const QXmlStreamReader_Table::spell [] = { - "end of file", 0, " ", "<", ">", "&", "#", "\'", "\"", "[", + "end of file", nullptr, " ", "<", ">", "&", "#", "\'", "\"", "[", "]", "(", ")", "|", "=", "%", "/", ":", ";", ",", "-", "+", "*", ".", "?", "!", "[a-zA-Z]", "[0-9]", "[CDATA[", "DOCTYPE", "ELEMENT", "ATTLIST", "ENTITY", "NOTATION", "SYSTEM", "PUBLIC", "NDATA", "REQUIRED", "IMPLIED", "FIXED", - "EMPTY", "ANY", "PCDATA", 0, 0, 0, 0, "CDATA", "ID", "IDREF", - "IDREFS", "ENTITIES", "NMTOKEN", "NMTOKENS", "<?xml", "version", 0}; + "EMPTY", "ANY", "PCDATA", nullptr, nullptr, nullptr, nullptr, "CDATA", "ID", "IDREF", + "IDREFS", "ENTITIES", "NMTOKEN", "NMTOKENS", "<?xml", "version", nullptr}; const short QXmlStreamReader_Table::lhs [] = { 57, 57, 59, 59, 59, 59, 59, 59, 59, 59, @@ -645,7 +645,7 @@ template <typename T> class QXmlStreamSimpleStack { T *data; int tos, cap; public: - inline QXmlStreamSimpleStack():data(0), tos(-1), cap(0){} + inline QXmlStreamSimpleStack():data(nullptr), tos(-1), cap(0){} inline ~QXmlStreamSimpleStack(){ if (data) free(data); } inline void reserve(int extraCapacity) { @@ -995,7 +995,7 @@ public: int fastScanLiteralContent(); int fastScanSpace(); int fastScanContentCharList(); - int fastScanName(int *prefix = 0); + int fastScanName(int *prefix = nullptr); inline int fastScanNMTOKEN(); diff --git a/src/corelib/statemachine/qstate_p.h b/src/corelib/statemachine/qstate_p.h index 7fb40392e7..ec746caae1 100644 --- a/src/corelib/statemachine/qstate_p.h +++ b/src/corelib/statemachine/qstate_p.h @@ -68,14 +68,14 @@ QT_BEGIN_NAMESPACE struct QPropertyAssignment { QPropertyAssignment() - : object(0), explicitlySet(true) {} + : object(nullptr), explicitlySet(true) {} QPropertyAssignment(QObject *o, const QByteArray &n, const QVariant &v, bool es = true) : object(o), propertyName(n), value(v), explicitlySet(es) {} bool objectDeleted() const { return !object; } - void write() const { Q_ASSERT(object != 0); object->setProperty(propertyName, value); } + void write() const { Q_ASSERT(object != nullptr); object->setProperty(propertyName, value); } bool hasTarget(QObject *o, const QByteArray &pn) const { return object == o && propertyName == pn; } @@ -99,8 +99,8 @@ public: QStatePrivate(); ~QStatePrivate(); - static QStatePrivate *get(QState *q) { return q ? q->d_func() : 0; } - static const QStatePrivate *get(const QState *q) { return q? q->d_func() : 0; } + static QStatePrivate *get(QState *q) { return q ? q->d_func() : nullptr; } + static const QStatePrivate *get(const QState *q) { return q? q->d_func() : nullptr; } QList<QAbstractState*> childStates() const; QList<QHistoryState*> historyStates() const; diff --git a/src/corelib/statemachine/qstatemachine_p.h b/src/corelib/statemachine/qstatemachine_p.h index f3366ca5f7..c66130b8ce 100644 --- a/src/corelib/statemachine/qstatemachine_p.h +++ b/src/corelib/statemachine/qstatemachine_p.h @@ -108,7 +108,7 @@ public: ~QStateMachinePrivate(); static QStateMachinePrivate *get(QStateMachine *q) - { return q ? q->d_func() : 0; } + { return q ? q->d_func() : nullptr; } QState *findLCA(const QList<QAbstractState*> &states, bool onlyCompound = false) const; QState *findLCCA(const QList<QAbstractState*> &states) const; @@ -313,7 +313,7 @@ public: DelayedEvent(QEvent *e, int tid) : event(e), timerId(tid) {} DelayedEvent() - : event(0), timerId(0) {} + : event(nullptr), timerId(0) {} }; QHash<int, DelayedEvent> delayedEvents; QHash<int, int> timerIdToDelayedEventId; diff --git a/src/corelib/thread/qatomic_bootstrap.h b/src/corelib/thread/qatomic_bootstrap.h index b463f817bd..27a67fb2ee 100644 --- a/src/corelib/thread/qatomic_bootstrap.h +++ b/src/corelib/thread/qatomic_bootstrap.h @@ -65,7 +65,7 @@ template <typename T> struct QAtomicOps: QGenericAtomicOps<QAtomicOps<T> > return --_q_value != 0; } - static bool testAndSetRelaxed(T &_q_value, T expectedValue, T newValue, T *currentValue = 0) Q_DECL_NOTHROW + static bool testAndSetRelaxed(T &_q_value, T expectedValue, T newValue, T *currentValue = nullptr) Q_DECL_NOTHROW { if (currentValue) *currentValue = _q_value; diff --git a/src/corelib/thread/qorderedmutexlocker_p.h b/src/corelib/thread/qorderedmutexlocker_p.h index ded102d32d..5b2c7ab112 100644 --- a/src/corelib/thread/qorderedmutexlocker_p.h +++ b/src/corelib/thread/qorderedmutexlocker_p.h @@ -58,6 +58,8 @@ QT_BEGIN_NAMESPACE +#if QT_CONFIG(thread) + /* Locks 2 mutexes in a defined order, avoiding a recursive lock if we're trying to lock the same mutex twice. @@ -65,9 +67,9 @@ QT_BEGIN_NAMESPACE class QOrderedMutexLocker { public: - QOrderedMutexLocker(QMutex *m1, QMutex *m2) - : mtx1((m1 == m2) ? m1 : (std::less<QMutex *>()(m1, m2) ? m1 : m2)), - mtx2((m1 == m2) ? 0 : (std::less<QMutex *>()(m1, m2) ? m2 : m1)), + QOrderedMutexLocker(QBasicMutex *m1, QBasicMutex *m2) + : mtx1((m1 == m2) ? m1 : (std::less<QBasicMutex *>()(m1, m2) ? m1 : m2)), + mtx2((m1 == m2) ? 0 : (std::less<QBasicMutex *>()(m1, m2) ? m2 : m1)), locked(false) { relock(); @@ -95,12 +97,12 @@ public: } } - static bool relock(QMutex *mtx1, QMutex *mtx2) + static bool relock(QBasicMutex *mtx1, QBasicMutex *mtx2) { // mtx1 is already locked, mtx2 not... do we need to unlock and relock? if (mtx1 == mtx2) return false; - if (std::less<QMutex *>()(mtx1, mtx2)) { + if (std::less<QBasicMutex *>()(mtx1, mtx2)) { mtx2->lock(); return true; } @@ -113,10 +115,58 @@ public: } private: - QMutex *mtx1, *mtx2; + QBasicMutex *mtx1, *mtx2; bool locked; }; +class QBasicMutexLocker +{ +public: + inline explicit QBasicMutexLocker(QBasicMutex *m) QT_MUTEX_LOCK_NOEXCEPT + : m(m), isLocked(true) + { + m->lock(); + } + inline ~QBasicMutexLocker() { if (isLocked) unlock(); } + + inline void unlock() Q_DECL_NOTHROW + { + isLocked = false; + m->unlock(); + } + + inline void relock() QT_MUTEX_LOCK_NOEXCEPT + { + isLocked = true; + m->lock(); + } + +private: + Q_DISABLE_COPY(QBasicMutexLocker) + + QBasicMutex *m; + bool isLocked; +}; + +#else + +class QOrderedMutexLocker +{ +public: + QOrderedMutexLocker(QBasicMutex *, QBasicMutex *) {} + ~QOrderedMutexLocker() {} + + void relock() {} + void unlock() {} + + static bool relock(QBasicMutex *, QBasicMutex *) {} +}; + +using QBasicMutexLocker = QMutexLocker; + +#endif + + QT_END_NAMESPACE #endif diff --git a/src/corelib/thread/qresultstore.h b/src/corelib/thread/qresultstore.h index 1f29e8d187..7a65089396 100644 --- a/src/corelib/thread/qresultstore.h +++ b/src/corelib/thread/qresultstore.h @@ -142,7 +142,7 @@ public: template <typename T> int addResult(int index, const T *result) { - if (result == 0) + if (result == nullptr) return addResult(index, static_cast<void *>(nullptr)); else return addResult(index, static_cast<void *>(new T(*result))); @@ -158,7 +158,7 @@ public: int addResults(int index, const QVector<T> *results, int totalCount) { if (m_filterMode == true && results->count() != totalCount && 0 == results->count()) - return addResults(index, 0, 0, totalCount); + return addResults(index, nullptr, 0, totalCount); else return addResults(index, new QVector<T>(*results), results->count(), totalCount); } diff --git a/src/corelib/thread/qthread_p.h b/src/corelib/thread/qthread_p.h index 7d9442ab79..e614ddd004 100644 --- a/src/corelib/thread/qthread_p.h +++ b/src/corelib/thread/qthread_p.h @@ -89,7 +89,7 @@ public: QEvent *event; int priority; inline QPostEvent() - : receiver(0), event(0), priority(0) + : receiver(nullptr), event(nullptr), priority(0) { } inline QPostEvent(QObject *r, QEvent *e, int p) : receiver(r), event(e), priority(p) @@ -148,7 +148,7 @@ private: class Q_CORE_EXPORT QDaemonThread : public QThread { public: - QDaemonThread(QObject *parent = 0); + QDaemonThread(QObject *parent = nullptr); ~QDaemonThread(); }; @@ -157,7 +157,7 @@ class QThreadPrivate : public QObjectPrivate Q_DECLARE_PUBLIC(QThread) public: - QThreadPrivate(QThreadData *d = 0); + QThreadPrivate(QThreadData *d = nullptr); ~QThreadPrivate(); void setPriority(QThread::Priority prio); @@ -248,7 +248,7 @@ public: #endif static void clearCurrentThreadData(); static QThreadData *get2(QThread *thread) - { Q_ASSERT_X(thread != 0, "QThread", "internal error"); return thread->d_func()->data; } + { Q_ASSERT_X(thread != nullptr, "QThread", "internal error"); return thread->d_func()->data; } void ref(); @@ -281,7 +281,7 @@ public: public: FlaggedDebugSignatures() : idx(0) - { std::fill_n(locations, Count, static_cast<char*>(0)); } + { std::fill_n(locations, Count, static_cast<char*>(nullptr)); } void store(const char* method) { locations[idx++ % Count] = method; } @@ -328,7 +328,7 @@ class QAdoptedThread : public QThread Q_DECLARE_PRIVATE(QThread) public: - QAdoptedThread(QThreadData *data = 0); + QAdoptedThread(QThreadData *data = nullptr); ~QAdoptedThread(); void init(); diff --git a/src/corelib/thread/qthreadpool_p.h b/src/corelib/thread/qthreadpool_p.h index 952e02ef20..01852d8366 100644 --- a/src/corelib/thread/qthreadpool_p.h +++ b/src/corelib/thread/qthreadpool_p.h @@ -162,7 +162,7 @@ public: void tryToStartMoreThreads(); bool tooManyThreadsActive() const; - void startThread(QRunnable *runnable = 0); + void startThread(QRunnable *runnable = nullptr); void reset(); bool waitForDone(int msecs); bool waitForDone(const QDeadlineTimer &timer); diff --git a/src/corelib/thread/qthreadstorage.h b/src/corelib/thread/qthreadstorage.h index 55fc482da3..9eb8672e92 100644 --- a/src/corelib/thread/qthreadstorage.h +++ b/src/corelib/thread/qthreadstorage.h @@ -69,7 +69,7 @@ inline T *&qThreadStorage_localData(QThreadStorageData &d, T **) { void **v = d.get(); - if (!v) v = d.set(0); + if (!v) v = d.set(nullptr); return *(reinterpret_cast<T**>(v)); } @@ -139,7 +139,7 @@ public: inline ~QThreadStorage() { } inline bool hasLocalData() const - { return d.get() != 0; } + { return d.get() != nullptr; } inline T& localData() { return qThreadStorage_localData(d, reinterpret_cast<T*>(0)); } diff --git a/src/corelib/tools/qbytearray.cpp b/src/corelib/tools/qbytearray.cpp index 0f27071176..8bf20350d6 100644 --- a/src/corelib/tools/qbytearray.cpp +++ b/src/corelib/tools/qbytearray.cpp @@ -4136,10 +4136,9 @@ ushort QByteArray::toUShort(bool *ok, int base) const double QByteArray::toDouble(bool *ok) const { - QByteArray nulled = nulTerminated(); bool nonNullOk = false; int processed = 0; - double d = qt_asciiToDouble(nulled.constData(), nulled.length(), + double d = qt_asciiToDouble(constData(), size(), nonNullOk, processed, WhitespacesAllowed); if (ok) *ok = nonNullOk; diff --git a/src/corelib/tools/qcache.h b/src/corelib/tools/qcache.h index 8c0e7860f7..b558a8358d 100644 --- a/src/corelib/tools/qcache.h +++ b/src/corelib/tools/qcache.h @@ -51,7 +51,7 @@ class QCache struct Node { inline Node() : keyPtr(0) {} inline Node(T *data, int cost) - : keyPtr(0), t(data), c(cost), p(0), n(0) {} + : keyPtr(nullptr), t(data), c(cost), p(nullptr), n(nullptr) {} const Key *keyPtr; T *t; int c; Node *p,*n; }; Node *f, *l; @@ -71,14 +71,14 @@ class QCache inline T *relink(const Key &key) { typename QHash<Key, Node>::iterator i = hash.find(key); if (typename QHash<Key, Node>::const_iterator(i) == hash.constEnd()) - return 0; + return nullptr; Node &n = *i; if (f != &n) { if (n.p) n.p->n = n.n; if (n.n) n.n->p = n.p; if (l == &n) l = n.p; - n.p = 0; + n.p = nullptr; n.n = f; f->p = &n; f = &n; @@ -117,12 +117,12 @@ private: template <class Key, class T> inline QCache<Key, T>::QCache(int amaxCost) Q_DECL_NOTHROW - : f(0), l(0), mx(amaxCost), total(0) {} + : f(nullptr), l(nullptr), mx(amaxCost), total(0) {} template <class Key, class T> inline void QCache<Key,T>::clear() { while (f) { delete f->t; f = f->n; } - hash.clear(); l = 0; total = 0; } + hash.clear(); l = nullptr; total = 0; } template <class Key, class T> inline void QCache<Key,T>::setMaxCost(int m) @@ -153,11 +153,11 @@ inline T *QCache<Key,T>::take(const Key &key) { typename QHash<Key, Node>::iterator i = hash.find(key); if (i == hash.end()) - return 0; + return nullptr; Node &n = *i; T *t = n.t; - n.t = 0; + n.t = nullptr; unlink(n); return t; } diff --git a/src/corelib/tools/qcollator.cpp b/src/corelib/tools/qcollator.cpp index 76dcf35833..d73eb0d07c 100644 --- a/src/corelib/tools/qcollator.cpp +++ b/src/corelib/tools/qcollator.cpp @@ -59,20 +59,21 @@ QT_BEGIN_NAMESPACE \ingroup string-processing \ingroup shared - QCollator is initialized with a QLocale and an optional collation strategy. It tries to - initialize the collator with the specified values. The collator can then be used to compare - and sort strings in a locale dependent fashion. + QCollator is initialized with a QLocale and an optional collation strategy. + It tries to initialize the collator with the specified values. The collator + can then be used to compare and sort strings in a locale dependent fashion. - A QCollator object can be used together with template based sorting algorithms such as std::sort - to sort a list of QStrings. + A QCollator object can be used together with template based sorting + algorithms such as std::sort to sort a list of QStrings. - In addition to the locale and collation strategy, several optional flags can be set that influence - the result of the collation. + In addition to the locale and collation strategy, several optional flags can + be set that influence the result of the collation. */ /*! - Constructs a QCollator from \a locale. If \a locale is not specified - the system's default locale is used. + Constructs a QCollator for \a locale. + + If \a locale is not specified, the system's default locale is used. \sa setLocale() */ @@ -128,9 +129,9 @@ QCollator &QCollator::operator=(const QCollator &other) Move constructor. Moves from \a other into this collator. - Note that a moved-from QCollator can only be destroyed or assigned - to. The effect of calling other functions than the destructor or - one of the assignment operators is undefined. + Note that a moved-from QCollator can only be destroyed or assigned to. + The effect of calling other functions than the destructor or one of the + assignment operators is undefined. */ /*! @@ -138,9 +139,9 @@ QCollator &QCollator::operator=(const QCollator &other) Move-assigns from \a other to this collator. - Note that a moved-from QCollator can only be destroyed or assigned - to. The effect of calling other functions than the destructor or - one of the assignment operators is undefined. + Note that a moved-from QCollator can only be destroyed or assigned to. + The effect of calling other functions than the destructor or one of the + assignment operators is undefined. */ /*! @@ -218,7 +219,8 @@ Qt::CaseSensitivity QCollator::caseSensitivity() const Enables numeric sorting mode when \a on is set to true. - This will enable proper sorting of numeric digits, so that e.g. 100 sorts after 99. + This will enable proper sorting of numeric digits, so that e.g. 100 sorts + after 99. By default this mode is off. @@ -248,11 +250,13 @@ bool QCollator::numericMode() const /*! \fn void QCollator::setIgnorePunctuation(bool on) - If \a on is set to true, punctuation characters and symbols are ignored when determining sort order. + If \a on is set to true, punctuation characters and symbols are ignored when + determining sort order. The default is locale dependent. - \note This method is not currently supported if Qt is configured to not use ICU on Linux. + \note This method is not currently supported if Qt is configured to not use + ICU on Linux. \sa ignorePunctuation() */ @@ -268,7 +272,8 @@ void QCollator::setIgnorePunctuation(bool on) /*! \fn bool QCollator::ignorePunctuation() const - Returns \c true if punctuation characters and symbols are ignored when determining sort order. + Returns \c true if punctuation characters and symbols are ignored when + determining sort order. \sa setIgnorePunctuation() */ @@ -278,35 +283,66 @@ bool QCollator::ignorePunctuation() const } /*! - \fn int QCollator::compare(const QString &s1, const QString &s2) const + \since 5.13 + \fn bool QCollator::operator()(QStringView s1, QStringView s2) const + \internal +*/ + +/*! + \since 5.13 + \fn int QCollator::compare(QStringView s1, QStringView s2) const - Compares \a s1 with \a s2. Returns an integer less than, equal to, or greater than zero - depending on whether \a s1 is smaller, equal or larger than \a s2. - */ + Compares \a s1 with \a s2. + Returns an integer less than, equal to, or greater than zero depending on + whether \a s1 sorts before, with or after \a s2. +*/ +#if QT_STRINGVIEW_LEVEL < 2 /*! \fn bool QCollator::operator()(const QString &s1, const QString &s2) const \internal */ /*! - \fn int QCollator::compare(const QStringRef &s1, const QStringRef &s2) const \overload - Compares \a s1 with \a s2. Returns an integer less than, equal to, or greater than zero - depending on whether \a s1 is smaller, equal or larger than \a s2. + Compares \a s1 with \a s2. + + Returns an integer less than, equal to, or greater than zero depending on + whether \a s1 sorts before, with or after \a s2. +*/ +int QCollator::compare(const QString &s1, const QString &s2) const +{ + return compare(QStringView(s1), QStringView(s2)); +} + +/*! + \overload + + Compares \a s1 with \a s2. + + Returns an integer less than, equal to, or greater than zero depending on + whether \a s1 sorts before, with or after \a s2. */ +int QCollator::compare(const QStringRef &s1, const QStringRef &s2) const +{ + return compare(QStringView(s1), QStringView(s2)); +} /*! - \fn int QCollator::compare(const QChar *s1, int len1, const QChar *s2, int len2) const \overload - Compares \a s1 with \a s2. \a len1 and \a len2 specify the length of the - QChar arrays pointer to by \a s1 and \a s2. + Compares \a s1 with \a s2. \a len1 and \a len2 specify the lengths of the + QChar arrays pointed to by \a s1 and \a s2. - Returns an integer less than, equal to, or greater than zero - depending on whether \a s1 is smaller, equal or larger than \a s2. + Returns an integer less than, equal to, or greater than zero depending on + whether \a s1 sorts before, with or after \a s2. */ +int QCollator::compare(const QChar *s1, int len1, const QChar *s2, int len2) const +{ + return compare(QStringView(s1, len1), QStringView(s2, len2)); +} +#endif // QT_STRINGVIEW_LEVEL < 2 /*! \fn QCollatorSortKey QCollator::sortKey(const QString &string) const @@ -314,9 +350,9 @@ bool QCollator::ignorePunctuation() const Returns a sortKey for \a string. Creating the sort key is usually somewhat slower, than using the compare() - methods directly. But if the string is compared repeatedly (e.g. when sorting - a whole list of strings), it's usually faster to create the sort keys for each - string and then sort using the keys. + methods directly. But if the string is compared repeatedly (e.g. when + sorting a whole list of strings), it's usually faster to create the sort + keys for each string and then sort using the keys. \note Not supported with the C (a.k.a. POSIX) locale on Darwin. */ @@ -328,8 +364,8 @@ bool QCollator::ignorePunctuation() const \since 5.2 - The QCollatorSortKey class is always created by QCollator::sortKey() - and is used for fast strings collation, for example when collating many strings. + The QCollatorSortKey class is always created by QCollator::sortKey() and is + used for fast strings collation, for example when collating many strings. \reentrant \ingroup i18n @@ -398,9 +434,11 @@ QCollatorSortKey& QCollatorSortKey::operator=(const QCollatorSortKey &other) /*! \fn int QCollatorSortKey::compare(const QCollatorSortKey &otherKey) const - Compares the key to \a otherKey. Returns a negative value if the key - is less than \a otherKey, 0 if the key is equal to \a otherKey or a - positive value if the key is greater than \a otherKey. + Compares this key to \a otherKey. + + Returns a negative value if the key is less than \a otherKey, 0 if the key + is equal to \a otherKey or a positive value if the key is greater than \a + otherKey. \sa operator<() */ diff --git a/src/corelib/tools/qcollator.h b/src/corelib/tools/qcollator.h index 6fa199cb0f..700de739bb 100644 --- a/src/corelib/tools/qcollator.h +++ b/src/corelib/tools/qcollator.h @@ -109,12 +109,18 @@ public: void setIgnorePunctuation(bool on); bool ignorePunctuation() const; +#if QT_STRINGVIEW_LEVEL < 2 int compare(const QString &s1, const QString &s2) const; int compare(const QStringRef &s1, const QStringRef &s2) const; int compare(const QChar *s1, int len1, const QChar *s2, int len2) const; bool operator()(const QString &s1, const QString &s2) const { return compare(s1, s2) < 0; } +#endif + int compare(QStringView s1, QStringView s2) const; + + bool operator()(QStringView s1, QStringView s2) const + { return compare(s1, s2) < 0; } QCollatorSortKey sortKey(const QString &string) const; diff --git a/src/corelib/tools/qcollator_icu.cpp b/src/corelib/tools/qcollator_icu.cpp index ab45b9a1a1..8acda45070 100644 --- a/src/corelib/tools/qcollator_icu.cpp +++ b/src/corelib/tools/qcollator_icu.cpp @@ -78,7 +78,8 @@ void QCollatorPrivate::init() // and does case sensitive comparison. // UCOL_QUATERNARY is used as default in a few languages such as Japanese to take care of some // additional differences in those languages. - UColAttributeValue val = (caseSensitivity == Qt::CaseSensitive) ? UCOL_DEFAULT_STRENGTH : UCOL_SECONDARY; + UColAttributeValue val = (caseSensitivity == Qt::CaseSensitive) + ? UCOL_DEFAULT_STRENGTH : UCOL_SECONDARY; status = U_ZERO_ERROR; ucol_setAttribute(collator, UCOL_STRENGTH, val, &status); @@ -91,7 +92,8 @@ void QCollatorPrivate::init() qWarning("ucol_setAttribute: numeric collation failed: %d", status); status = U_ZERO_ERROR; - ucol_setAttribute(collator, UCOL_ALTERNATE_HANDLING, ignorePunctuation ? UCOL_SHIFTED : UCOL_NON_IGNORABLE, &status); + ucol_setAttribute(collator, UCOL_ALTERNATE_HANDLING, + ignorePunctuation ? UCOL_SHIFTED : UCOL_NON_IGNORABLE, &status); if (U_FAILURE(status)) qWarning("ucol_setAttribute: Alternate handling failed: %d", status); @@ -105,37 +107,20 @@ void QCollatorPrivate::cleanup() collator = nullptr; } -int QCollator::compare(const QChar *s1, int len1, const QChar *s2, int len2) const +int QCollator::compare(QStringView s1, QStringView s2) const { if (d->dirty) d->init(); - if (d->collator) - return ucol_strcoll(d->collator, (const UChar *)s1, len1, (const UChar *)s2, len2); - - return QString::compare_helper(s1, len1, s2, len2, d->caseSensitivity); -} - -int QCollator::compare(const QString &s1, const QString &s2) const -{ - if (d->dirty) - d->init(); - - if (d->collator) - return compare(s1.constData(), s1.size(), s2.constData(), s2.size()); - - return QString::compare(s1, s2, d->caseSensitivity); -} - -int QCollator::compare(const QStringRef &s1, const QStringRef &s2) const -{ - if (d->dirty) - d->init(); - - if (d->collator) - return compare(s1.constData(), s1.size(), s2.constData(), s2.size()); + if (d->collator) { + return ucol_strcoll(d->collator, + reinterpret_cast<const UChar *>(s1.data()), s1.size(), + reinterpret_cast<const UChar *>(s2.data()), s2.size()); + } - return QStringRef::compare(s1, s2, d->caseSensitivity); + return QString::compare_helper(s1.data(), s1.size(), + s2.data(), s2.size(), + d->caseSensitivity); } QCollatorSortKey QCollator::sortKey(const QString &string) const diff --git a/src/corelib/tools/qcollator_macx.cpp b/src/corelib/tools/qcollator_macx.cpp index 42e67e0c12..071d7c048f 100644 --- a/src/corelib/tools/qcollator_macx.cpp +++ b/src/corelib/tools/qcollator_macx.cpp @@ -65,12 +65,12 @@ void QCollatorPrivate::init() return; LocaleRef localeRef; - int rc = LocaleRefFromLocaleString(QLocalePrivate::get(locale)->bcp47Name().constData(), &localeRef); - if (rc != 0) - qWarning("couldn't initialize the locale"); + OSStatus status = + LocaleRefFromLocaleString(QLocalePrivate::get(locale)->bcp47Name().constData(), &localeRef); + if (status != 0) + qWarning("Couldn't initialize the locale (%d)", int(status)); UInt32 options = 0; - if (caseSensitivity == Qt::CaseInsensitive) options |= kUCCollateCaseInsensitiveMask; if (numericMode) @@ -78,14 +78,9 @@ void QCollatorPrivate::init() if (!ignorePunctuation) options |= kUCCollatePunctuationSignificantMask; - OSStatus status = UCCreateCollator( - localeRef, - 0, - options, - &collator - ); + status = UCCreateCollator(localeRef, 0, options, &collator); if (status != 0) - qWarning("Couldn't initialize the collator"); + qWarning("Couldn't initialize the collator (%d)", int(status)); dirty = false; } @@ -97,18 +92,18 @@ void QCollatorPrivate::cleanup() collator = 0; } -int QCollator::compare(const QChar *s1, int len1, const QChar *s2, int len2) const +int QCollator::compare(QStringView s1, QStringView s2) const { if (d->dirty) d->init(); if (!d->collator) - return QStringView(s1, len1).compare(QStringView(s2, len2), caseSensitivity()); + return s1.compare(s2, caseSensitivity()); SInt32 result; Boolean equivalent; UCCompareText(d->collator, - reinterpret_cast<const UniChar *>(s1), len1, - reinterpret_cast<const UniChar *>(s2), len2, + reinterpret_cast<const UniChar *>(s1.data()), s1.size(), + reinterpret_cast<const UniChar *>(s2.data()), s2.size(), &equivalent, &result); if (equivalent) @@ -116,16 +111,6 @@ int QCollator::compare(const QChar *s1, int len1, const QChar *s2, int len2) con return result < 0 ? -1 : 1; } -int QCollator::compare(const QString &str1, const QString &str2) const -{ - return compare(str1.constData(), str1.size(), str2.constData(), str2.size()); -} - -int QCollator::compare(const QStringRef &s1, const QStringRef &s2) const -{ - return compare(s1.constData(), s1.size(), s2.constData(), s2.size()); -} - QCollatorSortKey QCollator::sortKey(const QString &string) const { if (d->dirty) @@ -139,13 +124,14 @@ QCollatorSortKey QCollator::sortKey(const QString &string) const //Documentation recommends having it 5 times as big as the input QVector<UCCollationValue> ret(string.size() * 5); ItemCount actualSize; - int status = UCGetCollationKey(d->collator, reinterpret_cast<const UniChar *>(string.constData()), string.count(), - ret.size(), &actualSize, ret.data()); + int status = UCGetCollationKey(d->collator, + reinterpret_cast<const UniChar *>(string.constData()), + string.count(), ret.size(), &actualSize, ret.data()); - ret.resize(actualSize+1); + ret.resize(actualSize + 1); if (status == kUCOutputBufferTooSmall) { - UCGetCollationKey(d->collator, reinterpret_cast<const UniChar *>(string.constData()), string.count(), - ret.size(), &actualSize, ret.data()); + UCGetCollationKey(d->collator, reinterpret_cast<const UniChar *>(string.constData()), + string.count(), ret.size(), &actualSize, ret.data()); } ret[actualSize] = 0; return QCollatorSortKey(new QCollatorSortKeyPrivate(std::move(ret))); diff --git a/src/corelib/tools/qcollator_posix.cpp b/src/corelib/tools/qcollator_posix.cpp index 81f97a02e1..9cbc539ebe 100644 --- a/src/corelib/tools/qcollator_posix.cpp +++ b/src/corelib/tools/qcollator_posix.cpp @@ -65,7 +65,7 @@ void QCollatorPrivate::cleanup() { } -static void stringToWCharArray(QVarLengthArray<wchar_t> &ret, const QString &string) +static void stringToWCharArray(QVarLengthArray<wchar_t> &ret, QStringView string) { ret.resize(string.length()); int len = string.toWCharArray(ret.data()); @@ -73,12 +73,7 @@ static void stringToWCharArray(QVarLengthArray<wchar_t> &ret, const QString &str ret[len] = 0; } -int QCollator::compare(const QChar *s1, int len1, const QChar *s2, int len2) const -{ - return compare(QString::fromRawData(s1, len1), QString::fromRawData(s2, len2)); -} - -int QCollator::compare(const QString &s1, const QString &s2) const +int QCollator::compare(QStringView s1, QStringView s2) const { if (d->isC()) return s1.compare(s2, caseSensitivity()); @@ -91,11 +86,6 @@ int QCollator::compare(const QString &s1, const QString &s2) const return std::wcscoll(array1.constData(), array2.constData()); } -int QCollator::compare(const QStringRef &s1, const QStringRef &s2) const -{ - return compare(s1.toString(), s2.toString()); -} - QCollatorSortKey QCollator::sortKey(const QString &string) const { if (d->dirty) diff --git a/src/corelib/tools/qcollator_win.cpp b/src/corelib/tools/qcollator_win.cpp index 10cfdaa264..9d81de882f 100644 --- a/src/corelib/tools/qcollator_win.cpp +++ b/src/corelib/tools/qcollator_win.cpp @@ -87,30 +87,30 @@ void QCollatorPrivate::cleanup() { } - -int QCollator::compare(const QChar *s1, int len1, const QChar *s2, int len2) const +int QCollator::compare(QStringView s1, QStringView s2) const { if (d->isC()) - return QString::compare_helper(s1, len1, s2, len2, d->caseSensitivity); + return s1.compare(s2, d->caseSensitivity); if (d->dirty) d->init(); //* from Windows documentation * - // Returns one of the following values if successful. To maintain the C runtime convention of - // comparing strings, the value 2 can be subtracted from a nonzero return value. Then, the - // meaning of <0, ==0, and >0 is consistent with the C runtime. + // Returns one of the following values if successful. To maintain the C + // runtime convention of comparing strings, the value 2 can be subtracted + // from a nonzero return value. Then, the meaning of <0, ==0, and >0 is + // consistent with the C runtime. // [...] The function returns 0 if it does not succeed. // https://docs.microsoft.com/en-us/windows/desktop/api/stringapiset/nf-stringapiset-comparestringex#return-value #ifndef USE_COMPARESTRINGEX const int ret = CompareString(d->localeID, d->collator, - reinterpret_cast<const wchar_t*>(s1), len1, - reinterpret_cast<const wchar_t*>(s2), len2); + reinterpret_cast<const wchar_t *>(s1.data()), s1.size(), + reinterpret_cast<const wchar_t *>(s2.data()), s2.size()); #else const int ret = CompareStringEx(LPCWSTR(d->localeName.utf16()), d->collator, - reinterpret_cast<LPCWSTR>(s1), len1, - reinterpret_cast<LPCWSTR>(s2), len2, + reinterpret_cast<LPCWSTR>(s1.data()), s1.size(), + reinterpret_cast<LPCWSTR>(s2.data()), s2.size(), nullptr, nullptr, 0); #endif if (Q_LIKELY(ret)) @@ -132,16 +132,6 @@ int QCollator::compare(const QChar *s1, int len1, const QChar *s2, int len2) con return 0; } -int QCollator::compare(const QString &str1, const QString &str2) const -{ - return compare(str1.constData(), str1.size(), str2.constData(), str2.size()); -} - -int QCollator::compare(const QStringRef &s1, const QStringRef &s2) const -{ - return compare(s1.constData(), s1.size(), s2.constData(), s2.size()); -} - QCollatorSortKey QCollator::sortKey(const QString &string) const { if (d->dirty) @@ -170,7 +160,9 @@ QCollatorSortKey QCollator::sortKey(const QString &string) const NULL, NULL, 0); #endif if (finalSize == 0) { - qWarning() << "there were problems when generating the ::sortKey by LCMapStringW with error:" << GetLastError(); + qWarning() + << "there were problems when generating the ::sortKey by LCMapStringW with error:" + << GetLastError(); } return QCollatorSortKey(new QCollatorSortKeyPrivate(std::move(ret))); } diff --git a/src/corelib/tools/qdatetime_p.h b/src/corelib/tools/qdatetime_p.h index 4d30d4192b..6e4120d762 100644 --- a/src/corelib/tools/qdatetime_p.h +++ b/src/corelib/tools/qdatetime_p.h @@ -135,7 +135,7 @@ public: #if QT_CONFIG(timezone) static qint64 zoneMSecsToEpochMSecs(qint64 msecs, const QTimeZone &zone, DaylightStatus hint = UnknownDaylightTime, - QDate *localDate = 0, QTime *localTime = 0); + QDate *localDate = nullptr, QTime *localTime = nullptr); // Inlined for its one caller in qdatetime.cpp inline void setUtcOffsetByTZ(qint64 atMSecsSinceEpoch); diff --git a/src/corelib/tools/qdatetimeparser_p.h b/src/corelib/tools/qdatetimeparser_p.h index f7e6e351fe..e244fed09a 100644 --- a/src/corelib/tools/qdatetimeparser_p.h +++ b/src/corelib/tools/qdatetimeparser_p.h @@ -86,7 +86,7 @@ public: DateTimeEdit }; QDateTimeParser(QVariant::Type t, Context ctx) - : currentSectionIndex(-1), display(0), cachedDay(-1), parserType(t), + : currentSectionIndex(-1), display(nullptr), cachedDay(-1), parserType(t), fixday(false), spec(Qt::LocalTime), context(ctx) { defaultLocale = QLocale::system(); @@ -218,9 +218,9 @@ private: ParsedSection parseSection(const QDateTime ¤tValue, int sectionIndex, int offset, QString *text) const; int findMonth(const QString &str1, int monthstart, int sectionIndex, - QString *monthName = 0, int *used = 0) const; + QString *monthName = nullptr, int *used = nullptr) const; int findDay(const QString &str1, int intDaystart, int sectionIndex, - QString *dayName = 0, int *used = 0) const; + QString *dayName = nullptr, int *used = nullptr) const; ParsedSection findTimeZone(QStringRef str, const QDateTime &when, int maxVal, int minVal) const; #if QT_CONFIG(timezone) @@ -236,7 +236,7 @@ private: PossiblePM = 3, PossibleBoth = 4 }; - AmPmFinder findAmPm(QString &str, int index, int *used = 0) const; + AmPmFinder findAmPm(QString &str, int index, int *used = nullptr) const; #endif // datestring bool potentialValue(const QStringRef &str, int min, int max, int index, diff --git a/src/corelib/tools/qfreelist_p.h b/src/corelib/tools/qfreelist_p.h index 63be0952ff..d72d6e1b4b 100644 --- a/src/corelib/tools/qfreelist_p.h +++ b/src/corelib/tools/qfreelist_p.h @@ -249,11 +249,11 @@ inline int QFreeList<T, ConstantsType>::next() if (!v) { v = allocate((id & ConstantsType::IndexMask) - at, ConstantsType::Sizes[block]); - if (!_v[block].testAndSetRelease(0, v)) { + if (!_v[block].testAndSetRelease(nullptr, v)) { // race with another thread lost delete [] v; v = _v[block].loadAcquire(); - Q_ASSERT(v != 0); + Q_ASSERT(v != nullptr); } } diff --git a/src/corelib/tools/qline.cpp b/src/corelib/tools/qline.cpp index 949f63ea15..6f3c22a6ec 100644 --- a/src/corelib/tools/qline.cpp +++ b/src/corelib/tools/qline.cpp @@ -805,6 +805,7 @@ qreal QLineF::angleTo(const QLineF &l) const return delta_normalized; } +#if QT_DEPRECATED_SINCE(5, 14) /*! \fn qreal QLineF::angle(const QLineF &line) const @@ -837,6 +838,7 @@ qreal QLineF::angle(const QLineF &l) const if (cos_line >= -1.0 && cos_line <= 1.0) rad = qAcos( cos_line ); return rad * 360 / M_2PI; } +#endif #ifndef QT_NO_DEBUG_STREAM diff --git a/src/corelib/tools/qline.h b/src/corelib/tools/qline.h index 6361c1af9f..14980b60a0 100644 --- a/src/corelib/tools/qline.h +++ b/src/corelib/tools/qline.h @@ -251,7 +251,10 @@ public: // ### Qt 6: rename intersects() or intersection() and rename IntersectType IntersectionType IntersectType intersect(const QLineF &l, QPointF *intersectionPoint) const; +#if QT_DEPRECATED_SINCE(5, 14) + QT_DEPRECATED_X("Use angleTo() instead, take care that the return value is between 0 and 360 degree.") qreal angle(const QLineF &l) const; +#endif Q_DECL_CONSTEXPR inline QPointF pointAt(qreal t) const; inline void translate(const QPointF &p); diff --git a/src/corelib/tools/qlist.h b/src/corelib/tools/qlist.h index 6643288bd5..34577acaa5 100644 --- a/src/corelib/tools/qlist.h +++ b/src/corelib/tools/qlist.h @@ -526,7 +526,7 @@ inline typename QList<T>::iterator QList<T>::insert(iterator before, const T &t) Q_ASSERT_X(isValidIterator(before), "QList::insert", "The specified iterator argument 'before' is invalid"); int iBefore = int(before.i - reinterpret_cast<Node *>(p.begin())); - Node *n = 0; + Node *n = nullptr; if (d->ref.isShared()) n = detach_helper_grow(iBefore, 1); else diff --git a/src/corelib/tools/qlocale_p.h b/src/corelib/tools/qlocale_p.h index 98b6a31a46..1e8dc28fbf 100644 --- a/src/corelib/tools/qlocale_p.h +++ b/src/corelib/tools/qlocale_p.h @@ -249,7 +249,7 @@ public: if (qIsInf(d)) return float(d); if (std::fabs(d) > std::numeric_limits<float>::max()) { - if (ok != 0) + if (ok != nullptr) *ok = false; const float huge = std::numeric_limits<float>::infinity(); return d < 0 ? -huge : huge; diff --git a/src/corelib/tools/qpair.h b/src/corelib/tools/qpair.h index 94977fc826..1af43d0a68 100644 --- a/src/corelib/tools/qpair.h +++ b/src/corelib/tools/qpair.h @@ -97,6 +97,11 @@ struct QPair T2 second; }; +#if defined(__cpp_deduction_guides) && __cpp_deduction_guides >= 201606 +template<class T1, class T2> +QPair(T1, T2) -> QPair<T1, T2>; +#endif + template <typename T1, typename T2> void swap(QPair<T1, T2> &lhs, QPair<T1, T2> &rhs) Q_DECL_NOEXCEPT_EXPR(noexcept(lhs.swap(rhs))) { lhs.swap(rhs); } diff --git a/src/corelib/tools/qregexp.cpp b/src/corelib/tools/qregexp.cpp index 87b30c952e..589eb74520 100644 --- a/src/corelib/tools/qregexp.cpp +++ b/src/corelib/tools/qregexp.cpp @@ -58,9 +58,6 @@ QT_BEGIN_NAMESPACE -int qFindString(const QChar *haystack, int haystackLen, int from, - const QChar *needle, int needleLen, Qt::CaseSensitivity cs); - // error strings for the regexp parser #define RXERR_OK QT_TRANSLATE_NOOP("QRegExp", "no error occurred") #define RXERR_DISABLED QT_TRANSLATE_NOOP("QRegExp", "disabled feature used") @@ -1423,7 +1420,8 @@ void QRegExpMatchState::match(const QChar *str0, int len0, int pos0, #ifndef QT_NO_REGEXP_OPTIM if (eng->trivial && !oneTest) { - pos = qFindString(str0, len0, pos0, eng->goodStr.unicode(), eng->goodStr.length(), eng->cs); + // ### Qt6: qsize + pos = int(QtPrivate::findString(QStringView(str0, len0), pos0, QStringView(eng->goodStr.unicode(), eng->goodStr.length()), eng->cs)); matchLen = eng->goodStr.length(); matched = (pos != -1); } else diff --git a/src/corelib/tools/qscopedvaluerollback.h b/src/corelib/tools/qscopedvaluerollback.h index 5f76269388..f904b8dfcb 100644 --- a/src/corelib/tools/qscopedvaluerollback.h +++ b/src/corelib/tools/qscopedvaluerollback.h @@ -48,20 +48,20 @@ template <typename T> class QScopedValueRollback { public: - explicit QScopedValueRollback(T &var) : - varRef(var), oldValue(var) + explicit QScopedValueRollback(T &var) + : varRef(var), oldValue(var) { } - explicit QScopedValueRollback(T &var, T value) : - varRef(var), oldValue(var) + explicit QScopedValueRollback(T &var, T value) + : varRef(var), oldValue(std::move(var)) { - varRef = qMove(value); + varRef = std::move(value); } ~QScopedValueRollback() { - varRef = qMove(oldValue); + varRef = std::move(oldValue); } void commit() @@ -70,7 +70,7 @@ public: } private: - T& varRef; + T &varRef; T oldValue; Q_DISABLE_COPY(QScopedValueRollback) diff --git a/src/corelib/tools/qstring.cpp b/src/corelib/tools/qstring.cpp index 9d6e0cbdd8..65519d1f98 100644 --- a/src/corelib/tools/qstring.cpp +++ b/src/corelib/tools/qstring.cpp @@ -2,6 +2,7 @@ ** ** Copyright (C) 2016 The Qt Company Ltd. ** Copyright (C) 2018 Intel Corporation. +** Copyright (C) 2019 Mail.ru Group. ** Contact: https://www.qt.io/licensing/ ** ** This file is part of the QtCore module of the Qt Toolkit. @@ -142,19 +143,11 @@ extern "C" void qt_toLatin1_mips_dsp_asm(uchar *dst, const ushort *src, int leng #endif // internal -int qFindString(const QChar *haystack, int haystackLen, int from, - const QChar *needle, int needleLen, Qt::CaseSensitivity cs); -int qFindStringBoyerMoore(const QChar *haystack, int haystackLen, int from, - const QChar *needle, int needleLen, Qt::CaseSensitivity cs); -static inline int qt_last_index_of(const QChar *haystack, int haystackLen, QChar needle, - int from, Qt::CaseSensitivity cs); -static inline int qt_string_count(const QChar *haystack, int haystackLen, - const QChar *needle, int needleLen, - Qt::CaseSensitivity cs); -static inline int qt_string_count(const QChar *haystack, int haystackLen, - QChar needle, Qt::CaseSensitivity cs); -static inline int qt_find_latin1_string(const QChar *hay, int size, QLatin1String needle, - int from, Qt::CaseSensitivity cs); +qsizetype qFindStringBoyerMoore(QStringView haystack, qsizetype from, QStringView needle, Qt::CaseSensitivity cs); +static inline qsizetype qt_last_index_of(QStringView haystack, QChar needle, qsizetype from, Qt::CaseSensitivity cs); +static inline qsizetype qt_string_count(QStringView haystack, QStringView needle, Qt::CaseSensitivity cs); +static inline qsizetype qt_string_count(QStringView haystack, QChar needle, Qt::CaseSensitivity cs); + static inline bool qt_starts_with(QStringView haystack, QStringView needle, Qt::CaseSensitivity cs); static inline bool qt_starts_with(QStringView haystack, QLatin1String needle, Qt::CaseSensitivity cs); static inline bool qt_starts_with(QStringView haystack, QChar needle, Qt::CaseSensitivity cs); @@ -1283,42 +1276,9 @@ int QtPrivate::compareStrings(QLatin1String lhs, QLatin1String rhs, Qt::CaseSens return qt_compare_strings(lhs, rhs, cs); } -/*! - \internal - - Returns the index position of the first occurrence of the - character \a ch in the string given by \a str and \a len, - searching forward from index - position \a from. Returns -1 if \a ch could not be found. -*/ -static int findChar(const QChar *str, int len, QChar ch, int from, - Qt::CaseSensitivity cs) -{ - const ushort *s = (const ushort *)str; - ushort c = ch.unicode(); - if (from < 0) - from = qMax(from + len, 0); - if (from < len) { - const ushort *n = s + from; - const ushort *e = s + len; - if (cs == Qt::CaseSensitive) { - n = QtPrivate::qustrchr(QStringView(n, e), c); - if (n != e) - return n - s; - } else { - c = foldCase(c); - --n; - while (++n != e) - if (foldCase(*n) == c) - return n - s; - } - } - return -1; -} - #define REHASH(a) \ - if (sl_minus_1 < sizeof(uint) * CHAR_BIT) \ - hashHaystack -= uint(a) << sl_minus_1; \ + if (sl_minus_1 < sizeof(std::size_t) * CHAR_BIT) \ + hashHaystack -= std::size_t(a) << sl_minus_1; \ hashHaystack <<= 1 inline bool qIsUpper(char ch) @@ -2086,7 +2046,7 @@ int QString::toUcs4_helper(const ushort *uc, int length, uint *out) \note This function does not append a null character to the array. - \sa utf16(), toUcs4(), toLatin1(), toUtf8(), toLocal8Bit(), toStdWString() + \sa utf16(), toUcs4(), toLatin1(), toUtf8(), toLocal8Bit(), toStdWString(), QStringView::toWCharArray() */ /*! \fn QString::QString(const QString &other) @@ -3735,7 +3695,8 @@ bool QString::operator>(QLatin1String other) const Q_DECL_NOTHROW */ int QString::indexOf(const QString &str, int from, Qt::CaseSensitivity cs) const { - return qFindString(unicode(), length(), from, str.unicode(), str.length(), cs); + // ### Qt6: qsize + return int(QtPrivate::findString(QStringView(unicode(), length()), from, QStringView(str.unicode(), str.length()), cs)); } /*! @@ -3759,85 +3720,8 @@ int QString::indexOf(const QString &str, int from, Qt::CaseSensitivity cs) const int QString::indexOf(QLatin1String str, int from, Qt::CaseSensitivity cs) const { - return qt_find_latin1_string(unicode(), size(), str, from, cs); -} - -int qFindString( - const QChar *haystack0, int haystackLen, int from, - const QChar *needle0, int needleLen, Qt::CaseSensitivity cs) -{ - const int l = haystackLen; - const int sl = needleLen; - if (from < 0) - from += l; - if (uint(sl + from) > (uint)l) - return -1; - if (!sl) - return from; - if (!l) - return -1; - - if (sl == 1) - return findChar(haystack0, haystackLen, needle0[0], from, cs); - - /* - We use the Boyer-Moore algorithm in cases where the overhead - for the skip table should pay off, otherwise we use a simple - hash function. - */ - if (l > 500 && sl > 5) - return qFindStringBoyerMoore(haystack0, haystackLen, from, - needle0, needleLen, cs); - - auto sv = [sl](const ushort *v) { return QStringView(v, sl); }; - /* - We use some hashing for efficiency's sake. Instead of - comparing strings, we compare the hash value of str with that - of a part of this QString. Only if that matches, we call - qt_string_compare(). - */ - const ushort *needle = (const ushort *)needle0; - const ushort *haystack = (const ushort *)haystack0 + from; - const ushort *end = (const ushort *)haystack0 + (l-sl); - const uint sl_minus_1 = sl - 1; - uint hashNeedle = 0, hashHaystack = 0; - int idx; - - if (cs == Qt::CaseSensitive) { - for (idx = 0; idx < sl; ++idx) { - hashNeedle = ((hashNeedle<<1) + needle[idx]); - hashHaystack = ((hashHaystack<<1) + haystack[idx]); - } - hashHaystack -= haystack[sl_minus_1]; - - while (haystack <= end) { - hashHaystack += haystack[sl_minus_1]; - if (hashHaystack == hashNeedle - && qt_compare_strings(sv(needle), sv(haystack), Qt::CaseSensitive) == 0) - return haystack - (const ushort *)haystack0; - - REHASH(*haystack); - ++haystack; - } - } else { - const ushort *haystack_start = (const ushort *)haystack0; - for (idx = 0; idx < sl; ++idx) { - hashNeedle = (hashNeedle<<1) + foldCase(needle + idx, needle); - hashHaystack = (hashHaystack<<1) + foldCase(haystack + idx, haystack_start); - } - hashHaystack -= foldCase(haystack + sl_minus_1, haystack_start); - - while (haystack <= end) { - hashHaystack += foldCase(haystack + sl_minus_1, haystack_start); - if (hashHaystack == hashNeedle - && qt_compare_strings(sv(needle), sv(haystack), Qt::CaseInsensitive) == 0) - return haystack - (const ushort *)haystack0; - - REHASH(foldCase(haystack, haystack_start)); - ++haystack; - } - } - return -1; + // ### Qt6: qsize + return int(QtPrivate::findString(QStringView(unicode(), size()), from, str, cs)); } /*! @@ -3849,7 +3733,8 @@ int qFindString( */ int QString::indexOf(QChar ch, int from, Qt::CaseSensitivity cs) const { - return findChar(unicode(), length(), ch, from, cs); + // ### Qt6: qsize + return int(QtPrivate::findChar(QStringView(unicode(), length()), ch, from, cs)); } /*! @@ -3866,7 +3751,8 @@ int QString::indexOf(QChar ch, int from, Qt::CaseSensitivity cs) const */ int QString::indexOf(const QStringRef &str, int from, Qt::CaseSensitivity cs) const { - return qFindString(unicode(), length(), from, str.unicode(), str.length(), cs); + // ### Qt6: qsize + return int(QtPrivate::findString(QStringView(unicode(), length()), from, QStringView(str.unicode(), str.length()), cs)); } static int lastIndexOfHelper(const ushort *haystack, int from, const ushort *needle, int sl, Qt::CaseSensitivity cs) @@ -3989,7 +3875,8 @@ int QString::lastIndexOf(QLatin1String str, int from, Qt::CaseSensitivity cs) co */ int QString::lastIndexOf(QChar ch, int from, Qt::CaseSensitivity cs) const { - return qt_last_index_of(unicode(), size(), ch, from, cs); + // ### Qt6: qsize + return int(qt_last_index_of(QStringView(unicode(), size()), ch, from, cs)); } /*! @@ -4322,7 +4209,8 @@ QString &QString::replace(const QRegularExpression &re, const QString &after) int QString::count(const QString &str, Qt::CaseSensitivity cs) const { - return qt_string_count(unicode(), size(), str.unicode(), str.size(), cs); + // ### Qt6: qsize + return int(qt_string_count(QStringView(unicode(), size()), QStringView(str.unicode(), str.size()), cs)); } /*! @@ -4338,8 +4226,9 @@ int QString::count(const QString &str, Qt::CaseSensitivity cs) const int QString::count(QChar ch, Qt::CaseSensitivity cs) const { - return qt_string_count(unicode(), size(), ch, cs); - } + // ### Qt6: qsize + return int(qt_string_count(QStringView(unicode(), size()), ch, cs)); +} /*! \since 4.8 @@ -4354,7 +4243,8 @@ int QString::count(QChar ch, Qt::CaseSensitivity cs) const */ int QString::count(const QStringRef &str, Qt::CaseSensitivity cs) const { - return qt_string_count(unicode(), size(), str.unicode(), str.size(), cs); + // ### Qt6: qsize + return int(qt_string_count(QStringView(unicode(), size()), QStringView(str.unicode(), str.size()), cs)); } @@ -6831,6 +6721,7 @@ QString QString::toUpper_helper(QString &str) return QUnicodeTables::convertCase<QUnicodeTables::UppercaseTraits>(str); } +#if QT_DEPRECATED_SINCE(5, 14) /*! \obsolete @@ -6844,6 +6735,7 @@ QString &QString::sprintf(const char *cformat, ...) va_end(ap); return *this; } +#endif // ### Qt 6: Consider whether this function shouldn't be removed See task 202871. /*! @@ -6889,6 +6781,7 @@ QString QString::asprintf(const char *cformat, ...) return s; } +#if QT_DEPRECATED_SINCE(5, 14) /*! \obsolete @@ -6898,6 +6791,7 @@ QString &QString::vsprintf(const char *cformat, va_list ap) { return *this = vasprintf(cformat, ap); } +#endif static void append_utf8(QString &qs, const char *cs, int len) { @@ -7778,10 +7672,10 @@ static ResultList splitString(const StringSource &source, const QChar *sep, QString::SplitBehavior behavior, Qt::CaseSensitivity cs, const int separatorSize) { ResultList list; - int start = 0; - int end; - int extra = 0; - while ((end = qFindString(source.constData(), source.size(), start + extra, sep, separatorSize, cs)) != -1) { + typename StringSource::size_type start = 0; + typename StringSource::size_type end; + typename StringSource::size_type extra = 0; + while ((end = QtPrivate::findString(QStringView(source.constData(), source.size()), start + extra, QStringView(sep, separatorSize), cs)) != -1) { if (start != end || behavior == QString::KeepEmptyParts) list.append(source.mid(start, end - start)); start = end + separatorSize; @@ -11154,7 +11048,8 @@ QStringRef QString::midRef(int position, int n) const */ int QStringRef::indexOf(const QString &str, int from, Qt::CaseSensitivity cs) const { - return qFindString(unicode(), length(), from, str.unicode(), str.length(), cs); + // ### Qt6: qsize + return int(QtPrivate::findString(QStringView(unicode(), length()), from, QStringView(str.unicode(), str.length()), cs)); } /*! @@ -11169,7 +11064,8 @@ int QStringRef::indexOf(const QString &str, int from, Qt::CaseSensitivity cs) co */ int QStringRef::indexOf(QChar ch, int from, Qt::CaseSensitivity cs) const { - return findChar(unicode(), length(), ch, from, cs); + // ### Qt6: qsize + return int(QtPrivate::findChar(QStringView(unicode(), length()), ch, from, cs)); } /*! @@ -11189,7 +11085,8 @@ int QStringRef::indexOf(QChar ch, int from, Qt::CaseSensitivity cs) const */ int QStringRef::indexOf(QLatin1String str, int from, Qt::CaseSensitivity cs) const { - return qt_find_latin1_string(unicode(), size(), str, from, cs); + // ### Qt6: qsize + return int(QtPrivate::findString(QStringView(unicode(), size()), from, str, cs)); } /*! @@ -11208,7 +11105,8 @@ int QStringRef::indexOf(QLatin1String str, int from, Qt::CaseSensitivity cs) con */ int QStringRef::indexOf(const QStringRef &str, int from, Qt::CaseSensitivity cs) const { - return qFindString(unicode(), size(), from, str.unicode(), str.size(), cs); + // ### Qt6: qsize + return int(QtPrivate::findString(QStringView(unicode(), size()), from, QStringView(str.unicode(), str.size()), cs)); } /*! @@ -11241,7 +11139,8 @@ int QStringRef::lastIndexOf(const QString &str, int from, Qt::CaseSensitivity cs */ int QStringRef::lastIndexOf(QChar ch, int from, Qt::CaseSensitivity cs) const { - return qt_last_index_of(unicode(), size(), ch, from, cs); + // ### Qt6: qsize + return int(qt_last_index_of(QStringView(unicode(), size()), ch, from, cs)); } template<typename T> @@ -11317,7 +11216,8 @@ int QStringRef::lastIndexOf(const QStringRef &str, int from, Qt::CaseSensitivity */ int QStringRef::count(const QString &str, Qt::CaseSensitivity cs) const { - return qt_string_count(unicode(), size(), str.unicode(), str.size(), cs); + // ### Qt6: qsize + return int(qt_string_count(QStringView(unicode(), size()), QStringView(str.unicode(), str.size()), cs)); } /*! @@ -11334,7 +11234,8 @@ int QStringRef::count(const QString &str, Qt::CaseSensitivity cs) const */ int QStringRef::count(QChar ch, Qt::CaseSensitivity cs) const { - return qt_string_count(unicode(), size(), ch, cs); + // ### Qt6: qsize + return int(qt_string_count(QStringView(unicode(), size()), ch, cs)); } /*! @@ -11351,7 +11252,8 @@ int QStringRef::count(QChar ch, Qt::CaseSensitivity cs) const */ int QStringRef::count(const QStringRef &str, Qt::CaseSensitivity cs) const { - return qt_string_count(unicode(), size(), str.unicode(), str.size(), cs); + // ### Qt6: qsize + return int(qt_string_count(QStringView(unicode(), size()), QStringView(str.unicode(), str.size()), cs)); } /*! @@ -11588,16 +11490,16 @@ bool QStringRef::endsWith(const QStringRef &str, Qt::CaseSensitivity cs) const \sa indexOf(), count() */ -static inline int qt_last_index_of(const QChar *haystack, int haystackLen, QChar needle, - int from, Qt::CaseSensitivity cs) +static inline qsizetype qt_last_index_of(QStringView haystack, QChar needle, + qsizetype from, Qt::CaseSensitivity cs) { - ushort c = needle.unicode(); if (from < 0) - from += haystackLen; - if (uint(from) >= uint(haystackLen)) + from += haystack.size(); + if (std::size_t(from) >= std::size_t(haystack.size())) return -1; if (from >= 0) { - const ushort *b = reinterpret_cast<const ushort*>(haystack); + ushort c = needle.unicode(); + const ushort *b = reinterpret_cast<const ushort*>(haystack.data()); const ushort *n = b + from; if (cs == Qt::CaseSensitive) { for (; n >= b; --n) @@ -11615,30 +11517,28 @@ static inline int qt_last_index_of(const QChar *haystack, int haystackLen, QChar } -static inline int qt_string_count(const QChar *haystack, int haystackLen, - const QChar *needle, int needleLen, - Qt::CaseSensitivity cs) +static inline qsizetype qt_string_count(QStringView haystack, QStringView needle, Qt::CaseSensitivity cs) { - int num = 0; - int i = -1; - if (haystackLen > 500 && needleLen > 5) { - QStringMatcher matcher(needle, needleLen, cs); - while ((i = matcher.indexIn(haystack, haystackLen, i + 1)) != -1) + qsizetype num = 0; + qsizetype i = -1; + if (haystack.size() > 500 && needle.size() > 5) { + QStringMatcher matcher(needle, cs); + while ((i = matcher.indexIn(haystack, i + 1)) != -1) ++num; } else { - while ((i = qFindString(haystack, haystackLen, i + 1, needle, needleLen, cs)) != -1) + while ((i = QtPrivate::findString(haystack, i + 1, needle, cs)) != -1) ++num; } return num; } -static inline int qt_string_count(const QChar *unicode, int size, QChar ch, +static inline qsizetype qt_string_count(QStringView haystack, QChar ch, Qt::CaseSensitivity cs) { ushort c = ch.unicode(); - int num = 0; - const ushort *b = reinterpret_cast<const ushort*>(unicode); - const ushort *i = b + size; + qsizetype num = 0; + const ushort *b = reinterpret_cast<const ushort*>(haystack.data()); + const ushort *i = b + haystack.size(); if (cs == Qt::CaseSensitive) { while (i != b) if (*--i == c) @@ -11652,22 +11552,6 @@ static inline int qt_string_count(const QChar *unicode, int size, QChar ch, return num; } -static inline int qt_find_latin1_string(const QChar *haystack, int size, - QLatin1String needle, - int from, Qt::CaseSensitivity cs) -{ - if (size < needle.size()) - return -1; - - const char *latin1 = needle.latin1(); - int len = needle.size(); - QVarLengthArray<ushort> s(len); - qt_from_latin1(s.data(), latin1, len); - - return qFindString(haystack, size, from, - reinterpret_cast<const QChar*>(s.constData()), len, cs); -} - template <typename Haystack, typename Needle> bool qt_starts_with_impl(Haystack haystack, Needle needle, Qt::CaseSensitivity cs) Q_DECL_NOTHROW { @@ -11815,6 +11699,127 @@ bool QtPrivate::endsWith(QLatin1String haystack, QLatin1String needle, Qt::CaseS } /*! + \internal + + Returns the index position of the first occurrence of the + character \a ch in the string given by \a str and \a len, + searching forward from index + position \a from. Returns -1 if \a ch could not be found. +*/ + +qsizetype QtPrivate::findChar(QStringView str, QChar ch, qsizetype from, Qt::CaseSensitivity cs) Q_DECL_NOTHROW +{ + if (from < 0) + from = qMax(from + str.size(), qsizetype(0)); + if (from < str.size()) { + const ushort *s = (const ushort *)str.data(); + ushort c = ch.unicode(); + const ushort *n = s + from; + const ushort *e = s + str.size(); + if (cs == Qt::CaseSensitive) { + n = QtPrivate::qustrchr(QStringView(n, e), c); + if (n != e) + return n - s; + } else { + c = foldCase(c); + --n; + while (++n != e) + if (foldCase(*n) == c) + return n - s; + } + } + return -1; +} + +qsizetype QtPrivate::findString(QStringView haystack0, qsizetype from, QStringView needle0, Qt::CaseSensitivity cs) Q_DECL_NOTHROW +{ + const qsizetype l = haystack0.size(); + const qsizetype sl = needle0.size(); + if (from < 0) + from += l; + if (std::size_t(sl + from) > std::size_t(l)) + return -1; + if (!sl) + return from; + if (!l) + return -1; + + if (sl == 1) + return QtPrivate::findChar(haystack0, needle0[0], from, cs); + + /* + We use the Boyer-Moore algorithm in cases where the overhead + for the skip table should pay off, otherwise we use a simple + hash function. + */ + if (l > 500 && sl > 5) + return qFindStringBoyerMoore(haystack0, from, needle0, cs); + + auto sv = [sl](const ushort *v) { return QStringView(v, sl); }; + /* + We use some hashing for efficiency's sake. Instead of + comparing strings, we compare the hash value of str with that + of a part of this QString. Only if that matches, we call + qt_string_compare(). + */ + const ushort *needle = (const ushort *)needle0.data(); + const ushort *haystack = (const ushort *)(haystack0.data()) + from; + const ushort *end = (const ushort *)(haystack0.data()) + (l - sl); + const std::size_t sl_minus_1 = sl - 1; + std::size_t hashNeedle = 0, hashHaystack = 0; + qsizetype idx; + + if (cs == Qt::CaseSensitive) { + for (idx = 0; idx < sl; ++idx) { + hashNeedle = ((hashNeedle<<1) + needle[idx]); + hashHaystack = ((hashHaystack<<1) + haystack[idx]); + } + hashHaystack -= haystack[sl_minus_1]; + + while (haystack <= end) { + hashHaystack += haystack[sl_minus_1]; + if (hashHaystack == hashNeedle + && qt_compare_strings(needle0, sv(haystack), Qt::CaseSensitive) == 0) + return haystack - (const ushort *)haystack0.data(); + + REHASH(*haystack); + ++haystack; + } + } else { + const ushort *haystack_start = (const ushort *)haystack0.data(); + for (idx = 0; idx < sl; ++idx) { + hashNeedle = (hashNeedle<<1) + foldCase(needle + idx, needle); + hashHaystack = (hashHaystack<<1) + foldCase(haystack + idx, haystack_start); + } + hashHaystack -= foldCase(haystack + sl_minus_1, haystack_start); + + while (haystack <= end) { + hashHaystack += foldCase(haystack + sl_minus_1, haystack_start); + if (hashHaystack == hashNeedle + && qt_compare_strings(needle0, sv(haystack), Qt::CaseInsensitive) == 0) + return haystack - (const ushort *)haystack0.data(); + + REHASH(foldCase(haystack, haystack_start)); + ++haystack; + } + } + return -1; +} + +qsizetype QtPrivate::findString(QStringView haystack, qsizetype from, QLatin1String needle, Qt::CaseSensitivity cs) Q_DECL_NOTHROW +{ + if (haystack.size() < needle.size()) + return -1; + + const char *latin1 = needle.latin1(); + const qsizetype len = needle.size(); + QVarLengthArray<ushort> s(len); + qt_from_latin1(s.data(), latin1, len); + + return QtPrivate::findString(haystack, from, QStringView(reinterpret_cast<const QChar*>(s.constData()), len), cs); +} + +/*! \since 4.8 Returns a Latin-1 representation of the string as a QByteArray. diff --git a/src/corelib/tools/qstring.h b/src/corelib/tools/qstring.h index da76601e88..e9a205dfdf 100644 --- a/src/corelib/tools/qstring.h +++ b/src/corelib/tools/qstring.h @@ -320,8 +320,12 @@ public: const QString &a4, const QString &a5, const QString &a6, const QString &a7, const QString &a8, const QString &a9) const; +#if QT_DEPRECATED_SINCE(5, 14) + QT_DEPRECATED_X("Use vasprintf(), arg() or QTextStream instead") QString &vsprintf(const char *format, va_list ap) Q_ATTRIBUTE_FORMAT_PRINTF(2, 0); + QT_DEPRECATED_X("Use asprintf(), arg() or QTextStream instead") QString &sprintf(const char *format, ...) Q_ATTRIBUTE_FORMAT_PRINTF(2, 3); +#endif static QString vasprintf(const char *format, va_list ap) Q_ATTRIBUTE_FORMAT_PRINTF(1, 0); static QString asprintf(const char *format, ...) Q_ATTRIBUTE_FORMAT_PRINTF(1, 2); @@ -1017,12 +1021,7 @@ QT_WARNING_DISABLE_INTEL(111) // "statement is unreachable" inline int QString::toWCharArray(wchar_t *array) const { - if (sizeof(wchar_t) == sizeof(QChar)) { - memcpy(array, d->data(), sizeof(QChar) * size()); - return size(); - } else { - return toUcs4_helper(d->data(), size(), reinterpret_cast<uint *>(array)); - } + return QStringView(*this).toWCharArray(array); } QT_WARNING_POP @@ -1376,14 +1375,12 @@ inline std::wstring QString::toStdWString() const { std::wstring str; str.resize(length()); - -#ifdef Q_CC_MSVC - // VS2005 crashes if the string is empty - if (!length()) - return str; +#if __cplusplus >= 201703L + str.resize(toWCharArray(str.data())); +#else + if (length()) + str.resize(toWCharArray(&str.front())); #endif - - str.resize(toWCharArray(&(*str.begin()))); return str; } diff --git a/src/corelib/tools/qstringalgorithms.h b/src/corelib/tools/qstringalgorithms.h index cc0eda71f3..e94f725598 100644 --- a/src/corelib/tools/qstringalgorithms.h +++ b/src/corelib/tools/qstringalgorithms.h @@ -51,6 +51,7 @@ QT_BEGIN_NAMESPACE class QByteArray; class QLatin1String; class QStringView; +class QChar; template <typename T> class QVector; namespace QtPrivate { @@ -74,6 +75,10 @@ Q_REQUIRED_RESULT Q_CORE_EXPORT Q_DECL_PURE_FUNCTION bool endsWith(QStringView Q_REQUIRED_RESULT Q_CORE_EXPORT Q_DECL_PURE_FUNCTION bool endsWith(QLatin1String haystack, QStringView needle, Qt::CaseSensitivity cs = Qt::CaseSensitive) Q_DECL_NOTHROW; Q_REQUIRED_RESULT Q_CORE_EXPORT Q_DECL_PURE_FUNCTION bool endsWith(QLatin1String haystack, QLatin1String needle, Qt::CaseSensitivity cs = Qt::CaseSensitive) Q_DECL_NOTHROW; +Q_REQUIRED_RESULT Q_CORE_EXPORT Q_DECL_PURE_FUNCTION qsizetype findChar(QStringView str, QChar ch, qsizetype from, Qt::CaseSensitivity cs = Qt::CaseSensitive) Q_DECL_NOTHROW; +Q_REQUIRED_RESULT Q_CORE_EXPORT Q_DECL_PURE_FUNCTION qsizetype findString(QStringView haystack, qsizetype from, QStringView needle, Qt::CaseSensitivity cs = Qt::CaseSensitive) Q_DECL_NOTHROW; +Q_REQUIRED_RESULT Q_CORE_EXPORT Q_DECL_PURE_FUNCTION qsizetype findString(QStringView haystack, qsizetype from, QLatin1String needle, Qt::CaseSensitivity cs = Qt::CaseSensitive) Q_DECL_NOTHROW; + Q_REQUIRED_RESULT Q_CORE_EXPORT Q_DECL_PURE_FUNCTION QStringView trimmed(QStringView s) Q_DECL_NOTHROW; Q_REQUIRED_RESULT Q_CORE_EXPORT Q_DECL_PURE_FUNCTION QLatin1String trimmed(QLatin1String s) Q_DECL_NOTHROW; diff --git a/src/corelib/tools/qstringmatcher.cpp b/src/corelib/tools/qstringmatcher.cpp index 67d3f0ebc8..417910b6ec 100644 --- a/src/corelib/tools/qstringmatcher.cpp +++ b/src/corelib/tools/qstringmatcher.cpp @@ -1,6 +1,7 @@ /**************************************************************************** ** ** Copyright (C) 2016 The Qt Company Ltd. +** Copyright (C) 2019 Mail.ru Group. ** Contact: https://www.qt.io/licensing/ ** ** This file is part of the QtCore module of the Qt Toolkit. @@ -41,43 +42,43 @@ QT_BEGIN_NAMESPACE -static void bm_init_skiptable(const ushort *uc, int len, uchar *skiptable, Qt::CaseSensitivity cs) +static void bm_init_skiptable(const ushort *uc, qsizetype len, uchar *skiptable, Qt::CaseSensitivity cs) { - int l = qMin(len, 255); - memset(skiptable, l, 256*sizeof(uchar)); + int l = int(qMin(len, qsizetype(255))); + memset(skiptable, l, 256 * sizeof(uchar)); uc += len - l; if (cs == Qt::CaseSensitive) { while (l--) { skiptable[*uc & 0xff] = l; - uc++; + ++uc; } } else { const ushort *start = uc; while (l--) { skiptable[foldCase(uc, start) & 0xff] = l; - uc++; + ++uc; } } } -static inline int bm_find(const ushort *uc, uint l, int index, const ushort *puc, uint pl, +static inline qsizetype bm_find(const ushort *uc, qsizetype l, qsizetype index, const ushort *puc, qsizetype pl, const uchar *skiptable, Qt::CaseSensitivity cs) { if (pl == 0) - return index > (int)l ? -1 : index; - const uint pl_minus_one = pl - 1; + return index > l ? -1 : index; + const qsizetype pl_minus_one = pl - 1; const ushort *current = uc + index + pl_minus_one; const ushort *end = uc + l; if (cs == Qt::CaseSensitive) { while (current < end) { - uint skip = skiptable[*current & 0xff]; + qsizetype skip = skiptable[*current & 0xff]; if (!skip) { // possible match while (skip < pl) { if (*(current - skip) != puc[pl_minus_one-skip]) break; - skip++; + ++skip; } if (skip > pl_minus_one) // we have a match return (current - uc) - pl_minus_one; @@ -95,13 +96,13 @@ static inline int bm_find(const ushort *uc, uint l, int index, const ushort *puc } } else { while (current < end) { - uint skip = skiptable[foldCase(current, uc) & 0xff]; + qsizetype skip = skiptable[foldCase(current, uc) & 0xff]; if (!skip) { // possible match while (skip < pl) { if (foldCase(current - skip, uc) != foldCase(puc + pl_minus_one - skip, puc)) break; - skip++; + ++skip; } if (skip > pl_minus_one) // we have a match return (current - uc) - pl_minus_one; @@ -175,14 +176,27 @@ QStringMatcher::QStringMatcher(const QString &pattern, Qt::CaseSensitivity cs) by \a uc with the given \a length and case sensitivity specified by \a cs. */ QStringMatcher::QStringMatcher(const QChar *uc, int len, Qt::CaseSensitivity cs) - : d_ptr(0), q_cs(cs) + : QStringMatcher(QStringView(uc, len), cs) { - p.uc = uc; - p.len = len; - bm_init_skiptable((const ushort *)p.uc, len, p.q_skiptable, cs); } /*! + \fn QStringMatcher::QStringMatcher(QStringView str, Qt::CaseSensitivity cs) + \since 5.14 + + Constructs a string matcher that will search for \a pattern, with + case sensitivity \a cs. + + Call indexIn() to perform a search. +*/ +QStringMatcher::QStringMatcher(QStringView str, Qt::CaseSensitivity cs) + : d_ptr(nullptr), q_cs(cs) +{ + p.uc = str.data(); + p.len = int(str.size()); + bm_init_skiptable((const ushort *)p.uc, p.len, p.q_skiptable, cs); +} +/*! Copies the \a other string matcher to this string matcher. */ QStringMatcher::QStringMatcher(const QStringMatcher &other) @@ -267,11 +281,7 @@ void QStringMatcher::setCaseSensitivity(Qt::CaseSensitivity cs) */ int QStringMatcher::indexIn(const QString &str, int from) const { - if (from < 0) - from = 0; - return bm_find((const ushort *)str.unicode(), str.size(), from, - (const ushort *)p.uc, p.len, - p.q_skiptable, q_cs); + return int(indexIn(QStringView(str), from)); } /*! @@ -288,9 +298,25 @@ int QStringMatcher::indexIn(const QString &str, int from) const */ int QStringMatcher::indexIn(const QChar *str, int length, int from) const { + return int(indexIn(QStringView(str, length), from)); +} + +/*! + \since 5.14 + + Searches the string \a str from character position \a from + (default 0, i.e. from the first character), for the string + pattern() that was set in the constructor or in the most recent + call to setPattern(). Returns the position where the pattern() + matched in \a str, or -1 if no match was found. + + \sa setPattern(), setCaseSensitivity() +*/ +qsizetype QStringMatcher::indexIn(QStringView str, qsizetype from) const +{ if (from < 0) from = 0; - return bm_find((const ushort *)str, length, from, + return bm_find((const ushort *)str.data(), str.size(), from, (const ushort *)p.uc, p.len, p.q_skiptable, q_cs); } @@ -307,16 +333,16 @@ int QStringMatcher::indexIn(const QChar *str, int length, int from) const \internal */ -int qFindStringBoyerMoore( - const QChar *haystack, int haystackLen, int haystackOffset, - const QChar *needle, int needleLen, Qt::CaseSensitivity cs) +qsizetype qFindStringBoyerMoore( + QStringView haystack, qsizetype haystackOffset, + QStringView needle, Qt::CaseSensitivity cs) { uchar skiptable[256]; - bm_init_skiptable((const ushort *)needle, needleLen, skiptable, cs); + bm_init_skiptable((const ushort *)needle.data(), needle.size(), skiptable, cs); if (haystackOffset < 0) haystackOffset = 0; - return bm_find((const ushort *)haystack, haystackLen, haystackOffset, - (const ushort *)needle, needleLen, skiptable, cs); + return bm_find((const ushort *)haystack.data(), haystack.size(), haystackOffset, + (const ushort *)needle.data(), needle.size(), skiptable, cs); } QT_END_NAMESPACE diff --git a/src/corelib/tools/qstringmatcher.h b/src/corelib/tools/qstringmatcher.h index 549bff9f29..6de4353930 100644 --- a/src/corelib/tools/qstringmatcher.h +++ b/src/corelib/tools/qstringmatcher.h @@ -1,6 +1,7 @@ /**************************************************************************** ** ** Copyright (C) 2016 The Qt Company Ltd. +** Copyright (C) 2019 Mail.ru Group. ** Contact: https://www.qt.io/licensing/ ** ** This file is part of the QtCore module of the Qt Toolkit. @@ -41,6 +42,7 @@ #define QSTRINGMATCHER_H #include <QtCore/qstring.h> +#include <QtCore/qstringview.h> QT_BEGIN_NAMESPACE @@ -55,6 +57,8 @@ public: Qt::CaseSensitivity cs = Qt::CaseSensitive); QStringMatcher(const QChar *uc, int len, Qt::CaseSensitivity cs = Qt::CaseSensitive); + QStringMatcher(QStringView pattern, + Qt::CaseSensitivity cs = Qt::CaseSensitive); QStringMatcher(const QStringMatcher &other); ~QStringMatcher(); @@ -65,6 +69,7 @@ public: int indexIn(const QString &str, int from = 0) const; int indexIn(const QChar *str, int length, int from = 0) const; + qsizetype indexIn(QStringView str, qsizetype from = 0) const; QString pattern() const; inline Qt::CaseSensitivity caseSensitivity() const { return q_cs; } diff --git a/src/corelib/tools/qstringview.cpp b/src/corelib/tools/qstringview.cpp index b97e989110..c863ca7ce2 100644 --- a/src/corelib/tools/qstringview.cpp +++ b/src/corelib/tools/qstringview.cpp @@ -38,6 +38,7 @@ ****************************************************************************/ #include "qstringview.h" +#include "qstring.h" QT_BEGIN_NAMESPACE @@ -794,4 +795,34 @@ QT_BEGIN_NAMESPACE \sa QString::isRightToLeft() */ +/*! + \since 5.14 + + Transcribes this string into the given \a array. + + Caller is responsible for ensuring \a array is large enough to hold the \t + wchar_t encoding of this string (allocating the array with the same length + as the string is always sufficient). The array is encoded in UTF-16 on + platforms where \t wchar_t is 2 bytes wide (e.g. Windows); otherwise (Unix + systems), \t wchar_t is assumed to be 4 bytes wide and the data is written + in UCS-4. + + \note This function writes no null terminator to the end of \a array. + + Returns the number of \t wchar_t entries written to \a array. + + \sa QString::toWCharArray() +*/ + +int QStringView::toWCharArray(wchar_t *array) const +{ + if (sizeof(wchar_t) == sizeof(QChar)) { + memcpy(array, data(), sizeof(QChar) * size()); + return size(); + } else { + return QString::toUcs4_helper(reinterpret_cast<const ushort *>(data()), int(size()), + reinterpret_cast<uint *>(array)); + } +} + QT_END_NAMESPACE diff --git a/src/corelib/tools/qstringview.h b/src/corelib/tools/qstringview.h index 2e95c2b218..4a900b5e89 100644 --- a/src/corelib/tools/qstringview.h +++ b/src/corelib/tools/qstringview.h @@ -272,6 +272,8 @@ public: Q_REQUIRED_RESULT bool isRightToLeft() const Q_DECL_NOTHROW { return QtPrivate::isRightToLeft(*this); } + Q_REQUIRED_RESULT Q_CORE_EXPORT int toWCharArray(wchar_t *array) const; + // // STL compatibility API: // diff --git a/src/corelib/tools/qvector.h b/src/corelib/tools/qvector.h index 988d5a9e1b..9762ec1b5b 100644 --- a/src/corelib/tools/qvector.h +++ b/src/corelib/tools/qvector.h @@ -79,6 +79,7 @@ public: void swap(QVector<T> &other) Q_DECL_NOTHROW { qSwap(d, other.d); } #ifdef Q_COMPILER_INITIALIZER_LISTS inline QVector(std::initializer_list<T> args); + QVector<T> &operator=(std::initializer_list<T> args); #endif bool operator==(const QVector<T> &v) const; inline bool operator!=(const QVector<T> &v) const { return !(*this == v); } @@ -542,10 +543,19 @@ QVector<T>::QVector(std::initializer_list<T> args) d = Data::sharedNull(); } } + +template <typename T> +QVector<T> &QVector<T>::operator=(std::initializer_list<T> args) +{ + QVector<T> tmp(args); + tmp.swap(*this); + return *this; +} + # if defined(Q_CC_MSVC) QT_WARNING_POP # endif // Q_CC_MSVC -#endif // Q_COMPILER_INITALIZER_LISTS +#endif // Q_COMPILER_INITIALIZER_LISTS template <typename T> void QVector<T>::freeData(Data *x) diff --git a/src/corelib/tools/qvector.qdoc b/src/corelib/tools/qvector.qdoc index 75b17a4207..69bbb5f9a2 100644 --- a/src/corelib/tools/qvector.qdoc +++ b/src/corelib/tools/qvector.qdoc @@ -263,6 +263,17 @@ \since 5.2 */ +/*! + \fn template <typename T> QVector<T> &QVector<T>::operator=(std::initializer_list<T> args) + + Assigns the collection of values in \a args to this QVector instance. + + This operator is only enabled if the compiler supports C++11 initializer + lists. + + \since 5.14 +*/ + /*! \fn template <typename T> void QVector<T>::swap(QVector<T> &other) \since 4.8 diff --git a/src/dbus/qdbusabstractinterface.cpp b/src/dbus/qdbusabstractinterface.cpp index 148bd54147..d49959d8e2 100644 --- a/src/dbus/qdbusabstractinterface.cpp +++ b/src/dbus/qdbusabstractinterface.cpp @@ -66,11 +66,11 @@ namespace { // of to QDBusAbstractInterface::customEvent. // See solution in Patch Set 1 of this change in the Qt Gerrit servers. // (https://codereview.qt-project.org/#/c/126384/1) -class DisconnectRelayEvent : public QMetaCallEvent +class DisconnectRelayEvent : public QAbstractMetaCallEvent { public: DisconnectRelayEvent(QObject *sender, const QMetaMethod &m) - : QMetaCallEvent(0, 0, nullptr, sender, m.methodIndex()) + : QAbstractMetaCallEvent(sender, m.methodIndex()) {} void placeMetaCall(QObject *object) override diff --git a/src/dbus/qdbusargument_p.h b/src/dbus/qdbusargument_p.h index b678b9606f..3553d3d151 100644 --- a/src/dbus/qdbusargument_p.h +++ b/src/dbus/qdbusargument_p.h @@ -71,7 +71,7 @@ class QDBusArgumentPrivate { public: inline QDBusArgumentPrivate(int flags = 0) - : message(0), ref(1), capabilities(flags) + : message(nullptr), ref(1), capabilities(flags) { } virtual ~QDBusArgumentPrivate(); @@ -104,7 +104,7 @@ public: class QDBusMarshaller: public QDBusArgumentPrivate { public: - QDBusMarshaller(int flags) : QDBusArgumentPrivate(flags), parent(0), ba(0), closeCode(0), ok(true), skipSignature(false) + QDBusMarshaller(int flags) : QDBusArgumentPrivate(flags), parent(nullptr), ba(nullptr), closeCode(0), ok(true), skipSignature(false) { direction = Marshalling; } ~QDBusMarshaller(); @@ -161,7 +161,7 @@ private: class QDBusDemarshaller: public QDBusArgumentPrivate { public: - inline QDBusDemarshaller(int flags) : QDBusArgumentPrivate(flags), parent(0) + inline QDBusDemarshaller(int flags) : QDBusArgumentPrivate(flags), parent(nullptr) { direction = Demarshalling; } ~QDBusDemarshaller(); diff --git a/src/dbus/qdbusconnection_p.h b/src/dbus/qdbusconnection_p.h index 7769b9ea71..da67a6c5d4 100644 --- a/src/dbus/qdbusconnection_p.h +++ b/src/dbus/qdbusconnection_p.h @@ -115,7 +115,7 @@ public: struct Watcher { - Watcher(): watch(0), read(0), write(0) {} + Watcher(): watch(nullptr), read(nullptr), write(nullptr) {} DBusWatch *watch; QSocketNotifier *read; QSocketNotifier *write; @@ -132,7 +132,7 @@ public: struct SignalHook { - inline SignalHook() : obj(0), midx(-1) { } + inline SignalHook() : obj(nullptr), midx(-1) { } QString service, path, signature; QObject* obj; int midx; @@ -150,9 +150,9 @@ public: { typedef QVector<ObjectTreeNode> DataList; - inline ObjectTreeNode() : obj(0), flags(0) { } + inline ObjectTreeNode() : obj(nullptr), flags(0) { } inline ObjectTreeNode(const QString &n) // intentionally implicit - : name(n), obj(0), flags(0) { } + : name(n), obj(nullptr), flags(0) { } inline bool operator<(const QString &other) const { return name < other; } inline bool operator<(const QStringRef &other) const @@ -194,7 +194,7 @@ public: public: // public methods are entry points from other objects - explicit QDBusConnectionPrivate(QObject *parent = 0); + explicit QDBusConnectionPrivate(QObject *parent = nullptr); ~QDBusConnectionPrivate(); void createBusService(); diff --git a/src/dbus/qdbusintegrator_p.h b/src/dbus/qdbusintegrator_p.h index 3cd029a933..44789b3317 100644 --- a/src/dbus/qdbusintegrator_p.h +++ b/src/dbus/qdbusintegrator_p.h @@ -101,36 +101,37 @@ struct QDBusSlotCache Q_DECLARE_SHARED(QDBusSlotCache::Data) Q_DECLARE_SHARED(QDBusSlotCache) -class QDBusCallDeliveryEvent: public QMetaCallEvent +class QDBusCallDeliveryEvent: public QAbstractMetaCallEvent { public: QDBusCallDeliveryEvent(const QDBusConnection &c, int id, QObject *sender, const QDBusMessage &msg, const QVector<int> &types, int f = 0) - : QMetaCallEvent(0, id, 0, sender, -1), connection(c), message(msg), metaTypes(types), flags(f) + : QAbstractMetaCallEvent(sender, -1), connection(c), message(msg), metaTypes(types), id(id), flags(f) { } void placeMetaCall(QObject *object) override { - QDBusConnectionPrivate::d(connection)->deliverCall(object, flags, message, metaTypes, id()); + QDBusConnectionPrivate::d(connection)->deliverCall(object, flags, message, metaTypes, id); } private: QDBusConnection connection; // just for refcounting QDBusMessage message; QVector<int> metaTypes; + int id; int flags; }; -class QDBusActivateObjectEvent: public QMetaCallEvent +class QDBusActivateObjectEvent: public QAbstractMetaCallEvent { public: QDBusActivateObjectEvent(const QDBusConnection &c, QObject *sender, const QDBusConnectionPrivate::ObjectTreeNode &n, - int p, const QDBusMessage &m, QSemaphore *s = 0) - : QMetaCallEvent(0, ushort(-1), 0, sender, -1, 0, 0, 0, s), connection(c), node(n), + int p, const QDBusMessage &m, QSemaphore *s = nullptr) + : QAbstractMetaCallEvent(sender, -1, s), connection(c), node(n), pathStartPos(p), message(m), handled(false) { } - ~QDBusActivateObjectEvent(); + ~QDBusActivateObjectEvent() override; void placeMetaCall(QObject *) override; @@ -142,15 +143,15 @@ private: bool handled; }; -class QDBusSpyCallEvent : public QMetaCallEvent +class QDBusSpyCallEvent : public QAbstractMetaCallEvent { public: typedef void (*Hook)(const QDBusMessage&); QDBusSpyCallEvent(QDBusConnectionPrivate *cp, const QDBusConnection &c, const QDBusMessage &msg, const Hook *hooks, int count) - : QMetaCallEvent(0, 0, nullptr, cp, 0), conn(c), msg(msg), hooks(hooks), hookCount(count) + : QAbstractMetaCallEvent(cp, 0), conn(c), msg(msg), hooks(hooks), hookCount(count) {} - ~QDBusSpyCallEvent(); + ~QDBusSpyCallEvent() override; void placeMetaCall(QObject *) override; static inline void invokeSpyHooks(const QDBusMessage &msg, const Hook *hooks, int hookCount); diff --git a/src/dbus/qdbuspendingcall_p.h b/src/dbus/qdbuspendingcall_p.h index 10f189ae43..e1f6240f3e 100644 --- a/src/dbus/qdbuspendingcall_p.h +++ b/src/dbus/qdbuspendingcall_p.h @@ -99,7 +99,7 @@ public: // } QDBusPendingCallPrivate(const QDBusMessage &sent, QDBusConnectionPrivate *connection) - : sentMessage(sent), connection(connection), watcherHelper(0), pending(0) + : sentMessage(sent), connection(connection), watcherHelper(nullptr), pending(nullptr) { } ~QDBusPendingCallPrivate(); bool setReplyCallback(QObject *target, const char *member); diff --git a/src/dbus/qdbuspendingreply.h b/src/dbus/qdbuspendingreply.h index bc5cd92c84..1d7e60ad7f 100644 --- a/src/dbus/qdbuspendingreply.h +++ b/src/dbus/qdbuspendingreply.h @@ -156,7 +156,7 @@ public: { Q_STATIC_ASSERT_X(Index >= 0 && Index < Count, "Index out of bounds"); typedef typename Select<Index>::Type ResultType; - return qdbus_cast<ResultType>(argumentAt(Index), 0); + return qdbus_cast<ResultType>(argumentAt(Index), nullptr); } #endif diff --git a/src/dbus/qdbusutil_p.h b/src/dbus/qdbusutil_p.h index 2f187687b8..5a4b461194 100644 --- a/src/dbus/qdbusutil_p.h +++ b/src/dbus/qdbusutil_p.h @@ -134,7 +134,7 @@ namespace Q_DBUS_NO_EXPORT QDBusUtil return false; } - inline bool checkMemberName(const QString &name, AllowEmptyFlag empty, QDBusError *error, const char *nameType = 0) + inline bool checkMemberName(const QString &name, AllowEmptyFlag empty, QDBusError *error, const char *nameType = nullptr) { if (!nameType) nameType = "member"; if (name.isEmpty()) { diff --git a/src/gui/accessible/qaccessiblecache_p.h b/src/gui/accessible/qaccessiblecache_p.h index a976277c1d..cf1ed04f35 100644 --- a/src/gui/accessible/qaccessiblecache_p.h +++ b/src/gui/accessible/qaccessiblecache_p.h @@ -73,7 +73,7 @@ public: QAccessibleInterface *interfaceForId(QAccessible::Id id) const; QAccessible::Id idForInterface(QAccessibleInterface *iface) const; QAccessible::Id insert(QObject *object, QAccessibleInterface *iface) const; - void deleteInterface(QAccessible::Id id, QObject *obj = 0); + void deleteInterface(QAccessible::Id id, QObject *obj = nullptr); #ifdef Q_OS_MAC QT_MANGLE_NAMESPACE(QMacAccessibilityElement) *elementForId(QAccessible::Id axid) const; diff --git a/src/gui/configure.json b/src/gui/configure.json index 59c06af97f..2ac06173a8 100644 --- a/src/gui/configure.json +++ b/src/gui/configure.json @@ -30,7 +30,6 @@ "libjpeg": { "type": "enum", "values": [ "no", "qt", "system" ] }, "libpng": { "type": "enum", "values": [ "no", "qt", "system" ] }, "linuxfb": "boolean", - "mirclient": "boolean", "mtdev": "boolean", "opengl": { "type": "optionalString", "values": [ "no", "yes", "desktop", "es2", "dynamic" ] }, "opengl-es-2": { "type": "void", "name": "opengl", "value": "es2" }, @@ -395,20 +394,6 @@ { "lib": "zlib", "condition": "features.system-zlib" } ] }, - "mirclient": { - "label": "Mir client libraries", - "test": { - "tail": "static void surfaceCreateCallback(MirSurface*, void*) {}", - "main": [ - "u_application_lifecycle_delegate_new();", - "mir_surface_create(0, surfaceCreateCallback, 0);" - ] - }, - "headers": [ "mir_toolkit/mir_client_library.h", "ubuntu/application/lifecycle_delegate.h", "EGL/egl.h" ], - "sources": [ - { "type": "pkgConfig", "args": "egl mirclient ubuntu-platform-api libcontent-hub >= 0.2.0" } - ] - }, "mtdev": { "label": "mtdev", "test": { @@ -1295,13 +1280,6 @@ ], "output": [ "privateFeature" ] }, - "mirclient": { - "label": "Mir client", - "section": "Platform plugins", - "autoDetect": false, - "condition": "libs.mirclient && features.xkbcommon", - "output": [ "privateFeature" ] - }, "mtdev": { "label": "mtdev", "condition": "libs.mtdev", @@ -1828,7 +1806,7 @@ or may depend on your system and XQuartz setup." }, { "type": "warning", - "condition": "features.gui && config.linux && !config.android && !features.xcb && !features.eglfs && !features.directfb && !features.linuxfb && !features.mirclient", + "condition": "features.gui && config.linux && !config.android && !features.xcb && !features.eglfs && !features.directfb && !features.linuxfb", "message": "No QPA platform plugin enabled! This will produce a Qt that cannot run GUI applications. See \"Platform backends\" in the output of --help." @@ -1936,7 +1914,7 @@ QMAKE_LIBDIR_OPENGL[_ES2] and QMAKE_LIBS_OPENGL[_ES2] in the mkspec for your pla "eglfs_openwfd", "eglfs_viv", "eglfs_viv_wl", "eglfs_rcar", "eglfs_egldevice", "eglfs_gbm", "eglfs_vsp2", "eglfs_mali", "eglfs_brcm", "eglfs_x11" ] }, - "linuxfb", "vnc", "mirclient", + "linuxfb", "vnc", { "type": "feature", "condition": "config.integrity", diff --git a/src/gui/image/qimage.cpp b/src/gui/image/qimage.cpp index 0463ef6a42..a6ac3bc333 100644 --- a/src/gui/image/qimage.cpp +++ b/src/gui/image/qimage.cpp @@ -1,6 +1,6 @@ /**************************************************************************** ** -** Copyright (C) 2016 The Qt Company Ltd. +** Copyright (C) 2018 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** ** This file is part of the QtGui module of the Qt Toolkit. @@ -38,8 +38,10 @@ ****************************************************************************/ #include "qimage.h" -#include "qdatastream.h" + #include "qbuffer.h" +#include "qdatastream.h" +#include "qcolortransform.h" #include "qmap.h" #include "qmatrix.h" #include "qtransform.h" @@ -54,6 +56,7 @@ #include <stdlib.h> #include <limits.h> #include <qpa/qplatformpixmap.h> +#include <private/qcolortransform_p.h> #include <private/qdrawhelper_p.h> #include <private/qmemrotate_p.h> #include <private/qimagescale_p.h> @@ -1098,6 +1101,7 @@ static void copyMetadata(QImageData *dst, const QImageData *src) dst->dpmy = src->dpmy; dst->devicePixelRatio = src->devicePixelRatio; dst->text = src->text; + dst->colorSpace = src->colorSpace; } /*! @@ -4929,6 +4933,132 @@ QTransform QImage::trueMatrix(const QTransform &matrix, int w, int h) return matrix * QTransform().translate(-delta.x(), -delta.y()); } +/*! + \since 5.14 + + Sets the image color space to \a colorSpace without performing any conversions on image data. + + \sa colorSpace() +*/ +void QImage::setColorSpace(const QColorSpace &colorSpace) +{ + if (!d) + return; + if (d->colorSpace == colorSpace) + return; + if (!isDetached()) // Detach only if shared, not for read-only data. + detach(); + d->colorSpace = colorSpace; +} + +/*! + \since 5.14 + + Converts the image to \a colorSpace. + + If the image has no valid color space, the method does nothing. + + \sa convertedToColorSpace(), setColorSpace() +*/ +void QImage::convertToColorSpace(const QColorSpace &colorSpace) +{ + if (!d) + return; + if (!d->colorSpace.isValid()) + return; + if (!colorSpace.isValid()) { + qWarning() << "QImage::convertToColorSpace: Output colorspace is not valid"; + return; + } + detach(); + applyColorTransform(d->colorSpace.transformationToColorSpace(colorSpace)); + d->colorSpace = colorSpace; +} + +/*! + \since 5.14 + + Returns the image converted to \a colorSpace. + + If the image has no valid color space, a null QImage is returned. + + \sa convertToColorSpace() +*/ +QImage QImage::convertedToColorSpace(const QColorSpace &colorSpace) const +{ + if (!d || !d->colorSpace.isValid() || !colorSpace.isValid()) + return QImage(); + QImage image = copy(); + image.convertToColorSpace(colorSpace); + return image; +} + +/*! + \since 5.14 + + Returns the color space of the image if a color space is defined. +*/ +QColorSpace QImage::colorSpace() const +{ + if (!d) + return QColorSpace::Undefined; + return d->colorSpace; +} + +/*! + \since 5.14 + + Applies the color transformation \a transform to all pixels in the image. +*/ +void QImage::applyColorTransform(const QColorTransform &transform) +{ + QImage::Format oldFormat = format(); + if (depth() > 32) { + if (format() != QImage::Format_RGBX64 && format() != QImage::Format_RGBA64 + && format() != QImage::Format_RGBA64_Premultiplied) + *this = std::move(*this).convertToFormat(QImage::Format_RGBA64); + } else if (format() != QImage::Format_ARGB32 && format() != QImage::Format_RGB32 + && format() != QImage::Format_ARGB32_Premultiplied) { + if (hasAlphaChannel()) + *this = std::move(*this).convertToFormat(QImage::Format_ARGB32); + else + *this = std::move(*this).convertToFormat(QImage::Format_RGB32); + } + + QColorTransformPrivate::TransformFlags flags = QColorTransformPrivate::Unpremultiplied; + switch (format()) { + case Format_ARGB32_Premultiplied: + case Format_RGBA64_Premultiplied: + flags = QColorTransformPrivate::Premultiplied; + break; + case Format_RGB32: + case Format_RGBX64: + flags = QColorTransformPrivate::InputOpaque; + break; + case Format_ARGB32: + case Format_RGBA64: + break; + default: + Q_UNREACHABLE(); + } + + if (depth() > 32) { + for (int i = 0; i < height(); ++i) { + QRgba64 *scanline = reinterpret_cast<QRgba64 *>(scanLine(i)); + transform.d_func()->apply(scanline, scanline, width(), flags); + } + } else { + for (int i = 0; i < height(); ++i) { + QRgb *scanline = reinterpret_cast<QRgb *>(scanLine(i)); + transform.d_func()->apply(scanline, scanline, width(), flags); + } + } + + if (oldFormat != format()) + *this = std::move(*this).convertToFormat(oldFormat); +} + + bool QImageData::convertInPlace(QImage::Format newFormat, Qt::ImageConversionFlags flags) { if (format == newFormat) diff --git a/src/gui/image/qimage.h b/src/gui/image/qimage.h index 8335e117f2..af7e6988cb 100644 --- a/src/gui/image/qimage.h +++ b/src/gui/image/qimage.h @@ -61,9 +61,11 @@ Q_FORWARD_DECLARE_MUTABLE_CG_TYPE(CGImage); QT_BEGIN_NAMESPACE +class QColorSpace; +class QColorTransform; class QIODevice; -class QStringList; class QMatrix; +class QStringList; class QTransform; class QVariant; template <class T> class QList; @@ -300,6 +302,12 @@ public: #endif void invertPixels(InvertMode = InvertRgb); + QColorSpace colorSpace() const; + QImage convertedToColorSpace(const QColorSpace &) const; + void convertToColorSpace(const QColorSpace &); + void setColorSpace(const QColorSpace &); + + void applyColorTransform(const QColorTransform &transform); bool load(QIODevice *device, const char* format); bool load(const QString &fileName, const char *format = nullptr); diff --git a/src/gui/image/qimage_conversions.cpp b/src/gui/image/qimage_conversions.cpp index 82ffb8af8b..837ac88470 100644 --- a/src/gui/image/qimage_conversions.cpp +++ b/src/gui/image/qimage_conversions.cpp @@ -39,7 +39,7 @@ #include <private/qdrawhelper_p.h> #include <private/qguiapplication_p.h> -#include <private/qcolorprofile_p.h> +#include <private/qcolortrclut_p.h> #include <private/qendian_p.h> #include <private/qsimd_p.h> #include <private/qimage_p.h> @@ -100,7 +100,7 @@ const uchar *qt_get_bitflip_array() void qGamma_correct_back_to_linear_cs(QImage *image) { - const QColorProfile *cp = QGuiApplicationPrivate::instance()->colorProfileForA32Text(); + const QColorTrcLut *cp = QGuiApplicationPrivate::instance()->colorProfileForA32Text(); if (!cp) return; // gamma correct the pixels back to linear color space... diff --git a/src/gui/image/qimage_p.h b/src/gui/image/qimage_p.h index d88ad2d1d2..9da6acd0a7 100644 --- a/src/gui/image/qimage_p.h +++ b/src/gui/image/qimage_p.h @@ -51,7 +51,9 @@ // We mean it. // +#include <QtGui/qcolorspace.h> #include <QtGui/private/qtguiglobal_p.h> +#include <QtGui/qimage.h> #include <QtCore/private/qnumeric_p.h> #include <QMap> @@ -65,7 +67,7 @@ struct Q_GUI_EXPORT QImageData { // internal image data QImageData(); ~QImageData(); static QImageData *create(const QSize &size, QImage::Format format); - static QImageData *create(uchar *data, int w, int h, int bpl, QImage::Format format, bool readOnly, QImageCleanupFunction cleanupFunction = 0, void *cleanupInfo = 0); + static QImageData *create(uchar *data, int w, int h, int bpl, QImage::Format format, bool readOnly, QImageCleanupFunction cleanupFunction = nullptr, void *cleanupInfo = nullptr); QAtomicInt ref; @@ -106,6 +108,8 @@ struct Q_GUI_EXPORT QImageData { // internal image data QPaintEngine *paintEngine; + QColorSpace colorSpace; + struct ImageSizeParameters { qsizetype bytesPerLine; qsizetype totalSize; diff --git a/src/gui/image/qpixmapcache_p.h b/src/gui/image/qpixmapcache_p.h index 3c57367514..ab8e2b7558 100644 --- a/src/gui/image/qpixmapcache_p.h +++ b/src/gui/image/qpixmapcache_p.h @@ -87,7 +87,7 @@ public: && !d->image.d->paintEngine->isActive()) { delete d->image.d->paintEngine; - d->image.d->paintEngine = 0; + d->image.d->paintEngine = nullptr; } } } diff --git a/src/gui/image/qpnghandler.cpp b/src/gui/image/qpnghandler.cpp index 140196004b..93635a051d 100644 --- a/src/gui/image/qpnghandler.cpp +++ b/src/gui/image/qpnghandler.cpp @@ -42,6 +42,7 @@ #ifndef QT_NO_IMAGEFORMAT_PNG #include <qcoreapplication.h> +#include <qdebug.h> #include <qiodevice.h> #include <qimage.h> #include <qlist.h> @@ -50,6 +51,10 @@ #include <private/qimage_p.h> // for qt_getImageText +#include <qcolorspace.h> +#include <private/qcolorspace_p.h> +#include <private/qicc_p.h> + #include <png.h> #include <pngconf.h> @@ -96,9 +101,16 @@ public: ReadingEnd, Error }; + // Defines the order of how the various ways of setting colorspace overrides eachother: + enum ColorSpaceState { + Undefined = 0, + GammaChrm = 1, // gAMA+cHRM chunks + Srgb = 2, // sRGB chunk + Icc = 3 // iCCP chunk + }; QPngHandlerPrivate(QPngHandler *qq) - : gamma(0.0), fileGamma(0.0), quality(50), compression(50), png_ptr(0), info_ptr(0), end_info(0), state(Ready), q(qq) + : gamma(0.0), fileGamma(0.0), quality(50), compression(50), colorSpaceState(Undefined), png_ptr(0), info_ptr(0), end_info(0), state(Ready), q(qq) { } float gamma; @@ -108,6 +120,8 @@ public: QString description; QSize scaledSize; QStringList readTexts; + QColorSpace colorSpace; + ColorSpaceState colorSpaceState; png_struct *png_ptr; png_info *info_ptr; @@ -226,11 +240,8 @@ void qpiw_flush_fn(png_structp /* png_ptr */) } static -void setup_qt(QImage& image, png_structp png_ptr, png_infop info_ptr, QSize scaledSize, bool *doScaledRead, float screen_gamma=0.0, float file_gamma=0.0) +void setup_qt(QImage& image, png_structp png_ptr, png_infop info_ptr, QSize scaledSize, bool *doScaledRead) { - if (screen_gamma != 0.0 && file_gamma != 0.0) - png_set_gamma(png_ptr, 1.0f / screen_gamma, file_gamma); - png_uint_32 width; png_uint_32 height; int bit_depth = 0; @@ -585,10 +596,45 @@ bool QPngHandlerPrivate::readPngHeader() readPngTexts(info_ptr); +#ifdef PNG_iCCP_SUPPORTED + if (png_get_valid(png_ptr, info_ptr, PNG_INFO_iCCP)) { + png_charp name = nullptr; + int compressionType = 0; +#if (PNG_LIBPNG_VER < 10500) + png_charp profileData = nullptr; +#else + png_bytep profileData = nullptr; +#endif + png_uint_32 profLen; + png_get_iCCP(png_ptr, info_ptr, &name, &compressionType, &profileData, &profLen); + if (!QIcc::fromIccProfile(QByteArray::fromRawData((const char *)profileData, profLen), &colorSpace)) { + qWarning() << "QPngHandler: Failed to parse ICC profile"; + } else { + colorSpaceState = Icc; + } + } +#endif + if (png_get_valid(png_ptr, info_ptr, PNG_INFO_sRGB)) { + int rendering_intent = -1; + png_get_sRGB(png_ptr, info_ptr, &rendering_intent); + // We don't actually care about the rendering_intent, just that it is valid + if (rendering_intent >= 0 && rendering_intent <= 3 && colorSpaceState <= Srgb) { + colorSpace = QColorSpace::SRgb; + colorSpaceState = Srgb; + } + } if (png_get_valid(png_ptr, info_ptr, PNG_INFO_gAMA)) { double file_gamma = 0.0; png_get_gAMA(png_ptr, info_ptr, &file_gamma); fileGamma = file_gamma; + if (fileGamma > 0.0f && colorSpaceState <= GammaChrm) { + QColorSpacePrivate *csPrivate = colorSpace.d_func(); + csPrivate->gamut = QColorSpace::Gamut::SRgb; + csPrivate->transferFunction = QColorSpace::TransferFunction::Gamma; + csPrivate->gamma = fileGamma; + csPrivate->initialize(); + colorSpaceState = GammaChrm; + } } state = ReadHeader; @@ -613,8 +659,19 @@ bool QPngHandlerPrivate::readPngImage(QImage *outImage) return false; } + if (gamma != 0.0 && fileGamma != 0.0) { + // This configuration forces gamma correction and + // thus changes the output colorspace + png_set_gamma(png_ptr, 1.0f / gamma, fileGamma); + QColorSpacePrivate *csPrivate = colorSpace.d_func(); + csPrivate->transferFunction = QColorSpace::TransferFunction::Gamma; + csPrivate->gamma = gamma; + csPrivate->initialize(); + colorSpaceState = GammaChrm; + } + bool doScaledRead = false; - setup_qt(*outImage, png_ptr, info_ptr, scaledSize, &doScaledRead, gamma, fileGamma); + setup_qt(*outImage, png_ptr, info_ptr, scaledSize, &doScaledRead); if (outImage->isNull()) { png_destroy_read_struct(&png_ptr, &info_ptr, &end_info); @@ -683,6 +740,9 @@ bool QPngHandlerPrivate::readPngImage(QImage *outImage) if (scaledSize.isValid() && outImage->size() != scaledSize) *outImage = outImage->scaled(scaledSize, Qt::IgnoreAspectRatio, Qt::SmoothTransformation); + if (colorSpaceState > Undefined && colorSpace.isValid()) + outImage->setColorSpace(colorSpace); + return true; } diff --git a/src/gui/image/qppmhandler_p.h b/src/gui/image/qppmhandler_p.h index f3c9d0f139..2f3811b759 100644 --- a/src/gui/image/qppmhandler_p.h +++ b/src/gui/image/qppmhandler_p.h @@ -71,7 +71,7 @@ public: QByteArray name() const override; #endif - static bool canRead(QIODevice *device, QByteArray *subType = 0); + static bool canRead(QIODevice *device, QByteArray *subType = nullptr); QVariant option(ImageOption option) const override; void setOption(ImageOption option, const QVariant &value) override; diff --git a/src/gui/itemmodels/qstandarditemmodel_p.h b/src/gui/itemmodels/qstandarditemmodel_p.h index 23d2938bc4..97c2e6f01b 100644 --- a/src/gui/itemmodels/qstandarditemmodel_p.h +++ b/src/gui/itemmodels/qstandarditemmodel_p.h @@ -109,11 +109,11 @@ class QStandardItemPrivate Q_DECLARE_PUBLIC(QStandardItem) public: inline QStandardItemPrivate() - : model(0), - parent(0), + : model(nullptr), + parent(nullptr), rows(0), columns(0), - q_ptr(0), + q_ptr(nullptr), lastKnownIndex(-1) { } @@ -220,10 +220,10 @@ public: if (!index.isValid()) return root.data(); if (index.model() != q) - return 0; + return nullptr; QStandardItem *parent = static_cast<QStandardItem*>(index.internalPointer()); - if (parent == 0) - return 0; + if (parent == nullptr) + return nullptr; return parent->child(index.row(), index.column()); } diff --git a/src/gui/kernel/kernel.pri b/src/gui/kernel/kernel.pri index 1f137fc46f..9c80f1e2cc 100644 --- a/src/gui/kernel/kernel.pri +++ b/src/gui/kernel/kernel.pri @@ -21,7 +21,7 @@ HEADERS += \ kernel/qplatforminputcontextplugin_p.h \ kernel/qplatformintegrationfactory_p.h \ kernel/qplatformintegrationplugin.h \ - kernel/qplatformtheme.h\ + kernel/qplatformtheme.h \ kernel/qplatformtheme_p.h \ kernel/qplatformthemefactory_p.h \ kernel/qplatformthemeplugin.h \ diff --git a/src/gui/kernel/qdnd_p.h b/src/gui/kernel/qdnd_p.h index 8f8eb03f87..b1219c8658 100644 --- a/src/gui/kernel/qdnd_p.h +++ b/src/gui/kernel/qdnd_p.h @@ -73,9 +73,9 @@ class QDragPrivate : public QObjectPrivate { public: QDragPrivate() - : source(0) - , target(0) - , data(0) + : source(nullptr) + , target(nullptr) + , data(nullptr) { } QObject *source; QObject *target; diff --git a/src/gui/kernel/qguiapplication.cpp b/src/gui/kernel/qguiapplication.cpp index 4e0c45d8ae..8e587f6b39 100644 --- a/src/gui/kernel/qguiapplication.cpp +++ b/src/gui/kernel/qguiapplication.cpp @@ -68,7 +68,7 @@ #include <qpalette.h> #include <qscreen.h> #include "qsessionmanager.h" -#include <private/qcolorprofile_p.h> +#include <private/qcolortrclut_p.h> #include <private/qscreen_p.h> #include <QtGui/qgenericpluginfactory.h> @@ -1643,8 +1643,6 @@ QGuiApplicationPrivate::~QGuiApplicationPrivate() platform_theme = 0; delete platform_integration; platform_integration = 0; - delete m_a8ColorProfile.load(); - delete m_a32ColorProfile.load(); window_list.clear(); screen_list.clear(); @@ -1827,7 +1825,11 @@ bool QGuiApplicationPrivate::sendQWindowEventToQPlatformWindow(QWindow *window, return platformWindow->windowEvent(event); } +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QGuiApplicationPrivate::processNativeEvent(QWindow *window, const QByteArray &eventType, void *message, qintptr *result) +#else bool QGuiApplicationPrivate::processNativeEvent(QWindow *window, const QByteArray &eventType, void *message, long *result) +#endif { return window->nativeEvent(eventType, message, result); } @@ -3984,32 +3986,26 @@ void QGuiApplicationPrivate::notifyDragStarted(const QDrag *drag) } #endif -const QColorProfile *QGuiApplicationPrivate::colorProfileForA8Text() +const QColorTrcLut *QGuiApplicationPrivate::colorProfileForA8Text() { #ifdef Q_OS_WIN - QColorProfile *result = m_a8ColorProfile.load(); - if (!result){ - QColorProfile *cs = QColorProfile::fromGamma(2.31); // This is a hard-coded thing for Windows text rendering - if (!m_a8ColorProfile.testAndSetRelease(0, cs)) - delete cs; - result = m_a8ColorProfile.load(); + if (!m_a8ColorProfile){ + QColorTrcLut *cs = QColorTrcLut::fromGamma(2.31); // This is a hard-coded thing for Windows text rendering + m_a8ColorProfile.reset(cs); } - return result; + return m_a8ColorProfile.get(); #else return colorProfileForA32Text(); #endif } -const QColorProfile *QGuiApplicationPrivate::colorProfileForA32Text() +const QColorTrcLut *QGuiApplicationPrivate::colorProfileForA32Text() { - QColorProfile *result = m_a32ColorProfile.load(); - if (!result){ - QColorProfile *cs = QColorProfile::fromGamma(fontSmoothingGamma); - if (!m_a32ColorProfile.testAndSetRelease(0, cs)) - delete cs; - result = m_a32ColorProfile.load(); + if (!m_a32ColorProfile) { + QColorTrcLut *cs = QColorTrcLut::fromGamma(fontSmoothingGamma); + m_a32ColorProfile.reset(cs); } - return result; + return m_a32ColorProfile.get(); } void QGuiApplicationPrivate::_q_updateFocusObject(QObject *object) diff --git a/src/gui/kernel/qguiapplication_p.h b/src/gui/kernel/qguiapplication_p.h index 63646dcd50..c9619daa3d 100644 --- a/src/gui/kernel/qguiapplication_p.h +++ b/src/gui/kernel/qguiapplication_p.h @@ -55,6 +55,7 @@ #include <QtGui/qguiapplication.h> #include <QtCore/QPointF> +#include <QtCore/QSharedPointer> #include <QtCore/private/qcoreapplication_p.h> #include <QtCore/private/qthread_p.h> @@ -66,7 +67,7 @@ QT_BEGIN_NAMESPACE -class QColorProfile; +class QColorTrcLut; class QPlatformIntegration; class QPlatformTheme; class QPlatformDragQtResponse; @@ -114,7 +115,7 @@ public: if (QCoreApplication::instance()) return QCoreApplication::instance()->d_func()->threadData->eventDispatcher.load(); else - return 0; + return nullptr; } static void processMouseEvent(QWindowSystemInterfacePrivate::MouseEvent *e); @@ -171,7 +172,11 @@ public: Qt::MouseButtons buttons, Qt::KeyboardModifiers modifiers); #endif +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + static bool processNativeEvent(QWindow *window, const QByteArray &eventType, void *message, qintptr *result); +#else static bool processNativeEvent(QWindow *window, const QByteArray &eventType, void *message, long *result); +#endif static bool sendQWindowEventToQPlatformWindow(QWindow *window, QEvent *event); @@ -204,7 +209,7 @@ public: static void showModalWindow(QWindow *window); static void hideModalWindow(QWindow *window); static void updateBlockedStatus(QWindow *window); - virtual bool isWindowBlocked(QWindow *window, QWindow **blockingWindow = 0) const; + virtual bool isWindowBlocked(QWindow *window, QWindow **blockingWindow = nullptr) const; virtual bool popupActive() { return false; } static ulong mousePressTime; @@ -299,8 +304,8 @@ public: static QInputDeviceManager *inputDeviceManager(); - const QColorProfile *colorProfileForA8Text(); - const QColorProfile *colorProfileForA32Text(); + const QColorTrcLut *colorProfileForA8Text(); + const QColorTrcLut *colorProfileForA32Text(); // hook reimplemented in QApplication to apply the QStyle function on the QIcon virtual QPixmap applyQIconStyleHelper(QIcon::Mode, const QPixmap &basePixmap) const { return basePixmap; } @@ -327,8 +332,8 @@ private: static QGuiApplicationPrivate *self; static QTouchDevice *m_fakeTouchDevice; static int m_fakeMouseSourcePointId; - QAtomicPointer<QColorProfile> m_a8ColorProfile; - QAtomicPointer<QColorProfile> m_a32ColorProfile; + QSharedPointer<QColorTrcLut> m_a8ColorProfile; + QSharedPointer<QColorTrcLut> m_a32ColorProfile; bool ownGlobalShareContext; diff --git a/src/gui/kernel/qinputmethod_p.h b/src/gui/kernel/qinputmethod_p.h index 0c2b739d92..5657edeb4e 100644 --- a/src/gui/kernel/qinputmethod_p.h +++ b/src/gui/kernel/qinputmethod_p.h @@ -67,7 +67,7 @@ class QInputMethodPrivate : public QObjectPrivate Q_DECLARE_PUBLIC(QInputMethod) public: - inline QInputMethodPrivate() : testContext(0) + inline QInputMethodPrivate() : testContext(nullptr) {} QPlatformInputContext *platformInputContext() const { diff --git a/src/gui/kernel/qopenglcontext_p.h b/src/gui/kernel/qopenglcontext_p.h index 2849d0c58e..c6ad893ee6 100644 --- a/src/gui/kernel/qopenglcontext_p.h +++ b/src/gui/kernel/qopenglcontext_p.h @@ -131,7 +131,7 @@ class Q_GUI_EXPORT QOpenGLContextGroupPrivate : public QObjectPrivate Q_DECLARE_PUBLIC(QOpenGLContextGroup) public: QOpenGLContextGroupPrivate() - : m_context(0) + : m_context(nullptr) , m_mutex(QMutex::Recursive) , m_refs(0) { @@ -198,20 +198,20 @@ class Q_GUI_EXPORT QOpenGLContextPrivate : public QObjectPrivate Q_DECLARE_PUBLIC(QOpenGLContext) public: QOpenGLContextPrivate() - : qGLContextHandle(0) - , qGLContextDeleteFunction(0) - , platformGLContext(0) - , shareContext(0) - , shareGroup(0) - , screen(0) - , surface(0) - , functions(0) - , textureFunctions(0) + : qGLContextHandle(nullptr) + , qGLContextDeleteFunction(nullptr) + , platformGLContext(nullptr) + , shareContext(nullptr) + , shareGroup(nullptr) + , screen(nullptr) + , surface(nullptr) + , functions(nullptr) + , textureFunctions(nullptr) , max_texture_size(-1) , workaround_brokenFBOReadBack(false) , workaround_brokenTexSubImage(false) , workaround_missingPrecisionQualifiers(false) - , active_engine(0) + , active_engine(nullptr) , qgl_current_fbo_invalid(false) , qgl_current_fbo(nullptr) , defaultFboRedirect(0) diff --git a/src/gui/kernel/qplatformintegration.cpp b/src/gui/kernel/qplatformintegration.cpp index 490cfc6178..6ae6e4a528 100644 --- a/src/gui/kernel/qplatformintegration.cpp +++ b/src/gui/kernel/qplatformintegration.cpp @@ -462,6 +462,44 @@ QList<int> QPlatformIntegration::possibleKeys(const QKeyEvent *) const return QList<int>(); } +/*! + \deprecated Use QWindowSystemInterface::handleScreenAdded instead. +*/ +void QPlatformIntegration::screenAdded(QPlatformScreen *ps, bool isPrimary) +{ + QWindowSystemInterface::handleScreenAdded(ps, isPrimary); +} + +/*! + \deprecated Use QWindowSystemInterface::handleScreenRemoved instead. +*/ +void QPlatformIntegration::removeScreen(QScreen *screen) +{ + const bool wasPrimary = (!QGuiApplicationPrivate::screen_list.isEmpty() && QGuiApplicationPrivate::screen_list.at(0) == screen); + QGuiApplicationPrivate::screen_list.removeOne(screen); + + QGuiApplicationPrivate::resetCachedDevicePixelRatio(); + + if (wasPrimary && qGuiApp && !QGuiApplicationPrivate::screen_list.isEmpty()) + emit qGuiApp->primaryScreenChanged(QGuiApplicationPrivate::screen_list.at(0)); +} + +/*! + \deprecated Use QWindowSystemInterface::handleScreenRemoved instead. +*/ +void QPlatformIntegration::destroyScreen(QPlatformScreen *platformScreen) +{ + QWindowSystemInterface::handleScreenRemoved(platformScreen); +} + +/*! + \deprecated Use QWindowSystemInterface::handlePrimaryScreenChanged instead. +*/ +void QPlatformIntegration::setPrimaryScreen(QPlatformScreen *newPrimary) +{ + QWindowSystemInterface::handlePrimaryScreenChanged(newPrimary); +} + QStringList QPlatformIntegration::themeNames() const { return QStringList(); diff --git a/src/gui/kernel/qplatformintegration.h b/src/gui/kernel/qplatformintegration.h index 389b35dbc0..048ea1139c 100644 --- a/src/gui/kernel/qplatformintegration.h +++ b/src/gui/kernel/qplatformintegration.h @@ -114,7 +114,7 @@ public: virtual QPlatformPixmap *createPlatformPixmap(QPlatformPixmap::PixelType type) const; virtual QPlatformWindow *createPlatformWindow(QWindow *window) const = 0; - virtual QPlatformWindow *createForeignWindow(QWindow *, WId) const { return 0; } + virtual QPlatformWindow *createForeignWindow(QWindow *, WId) const { return nullptr; } virtual QPlatformBackingStore *createPlatformBackingStore(QWindow *window) const = 0; #ifndef QT_NO_OPENGL virtual QPlatformOpenGLContext *createPlatformOpenGLContext(QOpenGLContext *context) const; @@ -192,6 +192,10 @@ public: #endif virtual void setApplicationIcon(const QIcon &icon) const; +#if QT_DEPRECATED_SINCE(5, 12) + QT_DEPRECATED_X("Use QWindowSystemInterface::handleScreenRemoved") void removeScreen(QScreen *screen); +#endif + virtual void beep() const; #if QT_CONFIG(vulkan) || defined(Q_CLANG_QDOC) @@ -200,6 +204,12 @@ public: protected: QPlatformIntegration() = default; + +#if QT_DEPRECATED_SINCE(5, 12) + QT_DEPRECATED_X("Use QWindowSystemInterface::handleScreenAdded") void screenAdded(QPlatformScreen *screen, bool isPrimary = false); + QT_DEPRECATED_X("Use QWindowSystemInterface::handleScreenRemoved") void destroyScreen(QPlatformScreen *screen); + QT_DEPRECATED_X("Use QWindowSystemInterface::handlePrimaryScreenChanged") void setPrimaryScreen(QPlatformScreen *newPrimary); +#endif }; QT_END_NAMESPACE diff --git a/src/gui/kernel/qplatformscreen.cpp b/src/gui/kernel/qplatformscreen.cpp index 9c5876550a..21ae75ba8f 100644 --- a/src/gui/kernel/qplatformscreen.cpp +++ b/src/gui/kernel/qplatformscreen.cpp @@ -62,6 +62,10 @@ QPlatformScreen::~QPlatformScreen() Q_D(QPlatformScreen); if (d->screen) { qWarning("Manually deleting a QPlatformScreen. Call QWindowSystemInterface::handleScreenRemoved instead."); +QT_WARNING_PUSH +QT_WARNING_DISABLE_DEPRECATED + QGuiApplicationPrivate::platformIntegration()->removeScreen(d->screen); +QT_WARNING_POP delete d->screen; } } diff --git a/src/gui/kernel/qplatformtheme.h b/src/gui/kernel/qplatformtheme.h index 54c8c70025..356c4ea3ea 100644 --- a/src/gui/kernel/qplatformtheme.h +++ b/src/gui/kernel/qplatformtheme.h @@ -309,7 +309,7 @@ public: virtual QPixmap standardPixmap(StandardPixmap sp, const QSizeF &size) const; virtual QIcon fileIcon(const QFileInfo &fileInfo, - QPlatformTheme::IconOptions iconOptions = 0) const; + QPlatformTheme::IconOptions iconOptions = nullptr) const; virtual QIconEngine *createIconEngine(const QString &iconName) const; #ifndef QT_NO_SHORTCUT diff --git a/src/gui/kernel/qscreen.cpp b/src/gui/kernel/qscreen.cpp index 952023dd1b..f208eb02be 100644 --- a/src/gui/kernel/qscreen.cpp +++ b/src/gui/kernel/qscreen.cpp @@ -106,18 +106,9 @@ void QScreenPrivate::setPlatformScreen(QPlatformScreen *screen) */ QScreen::~QScreen() { - // Remove screen - const bool wasPrimary = QGuiApplication::primaryScreen() == this; - QGuiApplicationPrivate::screen_list.removeOne(this); - QGuiApplicationPrivate::resetCachedDevicePixelRatio(); - - if (!qGuiApp) + if (!qApp) return; - QScreen *newPrimaryScreen = QGuiApplication::primaryScreen(); - if (wasPrimary && newPrimaryScreen) - emit qGuiApp->primaryScreenChanged(newPrimaryScreen); - // Allow clients to manage windows that are affected by the screen going // away, before we fall back to moving them to the primary screen. emit qApp->screenRemoved(this); @@ -125,8 +116,11 @@ QScreen::~QScreen() if (QGuiApplication::closingDown()) return; - bool movingFromVirtualSibling = newPrimaryScreen - && newPrimaryScreen->handle()->virtualSiblings().contains(handle()); + QScreen *primaryScreen = QGuiApplication::primaryScreen(); + if (this == primaryScreen) + return; + + bool movingFromVirtualSibling = primaryScreen && primaryScreen->handle()->virtualSiblings().contains(handle()); // Move any leftover windows to the primary screen const auto allWindows = QGuiApplication::allWindows(); @@ -135,7 +129,7 @@ QScreen::~QScreen() continue; const bool wasVisible = window->isVisible(); - window->setScreen(newPrimaryScreen); + window->setScreen(primaryScreen); // Re-show window if moved from a virtual sibling screen. Otherwise // leave it up to the application developer to show the window. diff --git a/src/gui/kernel/qscreen_p.h b/src/gui/kernel/qscreen_p.h index f31658355b..8e81c7bf87 100644 --- a/src/gui/kernel/qscreen_p.h +++ b/src/gui/kernel/qscreen_p.h @@ -65,8 +65,8 @@ class QScreenPrivate : public QObjectPrivate Q_DECLARE_PUBLIC(QScreen) public: QScreenPrivate() - : platformScreen(0) - , orientationUpdateMask(0) + : platformScreen(nullptr) + , orientationUpdateMask(nullptr) { } diff --git a/src/gui/kernel/qshapedpixmapdndwindow_p.h b/src/gui/kernel/qshapedpixmapdndwindow_p.h index d9a6ea4888..5089be7284 100644 --- a/src/gui/kernel/qshapedpixmapdndwindow_p.h +++ b/src/gui/kernel/qshapedpixmapdndwindow_p.h @@ -63,7 +63,7 @@ class QShapedPixmapWindow : public QRasterWindow { Q_OBJECT public: - explicit QShapedPixmapWindow(QScreen *screen = 0); + explicit QShapedPixmapWindow(QScreen *screen = nullptr); ~QShapedPixmapWindow(); void setUseCompositing(bool on) { m_useCompositing = on; } diff --git a/src/gui/kernel/qwindow.cpp b/src/gui/kernel/qwindow.cpp index 590e2a85bb..19a5d39ad5 100644 --- a/src/gui/kernel/qwindow.cpp +++ b/src/gui/kernel/qwindow.cpp @@ -2529,7 +2529,12 @@ void QWindow::tabletEvent(QTabletEvent *ev) Should return true only if the event was handled. */ + +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QWindow::nativeEvent(const QByteArray &eventType, void *message, qintptr *result) +#else bool QWindow::nativeEvent(const QByteArray &eventType, void *message, long *result) +#endif { Q_UNUSED(eventType); Q_UNUSED(message); diff --git a/src/gui/kernel/qwindow.h b/src/gui/kernel/qwindow.h index 1be3c845fe..5ee1d00f5b 100644 --- a/src/gui/kernel/qwindow.h +++ b/src/gui/kernel/qwindow.h @@ -364,7 +364,11 @@ protected: #if QT_CONFIG(tabletevent) virtual void tabletEvent(QTabletEvent *); #endif +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + virtual bool nativeEvent(const QByteArray &eventType, void *message, qintptr *result); +#else virtual bool nativeEvent(const QByteArray &eventType, void *message, long *result); +#endif QWindow(QWindowPrivate &dd, QWindow *parent); diff --git a/src/gui/kernel/qwindow_p.h b/src/gui/kernel/qwindow_p.h index b8fa77bef0..eb0b606598 100644 --- a/src/gui/kernel/qwindow_p.h +++ b/src/gui/kernel/qwindow_p.h @@ -79,8 +79,8 @@ public: : QObjectPrivate() , surfaceType(QWindow::RasterSurface) , windowFlags(Qt::Window) - , parentWindow(0) - , platformWindow(0) + , parentWindow(nullptr) + , platformWindow(nullptr) , visible(false) , visibilityOnDestroy(false) , exposed(false) @@ -98,8 +98,8 @@ public: , modality(Qt::NonModal) , blockedByModalWindow(false) , updateRequestPending(false) - , transientParent(0) - , topLevelScreen(0) + , transientParent(nullptr) + , topLevelScreen(nullptr) #ifndef QT_NO_CURSOR , cursor(Qt::ArrowCursor) , hasCursor(false) @@ -120,7 +120,7 @@ public: void maybeQuitOnLastWindowClosed(); #ifndef QT_NO_CURSOR - void setCursor(const QCursor *c = 0); + void setCursor(const QCursor *c = nullptr); bool applyCursor(); #endif diff --git a/src/gui/kernel/qwindowsysteminterface.cpp b/src/gui/kernel/qwindowsysteminterface.cpp index 759671fbd7..2b40b2d4d0 100644 --- a/src/gui/kernel/qwindowsysteminterface.cpp +++ b/src/gui/kernel/qwindowsysteminterface.cpp @@ -818,6 +818,11 @@ void QWindowSystemInterface::handleScreenAdded(QPlatformScreen *ps, bool isPrima */ void QWindowSystemInterface::handleScreenRemoved(QPlatformScreen *platformScreen) { +QT_WARNING_PUSH +QT_WARNING_DISABLE_DEPRECATED + QGuiApplicationPrivate::platformIntegration()->removeScreen(platformScreen->screen()); +QT_WARNING_POP + // Important to keep this order since the QSceen doesn't own the platform screen delete platformScreen->screen(); delete platformScreen; @@ -924,7 +929,11 @@ QPlatformDropQtResponse QWindowSystemInterface::handleDrop(QWindow *window, cons \note This function can only be called from the GUI thread. */ +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QWindowSystemInterface::handleNativeEvent(QWindow *window, const QByteArray &eventType, void *message, qintptr *result) +#else bool QWindowSystemInterface::handleNativeEvent(QWindow *window, const QByteArray &eventType, void *message, long *result) +#endif { return QGuiApplicationPrivate::processNativeEvent(window, eventType, message, result); } diff --git a/src/gui/kernel/qwindowsysteminterface.h b/src/gui/kernel/qwindowsysteminterface.h index bf98c33a1a..fd70eda9ff 100644 --- a/src/gui/kernel/qwindowsysteminterface.h +++ b/src/gui/kernel/qwindowsysteminterface.h @@ -230,7 +230,11 @@ public: Qt::MouseButtons buttons, Qt::KeyboardModifiers modifiers); #endif // QT_CONFIG(draganddrop) +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + static bool handleNativeEvent(QWindow *window, const QByteArray &eventType, void *message, qintptr *result); +#else static bool handleNativeEvent(QWindow *window, const QByteArray &eventType, void *message, long *result); +#endif // Changes to the screen static void handleScreenAdded(QPlatformScreen *screen, bool isPrimary = false); diff --git a/src/gui/kernel/qwindowsysteminterface_p.h b/src/gui/kernel/qwindowsysteminterface_p.h index 6c818a9030..d6513f1836 100644 --- a/src/gui/kernel/qwindowsysteminterface_p.h +++ b/src/gui/kernel/qwindowsysteminterface_p.h @@ -123,7 +123,7 @@ public: class CloseEvent : public WindowSystemEvent { public: - explicit CloseEvent(QWindow *w, bool *a = 0) + explicit CloseEvent(QWindow *w, bool *a = nullptr) : WindowSystemEvent(Close), window(w), accepted(a) { } QPointer<QWindow> window; @@ -398,7 +398,7 @@ public: class TabletEnterProximityEvent : public InputEvent { public: TabletEnterProximityEvent(ulong time, int device, int pointerType, qint64 uid) - : InputEvent(0, time, TabletEnterProximity, Qt::NoModifier), + : InputEvent(nullptr, time, TabletEnterProximity, Qt::NoModifier), device(device), pointerType(pointerType), uid(uid) { } int device; int pointerType; @@ -408,7 +408,7 @@ public: class TabletLeaveProximityEvent : public InputEvent { public: TabletLeaveProximityEvent(ulong time, int device, int pointerType, qint64 uid) - : InputEvent(0, time, TabletLeaveProximity, Qt::NoModifier), + : InputEvent(nullptr, time, TabletLeaveProximity, Qt::NoModifier), device(device), pointerType(pointerType), uid(uid) { } int device; int pointerType; @@ -474,7 +474,7 @@ public: for (int i = 0; i < impl.size(); ++i) if (!(impl.at(i)->type & QWindowSystemInterfacePrivate::UserInputEvent)) return impl.takeAt(i); - return 0; + return nullptr; } bool nonUserInputEventsQueued() { @@ -495,7 +495,7 @@ public: if (impl.at(i)->type == t) return impl.at(i); } - return 0; + return nullptr; } void remove(const WindowSystemEvent *e) { diff --git a/src/gui/opengl/qopenglengineshadermanager_p.h b/src/gui/opengl/qopenglengineshadermanager_p.h index d43788d777..14c79f5de3 100644 --- a/src/gui/opengl/qopenglengineshadermanager_p.h +++ b/src/gui/opengl/qopenglengineshadermanager_p.h @@ -370,7 +370,7 @@ private: class QOpenGLEngineShaderProg { public: - QOpenGLEngineShaderProg() : program(0) {} + QOpenGLEngineShaderProg() : program(nullptr) {} ~QOpenGLEngineShaderProg() { if (program) diff --git a/src/gui/opengl/qopengles2ext.h b/src/gui/opengl/qopengles2ext.h index 8ff50a924e..8517e24267 100644 --- a/src/gui/opengl/qopengles2ext.h +++ b/src/gui/opengl/qopengles2ext.h @@ -1,5 +1,5 @@ -#ifndef __gl2ext_h_ -#define __gl2ext_h_ 1 +#ifndef __gles2_gl2ext_h_ +#define __gles2_gl2ext_h_ 1 #if 0 #pragma qt_no_master_include @@ -25,7 +25,7 @@ typedef struct __GLsync *GLsync; #endif /* -** Copyright (c) 2013-2017 The Khronos Group Inc. +** Copyright (c) 2013-2018 The Khronos Group Inc. ** ** Permission is hereby granted, free of charge, to any person obtaining a ** copy of this software and/or associated documentation files (the @@ -57,7 +57,7 @@ typedef struct __GLsync *GLsync; #define GL_APIENTRYP GL_APIENTRY* #endif -/* Generated on date 20170331 */ +/* Generated on date 20190228 */ /* Generated C header for: * API: gles2 @@ -178,6 +178,16 @@ GL_APICALL void GL_APIENTRY glGetPointervKHR (GLenum pname, void **params); #define GL_CONTEXT_FLAG_NO_ERROR_BIT_KHR 0x00000008 #endif /* GL_KHR_no_error */ +#ifndef GL_KHR_parallel_shader_compile +#define GL_KHR_parallel_shader_compile 1 +#define GL_MAX_SHADER_COMPILER_THREADS_KHR 0x91B0 +#define GL_COMPLETION_STATUS_KHR 0x91B1 +typedef void (GL_APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSKHRPROC) (GLuint count); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glMaxShaderCompilerThreadsKHR (GLuint count); +#endif +#endif /* GL_KHR_parallel_shader_compile */ + #ifndef GL_KHR_robust_buffer_access_behavior #define GL_KHR_robust_buffer_access_behavior 1 #endif /* GL_KHR_robust_buffer_access_behavior */ @@ -343,12 +353,12 @@ GL_APICALL GLboolean GL_APIENTRY glIsEnablediOES (GLenum target, GLuint index); typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSBASEVERTEXOESPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); typedef void (GL_APIENTRYP PFNGLDRAWRANGEELEMENTSBASEVERTEXOESPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXOESPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); -typedef void (GL_APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXOESPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, const GLint *basevertex); +typedef void (GL_APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, const GLint *basevertex); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glDrawElementsBaseVertexOES (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); GL_APICALL void GL_APIENTRY glDrawRangeElementsBaseVertexOES (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); GL_APICALL void GL_APIENTRY glDrawElementsInstancedBaseVertexOES (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); -GL_APICALL void GL_APIENTRY glMultiDrawElementsBaseVertexOES (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, const GLint *basevertex); +GL_APICALL void GL_APIENTRY glMultiDrawElementsBaseVertexEXT (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, const GLint *basevertex); #endif #endif /* GL_OES_draw_elements_base_vertex */ @@ -810,6 +820,22 @@ GL_APICALL void GL_APIENTRY glGetFloati_vOES (GLenum target, GLuint index, GLflo #define GL_ATC_RGBA_INTERPOLATED_ALPHA_AMD 0x87EE #endif /* GL_AMD_compressed_ATC_texture */ +#ifndef GL_AMD_framebuffer_multisample_advanced +#define GL_AMD_framebuffer_multisample_advanced 1 +#define GL_RENDERBUFFER_STORAGE_SAMPLES_AMD 0x91B2 +#define GL_MAX_COLOR_FRAMEBUFFER_SAMPLES_AMD 0x91B3 +#define GL_MAX_COLOR_FRAMEBUFFER_STORAGE_SAMPLES_AMD 0x91B4 +#define GL_MAX_DEPTH_STENCIL_FRAMEBUFFER_SAMPLES_AMD 0x91B5 +#define GL_NUM_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B6 +#define GL_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B7 +typedef void (GL_APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glRenderbufferStorageMultisampleAdvancedAMD (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +GL_APICALL void GL_APIENTRY glNamedRenderbufferStorageMultisampleAdvancedAMD (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#endif +#endif /* GL_AMD_framebuffer_multisample_advanced */ + #ifndef GL_AMD_performance_monitor #define GL_AMD_performance_monitor 1 #define GL_COUNTER_TYPE_AMD 0x8BC0 @@ -1070,6 +1096,20 @@ GL_APICALL void GL_APIENTRY glGetSyncivAPPLE (GLsync sync, GLenum pname, GLsizei #define GL_SHADER_BINARY_DMP 0x9250 #endif /* GL_DMP_shader_binary */ +#ifndef GL_EXT_EGL_image_array +#define GL_EXT_EGL_image_array 1 +#endif /* GL_EXT_EGL_image_array */ + +#ifndef GL_EXT_EGL_image_storage +#define GL_EXT_EGL_image_storage 1 +typedef void (GL_APIENTRYP PFNGLEGLIMAGETARGETTEXSTORAGEEXTPROC) (GLenum target, GLeglImageOES image, const GLint* attrib_list); +typedef void (GL_APIENTRYP PFNGLEGLIMAGETARGETTEXTURESTORAGEEXTPROC) (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glEGLImageTargetTexStorageEXT (GLenum target, GLeglImageOES image, const GLint* attrib_list); +GL_APICALL void GL_APIENTRY glEGLImageTargetTextureStorageEXT (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#endif +#endif /* GL_EXT_EGL_image_storage */ + #ifndef GL_EXT_YUV_target #define GL_EXT_YUV_target 1 #define GL_SAMPLER_EXTERNAL_2D_Y2Y_EXT 0x8BE7 @@ -1141,6 +1181,20 @@ GL_APICALL void GL_APIENTRY glClearTexSubImageEXT (GLuint texture, GLint level, #endif #endif /* GL_EXT_clear_texture */ +#ifndef GL_EXT_clip_control +#define GL_EXT_clip_control 1 +#define GL_LOWER_LEFT_EXT 0x8CA1 +#define GL_UPPER_LEFT_EXT 0x8CA2 +#define GL_NEGATIVE_ONE_TO_ONE_EXT 0x935E +#define GL_ZERO_TO_ONE_EXT 0x935F +#define GL_CLIP_ORIGIN_EXT 0x935C +#define GL_CLIP_DEPTH_MODE_EXT 0x935D +typedef void (GL_APIENTRYP PFNGLCLIPCONTROLEXTPROC) (GLenum origin, GLenum depth); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glClipControlEXT (GLenum origin, GLenum depth); +#endif +#endif /* GL_EXT_clip_control */ + #ifndef GL_EXT_clip_cull_distance #define GL_EXT_clip_cull_distance 1 #define GL_MAX_CLIP_DISTANCES_EXT 0x0D32 @@ -1211,6 +1265,11 @@ GL_APICALL void GL_APIENTRY glPopGroupMarkerEXT (void); #endif #endif /* GL_EXT_debug_marker */ +#ifndef GL_EXT_depth_clamp +#define GL_EXT_depth_clamp 1 +#define GL_DEPTH_CLAMP_EXT 0x864F +#endif /* GL_EXT_depth_clamp */ + #ifndef GL_EXT_discard_framebuffer #define GL_EXT_discard_framebuffer 1 #define GL_COLOR_EXT 0x1800 @@ -1326,12 +1385,10 @@ GL_APICALL GLboolean GL_APIENTRY glIsEnablediEXT (GLenum target, GLuint index); typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSBASEVERTEXEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); typedef void (GL_APIENTRYP PFNGLDRAWRANGEELEMENTSBASEVERTEXEXTPROC) (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); typedef void (GL_APIENTRYP PFNGLDRAWELEMENTSINSTANCEDBASEVERTEXEXTPROC) (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); -typedef void (GL_APIENTRYP PFNGLMULTIDRAWELEMENTSBASEVERTEXEXTPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, const GLint *basevertex); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL void GL_APIENTRY glDrawElementsBaseVertexEXT (GLenum mode, GLsizei count, GLenum type, const void *indices, GLint basevertex); GL_APICALL void GL_APIENTRY glDrawRangeElementsBaseVertexEXT (GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const void *indices, GLint basevertex); GL_APICALL void GL_APIENTRY glDrawElementsInstancedBaseVertexEXT (GLenum mode, GLsizei count, GLenum type, const void *indices, GLsizei instancecount, GLint basevertex); -GL_APICALL void GL_APIENTRY glMultiDrawElementsBaseVertexEXT (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei primcount, const GLint *basevertex); #endif #endif /* GL_EXT_draw_elements_base_vertex */ @@ -1355,6 +1412,17 @@ GL_APICALL void GL_APIENTRY glDrawTransformFeedbackInstancedEXT (GLenum mode, GL #endif #endif /* GL_EXT_draw_transform_feedback */ +#ifndef GL_EXT_external_buffer +#define GL_EXT_external_buffer 1 +typedef void *GLeglClientBufferEXT; +typedef void (GL_APIENTRYP PFNGLBUFFERSTORAGEEXTERNALEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +typedef void (GL_APIENTRYP PFNGLNAMEDBUFFERSTORAGEEXTERNALEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glBufferStorageExternalEXT (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +GL_APICALL void GL_APIENTRY glNamedBufferStorageExternalEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#endif +#endif /* GL_EXT_external_buffer */ + #ifndef GL_EXT_float_blend #define GL_EXT_float_blend 1 #endif /* GL_EXT_float_blend */ @@ -1433,6 +1501,85 @@ GL_APICALL void GL_APIENTRY glFlushMappedBufferRangeEXT (GLenum target, GLintptr #endif #endif /* GL_EXT_map_buffer_range */ +#ifndef GL_EXT_memory_object +#define GL_EXT_memory_object 1 +#define GL_TEXTURE_TILING_EXT 0x9580 +#define GL_DEDICATED_MEMORY_OBJECT_EXT 0x9581 +#define GL_PROTECTED_MEMORY_OBJECT_EXT 0x959B +#define GL_NUM_TILING_TYPES_EXT 0x9582 +#define GL_TILING_TYPES_EXT 0x9583 +#define GL_OPTIMAL_TILING_EXT 0x9584 +#define GL_LINEAR_TILING_EXT 0x9585 +#define GL_NUM_DEVICE_UUIDS_EXT 0x9596 +#define GL_DEVICE_UUID_EXT 0x9597 +#define GL_DRIVER_UUID_EXT 0x9598 +#define GL_UUID_SIZE_EXT 16 +typedef void (GL_APIENTRYP PFNGLGETUNSIGNEDBYTEVEXTPROC) (GLenum pname, GLubyte *data); +typedef void (GL_APIENTRYP PFNGLGETUNSIGNEDBYTEI_VEXTPROC) (GLenum target, GLuint index, GLubyte *data); +typedef void (GL_APIENTRYP PFNGLDELETEMEMORYOBJECTSEXTPROC) (GLsizei n, const GLuint *memoryObjects); +typedef GLboolean (GL_APIENTRYP PFNGLISMEMORYOBJECTEXTPROC) (GLuint memoryObject); +typedef void (GL_APIENTRYP PFNGLCREATEMEMORYOBJECTSEXTPROC) (GLsizei n, GLuint *memoryObjects); +typedef void (GL_APIENTRYP PFNGLMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, const GLint *params); +typedef void (GL_APIENTRYP PFNGLGETMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, GLint *params); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEMEM2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEMEM2DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEMEM3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXSTORAGEMEM3DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLBUFFERSTORAGEMEMEXTPROC) (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGEMEM2DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGEMEM2DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGEMEM3DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTURESTORAGEMEM3DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLNAMEDBUFFERSTORAGEMEMEXTPROC) (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glGetUnsignedBytevEXT (GLenum pname, GLubyte *data); +GL_APICALL void GL_APIENTRY glGetUnsignedBytei_vEXT (GLenum target, GLuint index, GLubyte *data); +GL_APICALL void GL_APIENTRY glDeleteMemoryObjectsEXT (GLsizei n, const GLuint *memoryObjects); +GL_APICALL GLboolean GL_APIENTRY glIsMemoryObjectEXT (GLuint memoryObject); +GL_APICALL void GL_APIENTRY glCreateMemoryObjectsEXT (GLsizei n, GLuint *memoryObjects); +GL_APICALL void GL_APIENTRY glMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, const GLint *params); +GL_APICALL void GL_APIENTRY glGetMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, GLint *params); +GL_APICALL void GL_APIENTRY glTexStorageMem2DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTexStorageMem2DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTexStorageMem3DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTexStorageMem3DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glBufferStorageMemEXT (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureStorageMem2DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureStorageMem2DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureStorageMem3DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureStorageMem3DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glNamedBufferStorageMemEXT (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_EXT_memory_object */ + +#ifndef GL_EXT_memory_object_fd +#define GL_EXT_memory_object_fd 1 +#define GL_HANDLE_TYPE_OPAQUE_FD_EXT 0x9586 +typedef void (GL_APIENTRYP PFNGLIMPORTMEMORYFDEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glImportMemoryFdEXT (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_memory_object_fd */ + +#ifndef GL_EXT_memory_object_win32 +#define GL_EXT_memory_object_win32 1 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_EXT 0x9587 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_KMT_EXT 0x9588 +#define GL_DEVICE_LUID_EXT 0x9599 +#define GL_DEVICE_NODE_MASK_EXT 0x959A +#define GL_LUID_SIZE_EXT 8 +#define GL_HANDLE_TYPE_D3D12_TILEPOOL_EXT 0x9589 +#define GL_HANDLE_TYPE_D3D12_RESOURCE_EXT 0x958A +#define GL_HANDLE_TYPE_D3D11_IMAGE_EXT 0x958B +#define GL_HANDLE_TYPE_D3D11_IMAGE_KMT_EXT 0x958C +typedef void (GL_APIENTRYP PFNGLIMPORTMEMORYWIN32HANDLEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +typedef void (GL_APIENTRYP PFNGLIMPORTMEMORYWIN32NAMEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glImportMemoryWin32HandleEXT (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +GL_APICALL void GL_APIENTRY glImportMemoryWin32NameEXT (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_memory_object_win32 */ + #ifndef GL_EXT_multi_draw_arrays #define GL_EXT_multi_draw_arrays 1 typedef void (GL_APIENTRYP PFNGLMULTIDRAWARRAYSEXTPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei primcount); @@ -1598,6 +1745,55 @@ GL_APICALL void GL_APIENTRY glGetnUniformivEXT (GLuint program, GLint location, #define GL_FRAMEBUFFER_SRGB_EXT 0x8DB9 #endif /* GL_EXT_sRGB_write_control */ +#ifndef GL_EXT_semaphore +#define GL_EXT_semaphore 1 +#define GL_LAYOUT_GENERAL_EXT 0x958D +#define GL_LAYOUT_COLOR_ATTACHMENT_EXT 0x958E +#define GL_LAYOUT_DEPTH_STENCIL_ATTACHMENT_EXT 0x958F +#define GL_LAYOUT_DEPTH_STENCIL_READ_ONLY_EXT 0x9590 +#define GL_LAYOUT_SHADER_READ_ONLY_EXT 0x9591 +#define GL_LAYOUT_TRANSFER_SRC_EXT 0x9592 +#define GL_LAYOUT_TRANSFER_DST_EXT 0x9593 +#define GL_LAYOUT_DEPTH_READ_ONLY_STENCIL_ATTACHMENT_EXT 0x9530 +#define GL_LAYOUT_DEPTH_ATTACHMENT_STENCIL_READ_ONLY_EXT 0x9531 +typedef void (GL_APIENTRYP PFNGLGENSEMAPHORESEXTPROC) (GLsizei n, GLuint *semaphores); +typedef void (GL_APIENTRYP PFNGLDELETESEMAPHORESEXTPROC) (GLsizei n, const GLuint *semaphores); +typedef GLboolean (GL_APIENTRYP PFNGLISSEMAPHOREEXTPROC) (GLuint semaphore); +typedef void (GL_APIENTRYP PFNGLSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, const GLuint64 *params); +typedef void (GL_APIENTRYP PFNGLGETSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, GLuint64 *params); +typedef void (GL_APIENTRYP PFNGLWAITSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +typedef void (GL_APIENTRYP PFNGLSIGNALSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glGenSemaphoresEXT (GLsizei n, GLuint *semaphores); +GL_APICALL void GL_APIENTRY glDeleteSemaphoresEXT (GLsizei n, const GLuint *semaphores); +GL_APICALL GLboolean GL_APIENTRY glIsSemaphoreEXT (GLuint semaphore); +GL_APICALL void GL_APIENTRY glSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, const GLuint64 *params); +GL_APICALL void GL_APIENTRY glGetSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, GLuint64 *params); +GL_APICALL void GL_APIENTRY glWaitSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +GL_APICALL void GL_APIENTRY glSignalSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#endif +#endif /* GL_EXT_semaphore */ + +#ifndef GL_EXT_semaphore_fd +#define GL_EXT_semaphore_fd 1 +typedef void (GL_APIENTRYP PFNGLIMPORTSEMAPHOREFDEXTPROC) (GLuint semaphore, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glImportSemaphoreFdEXT (GLuint semaphore, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_semaphore_fd */ + +#ifndef GL_EXT_semaphore_win32 +#define GL_EXT_semaphore_win32 1 +#define GL_HANDLE_TYPE_D3D12_FENCE_EXT 0x9594 +#define GL_D3D12_FENCE_VALUE_EXT 0x9595 +typedef void (GL_APIENTRYP PFNGLIMPORTSEMAPHOREWIN32HANDLEEXTPROC) (GLuint semaphore, GLenum handleType, void *handle); +typedef void (GL_APIENTRYP PFNGLIMPORTSEMAPHOREWIN32NAMEEXTPROC) (GLuint semaphore, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glImportSemaphoreWin32HandleEXT (GLuint semaphore, GLenum handleType, void *handle); +GL_APICALL void GL_APIENTRY glImportSemaphoreWin32NameEXT (GLuint semaphore, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_semaphore_win32 */ + #ifndef GL_EXT_separate_shader_objects #define GL_EXT_separate_shader_objects 1 #define GL_ACTIVE_PROGRAM_EXT 0x8259 @@ -1703,6 +1899,14 @@ GL_APICALL void GL_APIENTRY glProgramUniformMatrix4x3fvEXT (GLuint program, GLin #define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52 #endif /* GL_EXT_shader_framebuffer_fetch */ +#ifndef GL_EXT_shader_framebuffer_fetch_non_coherent +#define GL_EXT_shader_framebuffer_fetch_non_coherent 1 +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIEREXTPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferFetchBarrierEXT (void); +#endif +#endif /* GL_EXT_shader_framebuffer_fetch_non_coherent */ + #ifndef GL_EXT_shader_group_vote #define GL_EXT_shader_group_vote 1 #endif /* GL_EXT_shader_group_vote */ @@ -1890,18 +2094,42 @@ GL_APICALL void GL_APIENTRY glTexBufferRangeEXT (GLenum target, GLenum internalf #define GL_TEXTURE_ASTC_DECODE_PRECISION_EXT 0x8F69 #endif /* GL_EXT_texture_compression_astc_decode_mode */ +#ifndef GL_EXT_texture_compression_bptc +#define GL_EXT_texture_compression_bptc 1 +#define GL_COMPRESSED_RGBA_BPTC_UNORM_EXT 0x8E8C +#define GL_COMPRESSED_SRGB_ALPHA_BPTC_UNORM_EXT 0x8E8D +#define GL_COMPRESSED_RGB_BPTC_SIGNED_FLOAT_EXT 0x8E8E +#define GL_COMPRESSED_RGB_BPTC_UNSIGNED_FLOAT_EXT 0x8E8F +#endif /* GL_EXT_texture_compression_bptc */ + #ifndef GL_EXT_texture_compression_dxt1 #define GL_EXT_texture_compression_dxt1 1 #define GL_COMPRESSED_RGB_S3TC_DXT1_EXT 0x83F0 #define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT 0x83F1 #endif /* GL_EXT_texture_compression_dxt1 */ +#ifndef GL_EXT_texture_compression_rgtc +#define GL_EXT_texture_compression_rgtc 1 +#define GL_COMPRESSED_RED_RGTC1_EXT 0x8DBB +#define GL_COMPRESSED_SIGNED_RED_RGTC1_EXT 0x8DBC +#define GL_COMPRESSED_RED_GREEN_RGTC2_EXT 0x8DBD +#define GL_COMPRESSED_SIGNED_RED_GREEN_RGTC2_EXT 0x8DBE +#endif /* GL_EXT_texture_compression_rgtc */ + #ifndef GL_EXT_texture_compression_s3tc #define GL_EXT_texture_compression_s3tc 1 #define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT 0x83F2 #define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT 0x83F3 #endif /* GL_EXT_texture_compression_s3tc */ +#ifndef GL_EXT_texture_compression_s3tc_srgb +#define GL_EXT_texture_compression_s3tc_srgb 1 +#define GL_COMPRESSED_SRGB_S3TC_DXT1_EXT 0x8C4C +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT1_EXT 0x8C4D +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT3_EXT 0x8C4E +#define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F +#endif /* GL_EXT_texture_compression_s3tc_srgb */ + #ifndef GL_EXT_texture_cube_map_array #define GL_EXT_texture_cube_map_array 1 #define GL_TEXTURE_CUBE_MAP_ARRAY_EXT 0x9009 @@ -1923,12 +2151,24 @@ GL_APICALL void GL_APIENTRY glTexBufferRangeEXT (GLenum target, GLenum internalf #ifndef GL_EXT_texture_filter_minmax #define GL_EXT_texture_filter_minmax 1 +#define GL_TEXTURE_REDUCTION_MODE_EXT 0x9366 +#define GL_WEIGHTED_AVERAGE_EXT 0x9367 #endif /* GL_EXT_texture_filter_minmax */ #ifndef GL_EXT_texture_format_BGRA8888 #define GL_EXT_texture_format_BGRA8888 1 #endif /* GL_EXT_texture_format_BGRA8888 */ +#ifndef GL_EXT_texture_format_sRGB_override +#define GL_EXT_texture_format_sRGB_override 1 +#define GL_TEXTURE_FORMAT_SRGB_OVERRIDE_EXT 0x8FBF +#endif /* GL_EXT_texture_format_sRGB_override */ + +#ifndef GL_EXT_texture_mirror_clamp_to_edge +#define GL_EXT_texture_mirror_clamp_to_edge 1 +#define GL_MIRROR_CLAMP_TO_EDGE_EXT 0x8743 +#endif /* GL_EXT_texture_mirror_clamp_to_edge */ + #ifndef GL_EXT_texture_norm16 #define GL_EXT_texture_norm16 1 #define GL_R16_EXT 0x822A @@ -1938,6 +2178,10 @@ GL_APICALL void GL_APIENTRY glTexBufferRangeEXT (GLenum target, GLenum internalf #define GL_RGB16_SNORM_EXT 0x8F9A #endif /* GL_EXT_texture_norm16 */ +#ifndef GL_EXT_texture_query_lod +#define GL_EXT_texture_query_lod 1 +#endif /* GL_EXT_texture_query_lod */ + #ifndef GL_EXT_texture_rg #define GL_EXT_texture_rg 1 #define GL_RED_EXT 0x1903 @@ -2019,6 +2263,16 @@ GL_APICALL void GL_APIENTRY glTextureViewEXT (GLuint texture, GLenum target, GLu #define GL_UNPACK_SKIP_PIXELS_EXT 0x0CF4 #endif /* GL_EXT_unpack_subimage */ +#ifndef GL_EXT_win32_keyed_mutex +#define GL_EXT_win32_keyed_mutex 1 +typedef GLboolean (GL_APIENTRYP PFNGLACQUIREKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key, GLuint timeout); +typedef GLboolean (GL_APIENTRYP PFNGLRELEASEKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL GLboolean GL_APIENTRY glAcquireKeyedMutexWin32EXT (GLuint memory, GLuint64 key, GLuint timeout); +GL_APICALL GLboolean GL_APIENTRY glReleaseKeyedMutexWin32EXT (GLuint memory, GLuint64 key); +#endif +#endif /* GL_EXT_win32_keyed_mutex */ + #ifndef GL_EXT_window_rectangles #define GL_EXT_window_rectangles 1 #define GL_INCLUSIVE_EXT 0x8F10 @@ -2121,6 +2375,11 @@ GL_APICALL void GL_APIENTRY glFramebufferTexture2DMultisampleIMG (GLenum target, #define GL_CUBIC_MIPMAP_LINEAR_IMG 0x913B #endif /* GL_IMG_texture_filter_cubic */ +#ifndef GL_INTEL_blackhole_render +#define GL_INTEL_blackhole_render 1 +#define GL_BLACKHOLE_RENDER_INTEL 0x83FC +#endif /* GL_INTEL_blackhole_render */ + #ifndef GL_INTEL_conservative_rasterization #define GL_INTEL_conservative_rasterization 1 #define GL_CONSERVATIVE_RASTERIZATION_INTEL 0x83FE @@ -2163,7 +2422,7 @@ typedef void (GL_APIENTRYP PFNGLENDPERFQUERYINTELPROC) (GLuint queryHandle); typedef void (GL_APIENTRYP PFNGLGETFIRSTPERFQUERYIDINTELPROC) (GLuint *queryId); typedef void (GL_APIENTRYP PFNGLGETNEXTPERFQUERYIDINTELPROC) (GLuint queryId, GLuint *nextQueryId); typedef void (GL_APIENTRYP PFNGLGETPERFCOUNTERINFOINTELPROC) (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); -typedef void (GL_APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, GLvoid *data, GLuint *bytesWritten); +typedef void (GL_APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); typedef void (GL_APIENTRYP PFNGLGETPERFQUERYIDBYNAMEINTELPROC) (GLchar *queryName, GLuint *queryId); typedef void (GL_APIENTRYP PFNGLGETPERFQUERYINFOINTELPROC) (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); #ifdef GL_GLEXT_PROTOTYPES @@ -2174,12 +2433,22 @@ GL_APICALL void GL_APIENTRY glEndPerfQueryINTEL (GLuint queryHandle); GL_APICALL void GL_APIENTRY glGetFirstPerfQueryIdINTEL (GLuint *queryId); GL_APICALL void GL_APIENTRY glGetNextPerfQueryIdINTEL (GLuint queryId, GLuint *nextQueryId); GL_APICALL void GL_APIENTRY glGetPerfCounterInfoINTEL (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); -GL_APICALL void GL_APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, GLvoid *data, GLuint *bytesWritten); +GL_APICALL void GL_APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); GL_APICALL void GL_APIENTRY glGetPerfQueryIdByNameINTEL (GLchar *queryName, GLuint *queryId); GL_APICALL void GL_APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); #endif #endif /* GL_INTEL_performance_query */ +#ifndef GL_MESA_framebuffer_flip_y +#define GL_MESA_framebuffer_flip_y 1 +#define GL_FRAMEBUFFER_FLIP_Y_MESA 0x8BBB +#endif /* GL_MESA_framebuffer_flip_y */ + +#ifndef GL_MESA_program_binary_formats +#define GL_MESA_program_binary_formats 1 +#define GL_PROGRAM_BINARY_FORMAT_MESA 0x875F +#endif /* GL_MESA_program_binary_formats */ + #ifndef GL_MESA_shader_integer_functions #define GL_MESA_shader_integer_functions 1 #endif /* GL_MESA_shader_integer_functions */ @@ -2284,6 +2553,27 @@ GL_APICALL void GL_APIENTRY glBlendBarrierNV (void); #define GL_BLEND_ADVANCED_COHERENT_NV 0x9285 #endif /* GL_NV_blend_equation_advanced_coherent */ +#ifndef GL_NV_blend_minmax_factor +#define GL_NV_blend_minmax_factor 1 +#define GL_FACTOR_MIN_AMD 0x901C +#define GL_FACTOR_MAX_AMD 0x901D +#endif /* GL_NV_blend_minmax_factor */ + +#ifndef GL_NV_clip_space_w_scaling +#define GL_NV_clip_space_w_scaling 1 +#define GL_VIEWPORT_POSITION_W_SCALE_NV 0x937C +#define GL_VIEWPORT_POSITION_W_SCALE_X_COEFF_NV 0x937D +#define GL_VIEWPORT_POSITION_W_SCALE_Y_COEFF_NV 0x937E +typedef void (GL_APIENTRYP PFNGLVIEWPORTPOSITIONWSCALENVPROC) (GLuint index, GLfloat xcoeff, GLfloat ycoeff); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glViewportPositionWScaleNV (GLuint index, GLfloat xcoeff, GLfloat ycoeff); +#endif +#endif /* GL_NV_clip_space_w_scaling */ + +#ifndef GL_NV_compute_shader_derivatives +#define GL_NV_compute_shader_derivatives 1 +#endif /* GL_NV_compute_shader_derivatives */ + #ifndef GL_NV_conditional_render #define GL_NV_conditional_render 1 #define GL_QUERY_WAIT_NV 0x8E13 @@ -2310,6 +2600,11 @@ GL_APICALL void GL_APIENTRY glSubpixelPrecisionBiasNV (GLuint xbits, GLuint ybit #endif #endif /* GL_NV_conservative_raster */ +#ifndef GL_NV_conservative_raster_pre_snap +#define GL_NV_conservative_raster_pre_snap 1 +#define GL_CONSERVATIVE_RASTER_MODE_PRE_SNAP_NV 0x9550 +#endif /* GL_NV_conservative_raster_pre_snap */ + #ifndef GL_NV_conservative_raster_pre_snap_triangles #define GL_NV_conservative_raster_pre_snap_triangles 1 #define GL_CONSERVATIVE_RASTER_MODE_NV 0x954D @@ -2655,6 +2950,34 @@ GL_APICALL void GL_APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum #endif #endif /* GL_NV_internalformat_sample_query */ +#ifndef GL_NV_memory_attachment +#define GL_NV_memory_attachment 1 +#define GL_ATTACHED_MEMORY_OBJECT_NV 0x95A4 +#define GL_ATTACHED_MEMORY_OFFSET_NV 0x95A5 +#define GL_MEMORY_ATTACHABLE_ALIGNMENT_NV 0x95A6 +#define GL_MEMORY_ATTACHABLE_SIZE_NV 0x95A7 +#define GL_MEMORY_ATTACHABLE_NV 0x95A8 +#define GL_DETACHED_MEMORY_INCARNATION_NV 0x95A9 +#define GL_DETACHED_TEXTURES_NV 0x95AA +#define GL_DETACHED_BUFFERS_NV 0x95AB +#define GL_MAX_DETACHED_TEXTURES_NV 0x95AC +#define GL_MAX_DETACHED_BUFFERS_NV 0x95AD +typedef void (GL_APIENTRYP PFNGLGETMEMORYOBJECTDETACHEDRESOURCESUIVNVPROC) (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +typedef void (GL_APIENTRYP PFNGLRESETMEMORYOBJECTPARAMETERNVPROC) (GLuint memory, GLenum pname); +typedef void (GL_APIENTRYP PFNGLTEXATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLBUFFERATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLTEXTUREATTACHMEMORYNVPROC) (GLuint texture, GLuint memory, GLuint64 offset); +typedef void (GL_APIENTRYP PFNGLNAMEDBUFFERATTACHMEMORYNVPROC) (GLuint buffer, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glGetMemoryObjectDetachedResourcesuivNV (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +GL_APICALL void GL_APIENTRY glResetMemoryObjectParameterNV (GLuint memory, GLenum pname); +GL_APICALL void GL_APIENTRY glTexAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glBufferAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glTextureAttachMemoryNV (GLuint texture, GLuint memory, GLuint64 offset); +GL_APICALL void GL_APIENTRY glNamedBufferAttachMemoryNV (GLuint buffer, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_NV_memory_attachment */ + #ifndef GL_NV_non_square_matrices #define GL_NV_non_square_matrices 1 #define GL_FLOAT_MAT2x3_NV 0x8B65 @@ -2681,6 +3004,7 @@ GL_APICALL void GL_APIENTRY glUniformMatrix4x3fvNV (GLint location, GLsizei coun #ifndef GL_NV_path_rendering #define GL_NV_path_rendering 1 +typedef double GLdouble; #define GL_PATH_FORMAT_SVG_NV 0x9070 #define GL_PATH_FORMAT_PS_NV 0x9071 #define GL_STANDARD_FONT_NAME_NV 0x9072 @@ -2891,6 +3215,25 @@ typedef GLenum (GL_APIENTRYP PFNGLPATHGLYPHINDEXARRAYNVPROC) (GLuint firstPathNa typedef GLenum (GL_APIENTRYP PFNGLPATHMEMORYGLYPHINDEXARRAYNVPROC) (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); typedef void (GL_APIENTRYP PFNGLPROGRAMPATHFRAGMENTINPUTGENNVPROC) (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); typedef void (GL_APIENTRYP PFNGLGETPROGRAMRESOURCEFVNVPROC) (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params); +typedef void (GL_APIENTRYP PFNGLMATRIXFRUSTUMEXTPROC) (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADIDENTITYEXTPROC) (GLenum mode); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXLOADDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULTTRANSPOSEFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULTTRANSPOSEDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULTFEXTPROC) (GLenum mode, const GLfloat *m); +typedef void (GL_APIENTRYP PFNGLMATRIXMULTDEXTPROC) (GLenum mode, const GLdouble *m); +typedef void (GL_APIENTRYP PFNGLMATRIXORTHOEXTPROC) (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +typedef void (GL_APIENTRYP PFNGLMATRIXPOPEXTPROC) (GLenum mode); +typedef void (GL_APIENTRYP PFNGLMATRIXPUSHEXTPROC) (GLenum mode); +typedef void (GL_APIENTRYP PFNGLMATRIXROTATEFEXTPROC) (GLenum mode, GLfloat angle, GLfloat x, GLfloat y, GLfloat z); +typedef void (GL_APIENTRYP PFNGLMATRIXROTATEDEXTPROC) (GLenum mode, GLdouble angle, GLdouble x, GLdouble y, GLdouble z); +typedef void (GL_APIENTRYP PFNGLMATRIXSCALEFEXTPROC) (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +typedef void (GL_APIENTRYP PFNGLMATRIXSCALEDEXTPROC) (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +typedef void (GL_APIENTRYP PFNGLMATRIXTRANSLATEFEXTPROC) (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +typedef void (GL_APIENTRYP PFNGLMATRIXTRANSLATEDEXTPROC) (GLenum mode, GLdouble x, GLdouble y, GLdouble z); #ifdef GL_GLEXT_PROTOTYPES GL_APICALL GLuint GL_APIENTRY glGenPathsNV (GLsizei range); GL_APICALL void GL_APIENTRY glDeletePathsNV (GLuint path, GLsizei range); @@ -2949,6 +3292,25 @@ GL_APICALL GLenum GL_APIENTRY glPathGlyphIndexArrayNV (GLuint firstPathName, GLe GL_APICALL GLenum GL_APIENTRY glPathMemoryGlyphIndexArrayNV (GLuint firstPathName, GLenum fontTarget, GLsizeiptr fontSize, const void *fontData, GLsizei faceIndex, GLuint firstGlyphIndex, GLsizei numGlyphs, GLuint pathParameterTemplate, GLfloat emScale); GL_APICALL void GL_APIENTRY glProgramPathFragmentInputGenNV (GLuint program, GLint location, GLenum genMode, GLint components, const GLfloat *coeffs); GL_APICALL void GL_APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum programInterface, GLuint index, GLsizei propCount, const GLenum *props, GLsizei bufSize, GLsizei *length, GLfloat *params); +GL_APICALL void GL_APIENTRY glMatrixFrustumEXT (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +GL_APICALL void GL_APIENTRY glMatrixLoadIdentityEXT (GLenum mode); +GL_APICALL void GL_APIENTRY glMatrixLoadTransposefEXT (GLenum mode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixLoadTransposedEXT (GLenum mode, const GLdouble *m); +GL_APICALL void GL_APIENTRY glMatrixLoadfEXT (GLenum mode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixLoaddEXT (GLenum mode, const GLdouble *m); +GL_APICALL void GL_APIENTRY glMatrixMultTransposefEXT (GLenum mode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixMultTransposedEXT (GLenum mode, const GLdouble *m); +GL_APICALL void GL_APIENTRY glMatrixMultfEXT (GLenum mode, const GLfloat *m); +GL_APICALL void GL_APIENTRY glMatrixMultdEXT (GLenum mode, const GLdouble *m); +GL_APICALL void GL_APIENTRY glMatrixOrthoEXT (GLenum mode, GLdouble left, GLdouble right, GLdouble bottom, GLdouble top, GLdouble zNear, GLdouble zFar); +GL_APICALL void GL_APIENTRY glMatrixPopEXT (GLenum mode); +GL_APICALL void GL_APIENTRY glMatrixPushEXT (GLenum mode); +GL_APICALL void GL_APIENTRY glMatrixRotatefEXT (GLenum mode, GLfloat angle, GLfloat x, GLfloat y, GLfloat z); +GL_APICALL void GL_APIENTRY glMatrixRotatedEXT (GLenum mode, GLdouble angle, GLdouble x, GLdouble y, GLdouble z); +GL_APICALL void GL_APIENTRY glMatrixScalefEXT (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +GL_APICALL void GL_APIENTRY glMatrixScaledEXT (GLenum mode, GLdouble x, GLdouble y, GLdouble z); +GL_APICALL void GL_APIENTRY glMatrixTranslatefEXT (GLenum mode, GLfloat x, GLfloat y, GLfloat z); +GL_APICALL void GL_APIENTRY glMatrixTranslatedEXT (GLenum mode, GLdouble x, GLdouble y, GLdouble z); #endif #endif /* GL_NV_path_rendering */ @@ -2957,6 +3319,14 @@ GL_APICALL void GL_APIENTRY glGetProgramResourcefvNV (GLuint program, GLenum pro #define GL_SHARED_EDGE_NV 0xC0 #endif /* GL_NV_path_rendering_shared_edge */ +#ifndef GL_NV_pixel_buffer_object +#define GL_NV_pixel_buffer_object 1 +#define GL_PIXEL_PACK_BUFFER_NV 0x88EB +#define GL_PIXEL_UNPACK_BUFFER_NV 0x88EC +#define GL_PIXEL_PACK_BUFFER_BINDING_NV 0x88ED +#define GL_PIXEL_UNPACK_BUFFER_BINDING_NV 0x88EF +#endif /* GL_NV_pixel_buffer_object */ + #ifndef GL_NV_polygon_mode #define GL_NV_polygon_mode 1 #define GL_POLYGON_MODE_NV 0x0B40 @@ -3034,6 +3404,18 @@ GL_APICALL void GL_APIENTRY glResolveDepthValuesNV (void); #define GL_NV_sample_mask_override_coverage 1 #endif /* GL_NV_sample_mask_override_coverage */ +#ifndef GL_NV_scissor_exclusive +#define GL_NV_scissor_exclusive 1 +#define GL_SCISSOR_TEST_EXCLUSIVE_NV 0x9555 +#define GL_SCISSOR_BOX_EXCLUSIVE_NV 0x9556 +typedef void (GL_APIENTRYP PFNGLSCISSOREXCLUSIVENVPROC) (GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (GL_APIENTRYP PFNGLSCISSOREXCLUSIVEARRAYVNVPROC) (GLuint first, GLsizei count, const GLint *v); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glScissorExclusiveNV (GLint x, GLint y, GLsizei width, GLsizei height); +GL_APICALL void GL_APIENTRY glScissorExclusiveArrayvNV (GLuint first, GLsizei count, const GLint *v); +#endif +#endif /* GL_NV_scissor_exclusive */ + #ifndef GL_NV_shader_atomic_fp16_vector #define GL_NV_shader_atomic_fp16_vector 1 #endif /* GL_NV_shader_atomic_fp16_vector */ @@ -3052,6 +3434,10 @@ GL_APICALL void GL_APIENTRY glResolveDepthValuesNV (void); #define GL_SAMPLER_CUBE_SHADOW_NV 0x8DC5 #endif /* GL_NV_shadow_samplers_cube */ +#ifndef GL_NV_stereo_view_rendering +#define GL_NV_stereo_view_rendering 1 +#endif /* GL_NV_stereo_view_rendering */ + #ifndef GL_NV_texture_border_clamp #define GL_NV_texture_border_clamp 1 #define GL_TEXTURE_BORDER_COLOR_NV 0x1004 @@ -3148,6 +3534,10 @@ GL_APICALL void GL_APIENTRY glFramebufferTextureMultisampleMultiviewOVR (GLenum #endif #endif /* GL_OVR_multiview_multisampled_render_to_texture */ +#ifndef GL_QCOM_YUV_texture_gather +#define GL_QCOM_YUV_texture_gather 1 +#endif /* GL_QCOM_YUV_texture_gather */ + #ifndef GL_QCOM_alpha_test #define GL_QCOM_alpha_test 1 #define GL_ALPHA_TEST_QCOM 0x0BC0 @@ -3245,6 +3635,38 @@ GL_APICALL void GL_APIENTRY glFramebufferFoveationParametersQCOM (GLuint framebu #define GL_PERFMON_GLOBAL_MODE_QCOM 0x8FA0 #endif /* GL_QCOM_perfmon_global_mode */ +#ifndef GL_QCOM_shader_framebuffer_fetch_noncoherent +#define GL_QCOM_shader_framebuffer_fetch_noncoherent 1 +#define GL_FRAMEBUFFER_FETCH_NONCOHERENT_QCOM 0x96A2 +typedef void (GL_APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIERQCOMPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glFramebufferFetchBarrierQCOM (void); +#endif +#endif /* GL_QCOM_shader_framebuffer_fetch_noncoherent */ + +#ifndef GL_QCOM_shader_framebuffer_fetch_rate +#define GL_QCOM_shader_framebuffer_fetch_rate 1 +#endif /* GL_QCOM_shader_framebuffer_fetch_rate */ + +#ifndef GL_QCOM_texture_foveated +#define GL_QCOM_texture_foveated 1 +#define GL_TEXTURE_FOVEATED_FEATURE_BITS_QCOM 0x8BFB +#define GL_TEXTURE_FOVEATED_MIN_PIXEL_DENSITY_QCOM 0x8BFC +#define GL_TEXTURE_FOVEATED_FEATURE_QUERY_QCOM 0x8BFD +#define GL_TEXTURE_FOVEATED_NUM_FOCAL_POINTS_QUERY_QCOM 0x8BFE +#define GL_FRAMEBUFFER_INCOMPLETE_FOVEATION_QCOM 0x8BFF +typedef void (GL_APIENTRYP PFNGLTEXTUREFOVEATIONPARAMETERSQCOMPROC) (GLuint texture, GLuint layer, GLuint focalPoint, GLfloat focalX, GLfloat focalY, GLfloat gainX, GLfloat gainY, GLfloat foveaArea); +#ifdef GL_GLEXT_PROTOTYPES +GL_APICALL void GL_APIENTRY glTextureFoveationParametersQCOM (GLuint texture, GLuint layer, GLuint focalPoint, GLfloat focalX, GLfloat focalY, GLfloat gainX, GLfloat gainY, GLfloat foveaArea); +#endif +#endif /* GL_QCOM_texture_foveated */ + +#ifndef GL_QCOM_texture_foveated_subsampled_layout +#define GL_QCOM_texture_foveated_subsampled_layout 1 +#define GL_FOVEATION_SUBSAMPLED_LAYOUT_METHOD_BIT_QCOM 0x00000004 +#define GL_MAX_SHADER_SUBSAMPLED_IMAGE_UNITS_QCOM 0x8FA1 +#endif /* GL_QCOM_texture_foveated_subsampled_layout */ + #ifndef GL_QCOM_tiled_rendering #define GL_QCOM_tiled_rendering 1 #define GL_COLOR_BUFFER_BIT0_QCOM 0x00000001 diff --git a/src/gui/opengl/qopenglext.h b/src/gui/opengl/qopenglext.h index 63873476e4..e3f9205619 100644 --- a/src/gui/opengl/qopenglext.h +++ b/src/gui/opengl/qopenglext.h @@ -12,7 +12,7 @@ extern "C" { #endif /* -** Copyright (c) 2013-2017 The Khronos Group Inc. +** Copyright (c) 2013-2018 The Khronos Group Inc. ** ** Permission is hereby granted, free of charge, to any person obtaining a ** copy of this software and/or associated documentation files (the @@ -57,7 +57,7 @@ extern "C" { #define GLAPI extern #endif -#define GL_GLEXT_VERSION 20170325 +#define GL_GLEXT_VERSION 20190228 /* Generated C header for: * API: gl @@ -359,15 +359,17 @@ GLAPI void APIENTRY glMultTransposeMatrixd (const GLdouble *m); #define GL_TEXTURE_FILTER_CONTROL 0x8500 #define GL_DEPTH_TEXTURE_MODE 0x884B #define GL_COMPARE_R_TO_TEXTURE 0x884E -#define GL_FUNC_ADD 0x8006 -#define GL_FUNC_SUBTRACT 0x800A -#define GL_FUNC_REVERSE_SUBTRACT 0x800B -#define GL_MIN 0x8007 -#define GL_MAX 0x8008 +#define GL_BLEND_COLOR 0x8005 +#define GL_BLEND_EQUATION 0x8009 #define GL_CONSTANT_COLOR 0x8001 #define GL_ONE_MINUS_CONSTANT_COLOR 0x8002 #define GL_CONSTANT_ALPHA 0x8003 #define GL_ONE_MINUS_CONSTANT_ALPHA 0x8004 +#define GL_FUNC_ADD 0x8006 +#define GL_FUNC_REVERSE_SUBTRACT 0x800B +#define GL_FUNC_SUBTRACT 0x800A +#define GL_MIN 0x8007 +#define GL_MAX 0x8008 typedef void (APIENTRYP PFNGLBLENDFUNCSEPARATEPROC) (GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha); typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSPROC) (GLenum mode, const GLint *first, const GLsizei *count, GLsizei drawcount); typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSPROC) (GLenum mode, const GLsizei *count, GLenum type, const void *const*indices, GLsizei drawcount); @@ -2872,6 +2874,42 @@ GLAPI void APIENTRY glTextureBarrier (void); #endif #endif /* GL_VERSION_4_5 */ +#ifndef GL_VERSION_4_6 +#define GL_VERSION_4_6 1 +#define GL_SHADER_BINARY_FORMAT_SPIR_V 0x9551 +#define GL_SPIR_V_BINARY 0x9552 +#define GL_PARAMETER_BUFFER 0x80EE +#define GL_PARAMETER_BUFFER_BINDING 0x80EF +#define GL_CONTEXT_FLAG_NO_ERROR_BIT 0x00000008 +#define GL_VERTICES_SUBMITTED 0x82EE +#define GL_PRIMITIVES_SUBMITTED 0x82EF +#define GL_VERTEX_SHADER_INVOCATIONS 0x82F0 +#define GL_TESS_CONTROL_SHADER_PATCHES 0x82F1 +#define GL_TESS_EVALUATION_SHADER_INVOCATIONS 0x82F2 +#define GL_GEOMETRY_SHADER_PRIMITIVES_EMITTED 0x82F3 +#define GL_FRAGMENT_SHADER_INVOCATIONS 0x82F4 +#define GL_COMPUTE_SHADER_INVOCATIONS 0x82F5 +#define GL_CLIPPING_INPUT_PRIMITIVES 0x82F6 +#define GL_CLIPPING_OUTPUT_PRIMITIVES 0x82F7 +#define GL_POLYGON_OFFSET_CLAMP 0x8E1B +#define GL_SPIR_V_EXTENSIONS 0x9553 +#define GL_NUM_SPIR_V_EXTENSIONS 0x9554 +#define GL_TEXTURE_MAX_ANISOTROPY 0x84FE +#define GL_MAX_TEXTURE_MAX_ANISOTROPY 0x84FF +#define GL_TRANSFORM_FEEDBACK_OVERFLOW 0x82EC +#define GL_TRANSFORM_FEEDBACK_STREAM_OVERFLOW 0x82ED +typedef void (APIENTRYP PFNGLSPECIALIZESHADERPROC) (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTCOUNTPROC) (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTPROC) (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLPOLYGONOFFSETCLAMPPROC) (GLfloat factor, GLfloat units, GLfloat clamp); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glSpecializeShader (GLuint shader, const GLchar *pEntryPoint, GLuint numSpecializationConstants, const GLuint *pConstantIndex, const GLuint *pConstantValue); +GLAPI void APIENTRY glMultiDrawArraysIndirectCount (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirectCount (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glPolygonOffsetClamp (GLfloat factor, GLfloat units, GLfloat clamp); +#endif +#endif /* GL_VERSION_4_6 */ + #ifndef GL_ARB_ES2_compatibility #define GL_ARB_ES2_compatibility 1 #endif /* GL_ARB_ES2_compatibility */ @@ -3475,8 +3513,6 @@ typedef unsigned short GLhalfARB; #ifndef GL_ARB_imaging #define GL_ARB_imaging 1 -#define GL_BLEND_COLOR 0x8005 -#define GL_BLEND_EQUATION 0x8009 #define GL_CONVOLUTION_1D 0x8010 #define GL_CONVOLUTION_2D 0x8011 #define GL_SEPARABLE_2D 0x8012 @@ -3613,11 +3649,11 @@ GLAPI void APIENTRY glResetMinmax (GLenum target); #define GL_ARB_indirect_parameters 1 #define GL_PARAMETER_BUFFER_ARB 0x80EE #define GL_PARAMETER_BUFFER_BINDING_ARB 0x80EF -typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTCOUNTARBPROC) (GLenum mode, GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); -typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTARBPROC) (GLenum mode, GLenum type, GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWARRAYSINDIRECTCOUNTARBPROC) (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWELEMENTSINDIRECTCOUNTARBPROC) (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); #ifdef GL_GLEXT_PROTOTYPES -GLAPI void APIENTRY glMultiDrawArraysIndirectCountARB (GLenum mode, GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); -GLAPI void APIENTRY glMultiDrawElementsIndirectCountARB (GLenum mode, GLenum type, GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawArraysIndirectCountARB (GLenum mode, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawElementsIndirectCountARB (GLenum mode, GLenum type, const void *indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); #endif #endif /* GL_ARB_indirect_parameters */ @@ -3637,6 +3673,25 @@ GLAPI void APIENTRY glVertexAttribDivisorARB (GLuint index, GLuint divisor); #ifndef GL_ARB_internalformat_query2 #define GL_ARB_internalformat_query2 1 #define GL_SRGB_DECODE_ARB 0x8299 +#define GL_VIEW_CLASS_EAC_R11 0x9383 +#define GL_VIEW_CLASS_EAC_RG11 0x9384 +#define GL_VIEW_CLASS_ETC2_RGB 0x9385 +#define GL_VIEW_CLASS_ETC2_RGBA 0x9386 +#define GL_VIEW_CLASS_ETC2_EAC_RGBA 0x9387 +#define GL_VIEW_CLASS_ASTC_4x4_RGBA 0x9388 +#define GL_VIEW_CLASS_ASTC_5x4_RGBA 0x9389 +#define GL_VIEW_CLASS_ASTC_5x5_RGBA 0x938A +#define GL_VIEW_CLASS_ASTC_6x5_RGBA 0x938B +#define GL_VIEW_CLASS_ASTC_6x6_RGBA 0x938C +#define GL_VIEW_CLASS_ASTC_8x5_RGBA 0x938D +#define GL_VIEW_CLASS_ASTC_8x6_RGBA 0x938E +#define GL_VIEW_CLASS_ASTC_8x8_RGBA 0x938F +#define GL_VIEW_CLASS_ASTC_10x5_RGBA 0x9390 +#define GL_VIEW_CLASS_ASTC_10x6_RGBA 0x9391 +#define GL_VIEW_CLASS_ASTC_10x8_RGBA 0x9392 +#define GL_VIEW_CLASS_ASTC_10x10_RGBA 0x9393 +#define GL_VIEW_CLASS_ASTC_12x10_RGBA 0x9394 +#define GL_VIEW_CLASS_ASTC_12x12_RGBA 0x9395 #endif /* GL_ARB_internalformat_query2 */ #ifndef GL_ARB_invalidate_subdata @@ -3894,6 +3949,10 @@ GLAPI void APIENTRY glPointParameterfvARB (GLenum pname, const GLfloat *params); #define GL_COORD_REPLACE_ARB 0x8862 #endif /* GL_ARB_point_sprite */ +#ifndef GL_ARB_polygon_offset_clamp +#define GL_ARB_polygon_offset_clamp 1 +#endif /* GL_ARB_polygon_offset_clamp */ + #ifndef GL_ARB_post_depth_coverage #define GL_ARB_post_depth_coverage 1 #endif /* GL_ARB_post_depth_coverage */ @@ -4292,6 +4351,10 @@ GLAPI void APIENTRY glTexPageCommitmentARB (GLenum target, GLint level, GLint xo #define GL_ARB_sparse_texture_clamp 1 #endif /* GL_ARB_sparse_texture_clamp */ +#ifndef GL_ARB_spirv_extensions +#define GL_ARB_spirv_extensions 1 +#endif /* GL_ARB_spirv_extensions */ + #ifndef GL_ARB_stencil_texturing #define GL_ARB_stencil_texturing 1 #endif /* GL_ARB_stencil_texturing */ @@ -4444,6 +4507,10 @@ GLAPI void APIENTRY glGetCompressedTexImageARB (GLenum target, GLint level, void #define GL_DOT3_RGBA_ARB 0x86AF #endif /* GL_ARB_texture_env_dot3 */ +#ifndef GL_ARB_texture_filter_anisotropic +#define GL_ARB_texture_filter_anisotropic 1 +#endif /* GL_ARB_texture_filter_anisotropic */ + #ifndef GL_ARB_texture_filter_minmax #define GL_ARB_texture_filter_minmax 1 #define GL_TEXTURE_REDUCTION_MODE_ARB 0x9366 @@ -4949,6 +5016,16 @@ GLAPI void APIENTRY glBlendBarrierKHR (void); #define GL_CONTEXT_FLAG_NO_ERROR_BIT_KHR 0x00000008 #endif /* GL_KHR_no_error */ +#ifndef GL_KHR_parallel_shader_compile +#define GL_KHR_parallel_shader_compile 1 +#define GL_MAX_SHADER_COMPILER_THREADS_KHR 0x91B0 +#define GL_COMPLETION_STATUS_KHR 0x91B1 +typedef void (APIENTRYP PFNGLMAXSHADERCOMPILERTHREADSKHRPROC) (GLuint count); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glMaxShaderCompilerThreadsKHR (GLuint count); +#endif +#endif /* GL_KHR_parallel_shader_compile */ + #ifndef GL_KHR_robust_buffer_access_behavior #define GL_KHR_robust_buffer_access_behavior 1 #endif /* GL_KHR_robust_buffer_access_behavior */ @@ -5389,6 +5466,22 @@ GLAPI void APIENTRY glBlendEquationSeparateIndexedAMD (GLuint buf, GLenum modeRG #endif #endif /* GL_AMD_draw_buffers_blend */ +#ifndef GL_AMD_framebuffer_multisample_advanced +#define GL_AMD_framebuffer_multisample_advanced 1 +#define GL_RENDERBUFFER_STORAGE_SAMPLES_AMD 0x91B2 +#define GL_MAX_COLOR_FRAMEBUFFER_SAMPLES_AMD 0x91B3 +#define GL_MAX_COLOR_FRAMEBUFFER_STORAGE_SAMPLES_AMD 0x91B4 +#define GL_MAX_DEPTH_STENCIL_FRAMEBUFFER_SAMPLES_AMD 0x91B5 +#define GL_NUM_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B6 +#define GL_SUPPORTED_MULTISAMPLE_MODES_AMD 0x91B7 +typedef void (APIENTRYP PFNGLRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLNAMEDRENDERBUFFERSTORAGEMULTISAMPLEADVANCEDAMDPROC) (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glRenderbufferStorageMultisampleAdvancedAMD (GLenum target, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +GLAPI void APIENTRY glNamedRenderbufferStorageMultisampleAdvancedAMD (GLuint renderbuffer, GLsizei samples, GLsizei storageSamples, GLenum internalformat, GLsizei width, GLsizei height); +#endif +#endif /* GL_AMD_framebuffer_multisample_advanced */ + #ifndef GL_AMD_framebuffer_sample_positions #define GL_AMD_framebuffer_sample_positions 1 #define GL_SUBSAMPLE_DISTANCE_AMD 0x883F @@ -5428,6 +5521,10 @@ GLAPI void APIENTRY glGetNamedFramebufferParameterfvAMD (GLuint framebuffer, GLe #define GL_FLOAT16_MAT4x3_AMD 0x91CD #endif /* GL_AMD_gpu_shader_half_float */ +#ifndef GL_AMD_gpu_shader_int16 +#define GL_AMD_gpu_shader_int16 1 +#endif /* GL_AMD_gpu_shader_int16 */ + #ifndef GL_AMD_gpu_shader_int64 #define GL_AMD_gpu_shader_int64 1 typedef int64_t GLint64EXT; @@ -5649,6 +5746,14 @@ GLAPI void APIENTRY glSetMultisamplefvAMD (GLenum pname, GLuint index, const GLf #define GL_AMD_shader_explicit_vertex_parameter 1 #endif /* GL_AMD_shader_explicit_vertex_parameter */ +#ifndef GL_AMD_shader_gpu_shader_half_float_fetch +#define GL_AMD_shader_gpu_shader_half_float_fetch 1 +#endif /* GL_AMD_shader_gpu_shader_half_float_fetch */ + +#ifndef GL_AMD_shader_image_load_store_lod +#define GL_AMD_shader_image_load_store_lod 1 +#endif /* GL_AMD_shader_image_load_store_lod */ + #ifndef GL_AMD_shader_stencil_export #define GL_AMD_shader_stencil_export 1 #endif /* GL_AMD_shader_stencil_export */ @@ -5688,6 +5793,10 @@ GLAPI void APIENTRY glStencilOpValueAMD (GLenum face, GLuint value); #endif #endif /* GL_AMD_stencil_operation_extended */ +#ifndef GL_AMD_texture_gather_bias_lod +#define GL_AMD_texture_gather_bias_lod 1 +#endif /* GL_AMD_texture_gather_bias_lod */ + #ifndef GL_AMD_texture_texture4 #define GL_AMD_texture_texture4 1 #endif /* GL_AMD_texture_texture4 */ @@ -6388,6 +6497,17 @@ GLAPI void APIENTRY glVertexBlendEnvfATI (GLenum pname, GLfloat param); #define GL_422_REV_AVERAGE_EXT 0x80CF #endif /* GL_EXT_422_pixels */ +#ifndef GL_EXT_EGL_image_storage +#define GL_EXT_EGL_image_storage 1 +typedef void *GLeglImageOES; +typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXSTORAGEEXTPROC) (GLenum target, GLeglImageOES image, const GLint* attrib_list); +typedef void (APIENTRYP PFNGLEGLIMAGETARGETTEXTURESTORAGEEXTPROC) (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glEGLImageTargetTexStorageEXT (GLenum target, GLeglImageOES image, const GLint* attrib_list); +GLAPI void APIENTRY glEGLImageTargetTextureStorageEXT (GLuint texture, GLeglImageOES image, const GLint* attrib_list); +#endif +#endif /* GL_EXT_EGL_image_storage */ + #ifndef GL_EXT_abgr #define GL_EXT_abgr 1 #define GL_ABGR_EXT 0x8000 @@ -7239,6 +7359,17 @@ GLAPI void APIENTRY glDrawRangeElementsEXT (GLenum mode, GLuint start, GLuint en #endif #endif /* GL_EXT_draw_range_elements */ +#ifndef GL_EXT_external_buffer +#define GL_EXT_external_buffer 1 +typedef void *GLeglClientBufferEXT; +typedef void (APIENTRYP PFNGLBUFFERSTORAGEEXTERNALEXTPROC) (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEEXTERNALEXTPROC) (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBufferStorageExternalEXT (GLenum target, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +GLAPI void APIENTRY glNamedBufferStorageExternalEXT (GLuint buffer, GLintptr offset, GLsizeiptr size, GLeglClientBufferEXT clientBuffer, GLbitfield flags); +#endif +#endif /* GL_EXT_external_buffer */ + #ifndef GL_EXT_fog_coord #define GL_EXT_fog_coord 1 #define GL_FOG_COORDINATE_SOURCE_EXT 0x8450 @@ -7582,6 +7713,89 @@ GLAPI void APIENTRY glTextureMaterialEXT (GLenum face, GLenum mode); #endif #endif /* GL_EXT_light_texture */ +#ifndef GL_EXT_memory_object +#define GL_EXT_memory_object 1 +#define GL_TEXTURE_TILING_EXT 0x9580 +#define GL_DEDICATED_MEMORY_OBJECT_EXT 0x9581 +#define GL_PROTECTED_MEMORY_OBJECT_EXT 0x959B +#define GL_NUM_TILING_TYPES_EXT 0x9582 +#define GL_TILING_TYPES_EXT 0x9583 +#define GL_OPTIMAL_TILING_EXT 0x9584 +#define GL_LINEAR_TILING_EXT 0x9585 +#define GL_NUM_DEVICE_UUIDS_EXT 0x9596 +#define GL_DEVICE_UUID_EXT 0x9597 +#define GL_DRIVER_UUID_EXT 0x9598 +#define GL_UUID_SIZE_EXT 16 +typedef void (APIENTRYP PFNGLGETUNSIGNEDBYTEVEXTPROC) (GLenum pname, GLubyte *data); +typedef void (APIENTRYP PFNGLGETUNSIGNEDBYTEI_VEXTPROC) (GLenum target, GLuint index, GLubyte *data); +typedef void (APIENTRYP PFNGLDELETEMEMORYOBJECTSEXTPROC) (GLsizei n, const GLuint *memoryObjects); +typedef GLboolean (APIENTRYP PFNGLISMEMORYOBJECTEXTPROC) (GLuint memoryObject); +typedef void (APIENTRYP PFNGLCREATEMEMORYOBJECTSEXTPROC) (GLsizei n, GLuint *memoryObjects); +typedef void (APIENTRYP PFNGLMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, const GLint *params); +typedef void (APIENTRYP PFNGLGETMEMORYOBJECTPARAMETERIVEXTPROC) (GLuint memoryObject, GLenum pname, GLint *params); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM2DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM2DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM3DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM3DMULTISAMPLEEXTPROC) (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLBUFFERSTORAGEMEMEXTPROC) (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM2DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM2DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM3DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM3DMULTISAMPLEEXTPROC) (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLNAMEDBUFFERSTORAGEMEMEXTPROC) (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXSTORAGEMEM1DEXTPROC) (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTURESTORAGEMEM1DEXTPROC) (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetUnsignedBytevEXT (GLenum pname, GLubyte *data); +GLAPI void APIENTRY glGetUnsignedBytei_vEXT (GLenum target, GLuint index, GLubyte *data); +GLAPI void APIENTRY glDeleteMemoryObjectsEXT (GLsizei n, const GLuint *memoryObjects); +GLAPI GLboolean APIENTRY glIsMemoryObjectEXT (GLuint memoryObject); +GLAPI void APIENTRY glCreateMemoryObjectsEXT (GLsizei n, GLuint *memoryObjects); +GLAPI void APIENTRY glMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, const GLint *params); +GLAPI void APIENTRY glGetMemoryObjectParameterivEXT (GLuint memoryObject, GLenum pname, GLint *params); +GLAPI void APIENTRY glTexStorageMem2DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem2DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem3DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem3DMultisampleEXT (GLenum target, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glBufferStorageMemEXT (GLenum target, GLsizeiptr size, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem2DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem2DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem3DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem3DMultisampleEXT (GLuint texture, GLsizei samples, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLboolean fixedSampleLocations, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glNamedBufferStorageMemEXT (GLuint buffer, GLsizeiptr size, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTexStorageMem1DEXT (GLenum target, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureStorageMem1DEXT (GLuint texture, GLsizei levels, GLenum internalFormat, GLsizei width, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_EXT_memory_object */ + +#ifndef GL_EXT_memory_object_fd +#define GL_EXT_memory_object_fd 1 +#define GL_HANDLE_TYPE_OPAQUE_FD_EXT 0x9586 +typedef void (APIENTRYP PFNGLIMPORTMEMORYFDEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportMemoryFdEXT (GLuint memory, GLuint64 size, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_memory_object_fd */ + +#ifndef GL_EXT_memory_object_win32 +#define GL_EXT_memory_object_win32 1 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_EXT 0x9587 +#define GL_HANDLE_TYPE_OPAQUE_WIN32_KMT_EXT 0x9588 +#define GL_DEVICE_LUID_EXT 0x9599 +#define GL_DEVICE_NODE_MASK_EXT 0x959A +#define GL_LUID_SIZE_EXT 8 +#define GL_HANDLE_TYPE_D3D12_TILEPOOL_EXT 0x9589 +#define GL_HANDLE_TYPE_D3D12_RESOURCE_EXT 0x958A +#define GL_HANDLE_TYPE_D3D11_IMAGE_EXT 0x958B +#define GL_HANDLE_TYPE_D3D11_IMAGE_KMT_EXT 0x958C +typedef void (APIENTRYP PFNGLIMPORTMEMORYWIN32HANDLEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +typedef void (APIENTRYP PFNGLIMPORTMEMORYWIN32NAMEEXTPROC) (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportMemoryWin32HandleEXT (GLuint memory, GLuint64 size, GLenum handleType, void *handle); +GLAPI void APIENTRY glImportMemoryWin32NameEXT (GLuint memory, GLuint64 size, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_memory_object_win32 */ + #ifndef GL_EXT_misc_attribute #define GL_EXT_misc_attribute 1 #endif /* GL_EXT_misc_attribute */ @@ -7823,6 +8037,55 @@ GLAPI void APIENTRY glSecondaryColorPointerEXT (GLint size, GLenum type, GLsizei #endif #endif /* GL_EXT_secondary_color */ +#ifndef GL_EXT_semaphore +#define GL_EXT_semaphore 1 +#define GL_LAYOUT_GENERAL_EXT 0x958D +#define GL_LAYOUT_COLOR_ATTACHMENT_EXT 0x958E +#define GL_LAYOUT_DEPTH_STENCIL_ATTACHMENT_EXT 0x958F +#define GL_LAYOUT_DEPTH_STENCIL_READ_ONLY_EXT 0x9590 +#define GL_LAYOUT_SHADER_READ_ONLY_EXT 0x9591 +#define GL_LAYOUT_TRANSFER_SRC_EXT 0x9592 +#define GL_LAYOUT_TRANSFER_DST_EXT 0x9593 +#define GL_LAYOUT_DEPTH_READ_ONLY_STENCIL_ATTACHMENT_EXT 0x9530 +#define GL_LAYOUT_DEPTH_ATTACHMENT_STENCIL_READ_ONLY_EXT 0x9531 +typedef void (APIENTRYP PFNGLGENSEMAPHORESEXTPROC) (GLsizei n, GLuint *semaphores); +typedef void (APIENTRYP PFNGLDELETESEMAPHORESEXTPROC) (GLsizei n, const GLuint *semaphores); +typedef GLboolean (APIENTRYP PFNGLISSEMAPHOREEXTPROC) (GLuint semaphore); +typedef void (APIENTRYP PFNGLSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, const GLuint64 *params); +typedef void (APIENTRYP PFNGLGETSEMAPHOREPARAMETERUI64VEXTPROC) (GLuint semaphore, GLenum pname, GLuint64 *params); +typedef void (APIENTRYP PFNGLWAITSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +typedef void (APIENTRYP PFNGLSIGNALSEMAPHOREEXTPROC) (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenSemaphoresEXT (GLsizei n, GLuint *semaphores); +GLAPI void APIENTRY glDeleteSemaphoresEXT (GLsizei n, const GLuint *semaphores); +GLAPI GLboolean APIENTRY glIsSemaphoreEXT (GLuint semaphore); +GLAPI void APIENTRY glSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, const GLuint64 *params); +GLAPI void APIENTRY glGetSemaphoreParameterui64vEXT (GLuint semaphore, GLenum pname, GLuint64 *params); +GLAPI void APIENTRY glWaitSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *srcLayouts); +GLAPI void APIENTRY glSignalSemaphoreEXT (GLuint semaphore, GLuint numBufferBarriers, const GLuint *buffers, GLuint numTextureBarriers, const GLuint *textures, const GLenum *dstLayouts); +#endif +#endif /* GL_EXT_semaphore */ + +#ifndef GL_EXT_semaphore_fd +#define GL_EXT_semaphore_fd 1 +typedef void (APIENTRYP PFNGLIMPORTSEMAPHOREFDEXTPROC) (GLuint semaphore, GLenum handleType, GLint fd); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportSemaphoreFdEXT (GLuint semaphore, GLenum handleType, GLint fd); +#endif +#endif /* GL_EXT_semaphore_fd */ + +#ifndef GL_EXT_semaphore_win32 +#define GL_EXT_semaphore_win32 1 +#define GL_HANDLE_TYPE_D3D12_FENCE_EXT 0x9594 +#define GL_D3D12_FENCE_VALUE_EXT 0x9595 +typedef void (APIENTRYP PFNGLIMPORTSEMAPHOREWIN32HANDLEEXTPROC) (GLuint semaphore, GLenum handleType, void *handle); +typedef void (APIENTRYP PFNGLIMPORTSEMAPHOREWIN32NAMEEXTPROC) (GLuint semaphore, GLenum handleType, const void *name); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glImportSemaphoreWin32HandleEXT (GLuint semaphore, GLenum handleType, void *handle); +GLAPI void APIENTRY glImportSemaphoreWin32NameEXT (GLuint semaphore, GLenum handleType, const void *name); +#endif +#endif /* GL_EXT_semaphore_win32 */ + #ifndef GL_EXT_separate_shader_objects #define GL_EXT_separate_shader_objects 1 #define GL_ACTIVE_PROGRAM_EXT 0x8B8D @@ -7843,6 +8106,19 @@ GLAPI GLuint APIENTRY glCreateShaderProgramEXT (GLenum type, const GLchar *strin #define GL_SEPARATE_SPECULAR_COLOR_EXT 0x81FA #endif /* GL_EXT_separate_specular_color */ +#ifndef GL_EXT_shader_framebuffer_fetch +#define GL_EXT_shader_framebuffer_fetch 1 +#define GL_FRAGMENT_SHADER_DISCARDS_SAMPLES_EXT 0x8A52 +#endif /* GL_EXT_shader_framebuffer_fetch */ + +#ifndef GL_EXT_shader_framebuffer_fetch_non_coherent +#define GL_EXT_shader_framebuffer_fetch_non_coherent 1 +typedef void (APIENTRYP PFNGLFRAMEBUFFERFETCHBARRIEREXTPROC) (void); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glFramebufferFetchBarrierEXT (void); +#endif +#endif /* GL_EXT_shader_framebuffer_fetch_non_coherent */ + #ifndef GL_EXT_shader_image_load_formatted #define GL_EXT_shader_image_load_formatted 1 #endif /* GL_EXT_shader_image_load_formatted */ @@ -8143,6 +8419,8 @@ GLAPI void APIENTRY glTexBufferEXT (GLenum target, GLenum internalformat, GLuint #ifndef GL_EXT_texture_filter_minmax #define GL_EXT_texture_filter_minmax 1 +#define GL_TEXTURE_REDUCTION_MODE_EXT 0x9366 +#define GL_WEIGHTED_AVERAGE_EXT 0x9367 #endif /* GL_EXT_texture_filter_minmax */ #ifndef GL_EXT_texture_integer @@ -8277,6 +8555,11 @@ GLAPI void APIENTRY glTextureNormalEXT (GLenum mode); #define GL_COMPRESSED_SRGB_ALPHA_S3TC_DXT5_EXT 0x8C4F #endif /* GL_EXT_texture_sRGB */ +#ifndef GL_EXT_texture_sRGB_R8 +#define GL_EXT_texture_sRGB_R8 1 +#define GL_SR8_EXT 0x8FBD +#endif /* GL_EXT_texture_sRGB_R8 */ + #ifndef GL_EXT_texture_sRGB_decode #define GL_EXT_texture_sRGB_decode 1 #define GL_TEXTURE_SRGB_DECODE_EXT 0x8A48 @@ -8689,6 +8972,16 @@ GLAPI void APIENTRY glVertexWeightPointerEXT (GLint size, GLenum type, GLsizei s #endif #endif /* GL_EXT_vertex_weighting */ +#ifndef GL_EXT_win32_keyed_mutex +#define GL_EXT_win32_keyed_mutex 1 +typedef GLboolean (APIENTRYP PFNGLACQUIREKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key, GLuint timeout); +typedef GLboolean (APIENTRYP PFNGLRELEASEKEYEDMUTEXWIN32EXTPROC) (GLuint memory, GLuint64 key); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLboolean APIENTRY glAcquireKeyedMutexWin32EXT (GLuint memory, GLuint64 key, GLuint timeout); +GLAPI GLboolean APIENTRY glReleaseKeyedMutexWin32EXT (GLuint memory, GLuint64 key); +#endif +#endif /* GL_EXT_win32_keyed_mutex */ + #ifndef GL_EXT_window_rectangles #define GL_EXT_window_rectangles 1 #define GL_INCLUSIVE_EXT 0x8F10 @@ -8880,6 +9173,11 @@ GLAPI void APIENTRY glBlendFuncSeparateINGR (GLenum sfactorRGB, GLenum dfactorRG #define GL_INTERLACE_READ_INGR 0x8568 #endif /* GL_INGR_interlace_read */ +#ifndef GL_INTEL_blackhole_render +#define GL_INTEL_blackhole_render 1 +#define GL_BLACKHOLE_RENDER_INTEL 0x83FC +#endif /* GL_INTEL_blackhole_render */ + #ifndef GL_INTEL_conservative_rasterization #define GL_INTEL_conservative_rasterization 1 #define GL_CONSERVATIVE_RASTERIZATION_INTEL 0x83FE @@ -8961,7 +9259,7 @@ typedef void (APIENTRYP PFNGLENDPERFQUERYINTELPROC) (GLuint queryHandle); typedef void (APIENTRYP PFNGLGETFIRSTPERFQUERYIDINTELPROC) (GLuint *queryId); typedef void (APIENTRYP PFNGLGETNEXTPERFQUERYIDINTELPROC) (GLuint queryId, GLuint *nextQueryId); typedef void (APIENTRYP PFNGLGETPERFCOUNTERINFOINTELPROC) (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); -typedef void (APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, GLvoid *data, GLuint *bytesWritten); +typedef void (APIENTRYP PFNGLGETPERFQUERYDATAINTELPROC) (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); typedef void (APIENTRYP PFNGLGETPERFQUERYIDBYNAMEINTELPROC) (GLchar *queryName, GLuint *queryId); typedef void (APIENTRYP PFNGLGETPERFQUERYINFOINTELPROC) (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); #ifdef GL_GLEXT_PROTOTYPES @@ -8972,7 +9270,7 @@ GLAPI void APIENTRY glEndPerfQueryINTEL (GLuint queryHandle); GLAPI void APIENTRY glGetFirstPerfQueryIdINTEL (GLuint *queryId); GLAPI void APIENTRY glGetNextPerfQueryIdINTEL (GLuint queryId, GLuint *nextQueryId); GLAPI void APIENTRY glGetPerfCounterInfoINTEL (GLuint queryId, GLuint counterId, GLuint counterNameLength, GLchar *counterName, GLuint counterDescLength, GLchar *counterDesc, GLuint *counterOffset, GLuint *counterDataSize, GLuint *counterTypeEnum, GLuint *counterDataTypeEnum, GLuint64 *rawCounterMaxValue); -GLAPI void APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, GLvoid *data, GLuint *bytesWritten); +GLAPI void APIENTRY glGetPerfQueryDataINTEL (GLuint queryHandle, GLuint flags, GLsizei dataSize, void *data, GLuint *bytesWritten); GLAPI void APIENTRY glGetPerfQueryIdByNameINTEL (GLchar *queryName, GLuint *queryId); GLAPI void APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLength, GLchar *queryName, GLuint *dataSize, GLuint *noCounters, GLuint *noInstances, GLuint *capsMask); #endif @@ -8993,6 +9291,11 @@ GLAPI void APIENTRY glGetPerfQueryInfoINTEL (GLuint queryId, GLuint queryNameLen #define GL_PACK_INVERT_MESA 0x8758 #endif /* GL_MESA_pack_invert */ +#ifndef GL_MESA_program_binary_formats +#define GL_MESA_program_binary_formats 1 +#define GL_PROGRAM_BINARY_FORMAT_MESA 0x875F +#endif /* GL_MESA_program_binary_formats */ + #ifndef GL_MESA_resize_buffers #define GL_MESA_resize_buffers 1 typedef void (APIENTRYP PFNGLRESIZEBUFFERSMESAPROC) (void); @@ -9005,6 +9308,13 @@ GLAPI void APIENTRY glResizeBuffersMESA (void); #define GL_MESA_shader_integer_functions 1 #endif /* GL_MESA_shader_integer_functions */ +#ifndef GL_MESA_tile_raster_order +#define GL_MESA_tile_raster_order 1 +#define GL_TILE_RASTER_ORDER_FIXED_MESA 0x8BB8 +#define GL_TILE_RASTER_ORDER_INCREASING_X_MESA 0x8BB9 +#define GL_TILE_RASTER_ORDER_INCREASING_Y_MESA 0x8BBA +#endif /* GL_MESA_tile_raster_order */ + #ifndef GL_MESA_window_pos #define GL_MESA_window_pos 1 typedef void (APIENTRYP PFNGLWINDOWPOS2DMESAPROC) (GLdouble x, GLdouble y); @@ -9231,6 +9541,10 @@ GLAPI void APIENTRY glBlendBarrierNV (void); #define GL_BLEND_ADVANCED_COHERENT_NV 0x9285 #endif /* GL_NV_blend_equation_advanced_coherent */ +#ifndef GL_NV_blend_minmax_factor +#define GL_NV_blend_minmax_factor 1 +#endif /* GL_NV_blend_minmax_factor */ + #ifndef GL_NV_blend_square #define GL_NV_blend_square 1 #endif /* GL_NV_blend_square */ @@ -9311,6 +9625,10 @@ GLAPI void APIENTRY glCallCommandListNV (GLuint list); #define GL_COMPUTE_PROGRAM_PARAMETER_BUFFER_NV 0x90FC #endif /* GL_NV_compute_program5 */ +#ifndef GL_NV_compute_shader_derivatives +#define GL_NV_compute_shader_derivatives 1 +#endif /* GL_NV_compute_shader_derivatives */ + #ifndef GL_NV_conditional_render #define GL_NV_conditional_render 1 #define GL_QUERY_WAIT_NV 0x8E13 @@ -9348,6 +9666,11 @@ GLAPI void APIENTRY glConservativeRasterParameterfNV (GLenum pname, GLfloat valu #endif #endif /* GL_NV_conservative_raster_dilate */ +#ifndef GL_NV_conservative_raster_pre_snap +#define GL_NV_conservative_raster_pre_snap 1 +#define GL_CONSERVATIVE_RASTER_MODE_PRE_SNAP_NV 0x9550 +#endif /* GL_NV_conservative_raster_pre_snap */ + #ifndef GL_NV_conservative_raster_pre_snap_triangles #define GL_NV_conservative_raster_pre_snap_triangles 1 #define GL_CONSERVATIVE_RASTER_MODE_NV 0x954D @@ -9359,6 +9682,10 @@ GLAPI void APIENTRY glConservativeRasterParameteriNV (GLenum pname, GLint param) #endif #endif /* GL_NV_conservative_raster_pre_snap_triangles */ +#ifndef GL_NV_conservative_raster_underestimation +#define GL_NV_conservative_raster_underestimation 1 +#endif /* GL_NV_conservative_raster_underestimation */ + #ifndef GL_NV_copy_depth_to_color #define GL_NV_copy_depth_to_color 1 #define GL_DEPTH_STENCIL_TO_RGBA_NV 0x886E @@ -9600,6 +9927,10 @@ GLAPI void APIENTRY glGetProgramNamedParameterdvNV (GLuint id, GLsizei len, cons #define GL_NV_fragment_program_option 1 #endif /* GL_NV_fragment_program_option */ +#ifndef GL_NV_fragment_shader_barycentric +#define GL_NV_fragment_shader_barycentric 1 +#endif /* GL_NV_fragment_shader_barycentric */ + #ifndef GL_NV_fragment_shader_interlock #define GL_NV_fragment_shader_interlock 1 #endif /* GL_NV_fragment_shader_interlock */ @@ -9667,7 +9998,7 @@ GLAPI void APIENTRY glFramebufferTextureFaceEXT (GLenum target, GLenum attachmen #define GL_PER_GPU_STORAGE_NV 0x9548 #define GL_MULTICAST_PROGRAMMABLE_SAMPLE_LOCATION_NV 0x9549 typedef void (APIENTRYP PFNGLRENDERGPUMASKNVPROC) (GLbitfield mask); -typedef void (APIENTRYP PFNGLMULTICASTBUFFERSUBDATANVPROC) (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const GLvoid *data); +typedef void (APIENTRYP PFNGLMULTICASTBUFFERSUBDATANVPROC) (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); typedef void (APIENTRYP PFNGLMULTICASTCOPYBUFFERSUBDATANVPROC) (GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); typedef void (APIENTRYP PFNGLMULTICASTCOPYIMAGESUBDATANVPROC) (GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); typedef void (APIENTRYP PFNGLMULTICASTBLITFRAMEBUFFERNVPROC) (GLuint srcGpu, GLuint dstGpu, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); @@ -9680,7 +10011,7 @@ typedef void (APIENTRYP PFNGLMULTICASTGETQUERYOBJECTI64VNVPROC) (GLuint gpu, GLu typedef void (APIENTRYP PFNGLMULTICASTGETQUERYOBJECTUI64VNVPROC) (GLuint gpu, GLuint id, GLenum pname, GLuint64 *params); #ifdef GL_GLEXT_PROTOTYPES GLAPI void APIENTRY glRenderGpuMaskNV (GLbitfield mask); -GLAPI void APIENTRY glMulticastBufferSubDataNV (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const GLvoid *data); +GLAPI void APIENTRY glMulticastBufferSubDataNV (GLbitfield gpuMask, GLuint buffer, GLintptr offset, GLsizeiptr size, const void *data); GLAPI void APIENTRY glMulticastCopyBufferSubDataNV (GLuint readGpu, GLbitfield writeGpuMask, GLuint readBuffer, GLuint writeBuffer, GLintptr readOffset, GLintptr writeOffset, GLsizeiptr size); GLAPI void APIENTRY glMulticastCopyImageSubDataNV (GLuint srcGpu, GLbitfield dstGpuMask, GLuint srcName, GLenum srcTarget, GLint srcLevel, GLint srcX, GLint srcY, GLint srcZ, GLuint dstName, GLenum dstTarget, GLint dstLevel, GLint dstX, GLint dstY, GLint dstZ, GLsizei srcWidth, GLsizei srcHeight, GLsizei srcDepth); GLAPI void APIENTRY glMulticastBlitFramebufferNV (GLuint srcGpu, GLuint dstGpu, GLint srcX0, GLint srcY0, GLint srcX1, GLint srcY1, GLint dstX0, GLint dstY0, GLint dstX1, GLint dstY1, GLbitfield mask, GLenum filter); @@ -9884,6 +10215,96 @@ GLAPI void APIENTRY glGetInternalformatSampleivNV (GLenum target, GLenum interna #define GL_MAX_SPOT_EXPONENT_NV 0x8505 #endif /* GL_NV_light_max_exponent */ +#ifndef GL_NV_memory_attachment +#define GL_NV_memory_attachment 1 +#define GL_ATTACHED_MEMORY_OBJECT_NV 0x95A4 +#define GL_ATTACHED_MEMORY_OFFSET_NV 0x95A5 +#define GL_MEMORY_ATTACHABLE_ALIGNMENT_NV 0x95A6 +#define GL_MEMORY_ATTACHABLE_SIZE_NV 0x95A7 +#define GL_MEMORY_ATTACHABLE_NV 0x95A8 +#define GL_DETACHED_MEMORY_INCARNATION_NV 0x95A9 +#define GL_DETACHED_TEXTURES_NV 0x95AA +#define GL_DETACHED_BUFFERS_NV 0x95AB +#define GL_MAX_DETACHED_TEXTURES_NV 0x95AC +#define GL_MAX_DETACHED_BUFFERS_NV 0x95AD +typedef void (APIENTRYP PFNGLGETMEMORYOBJECTDETACHEDRESOURCESUIVNVPROC) (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +typedef void (APIENTRYP PFNGLRESETMEMORYOBJECTPARAMETERNVPROC) (GLuint memory, GLenum pname); +typedef void (APIENTRYP PFNGLTEXATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLBUFFERATTACHMEMORYNVPROC) (GLenum target, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLTEXTUREATTACHMEMORYNVPROC) (GLuint texture, GLuint memory, GLuint64 offset); +typedef void (APIENTRYP PFNGLNAMEDBUFFERATTACHMEMORYNVPROC) (GLuint buffer, GLuint memory, GLuint64 offset); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGetMemoryObjectDetachedResourcesuivNV (GLuint memory, GLenum pname, GLint first, GLsizei count, GLuint *params); +GLAPI void APIENTRY glResetMemoryObjectParameterNV (GLuint memory, GLenum pname); +GLAPI void APIENTRY glTexAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glBufferAttachMemoryNV (GLenum target, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glTextureAttachMemoryNV (GLuint texture, GLuint memory, GLuint64 offset); +GLAPI void APIENTRY glNamedBufferAttachMemoryNV (GLuint buffer, GLuint memory, GLuint64 offset); +#endif +#endif /* GL_NV_memory_attachment */ + +#ifndef GL_NV_mesh_shader +#define GL_NV_mesh_shader 1 +#define GL_MESH_SHADER_NV 0x9559 +#define GL_TASK_SHADER_NV 0x955A +#define GL_MAX_MESH_UNIFORM_BLOCKS_NV 0x8E60 +#define GL_MAX_MESH_TEXTURE_IMAGE_UNITS_NV 0x8E61 +#define GL_MAX_MESH_IMAGE_UNIFORMS_NV 0x8E62 +#define GL_MAX_MESH_UNIFORM_COMPONENTS_NV 0x8E63 +#define GL_MAX_MESH_ATOMIC_COUNTER_BUFFERS_NV 0x8E64 +#define GL_MAX_MESH_ATOMIC_COUNTERS_NV 0x8E65 +#define GL_MAX_MESH_SHADER_STORAGE_BLOCKS_NV 0x8E66 +#define GL_MAX_COMBINED_MESH_UNIFORM_COMPONENTS_NV 0x8E67 +#define GL_MAX_TASK_UNIFORM_BLOCKS_NV 0x8E68 +#define GL_MAX_TASK_TEXTURE_IMAGE_UNITS_NV 0x8E69 +#define GL_MAX_TASK_IMAGE_UNIFORMS_NV 0x8E6A +#define GL_MAX_TASK_UNIFORM_COMPONENTS_NV 0x8E6B +#define GL_MAX_TASK_ATOMIC_COUNTER_BUFFERS_NV 0x8E6C +#define GL_MAX_TASK_ATOMIC_COUNTERS_NV 0x8E6D +#define GL_MAX_TASK_SHADER_STORAGE_BLOCKS_NV 0x8E6E +#define GL_MAX_COMBINED_TASK_UNIFORM_COMPONENTS_NV 0x8E6F +#define GL_MAX_MESH_WORK_GROUP_INVOCATIONS_NV 0x95A2 +#define GL_MAX_TASK_WORK_GROUP_INVOCATIONS_NV 0x95A3 +#define GL_MAX_MESH_TOTAL_MEMORY_SIZE_NV 0x9536 +#define GL_MAX_TASK_TOTAL_MEMORY_SIZE_NV 0x9537 +#define GL_MAX_MESH_OUTPUT_VERTICES_NV 0x9538 +#define GL_MAX_MESH_OUTPUT_PRIMITIVES_NV 0x9539 +#define GL_MAX_TASK_OUTPUT_COUNT_NV 0x953A +#define GL_MAX_DRAW_MESH_TASKS_COUNT_NV 0x953D +#define GL_MAX_MESH_VIEWS_NV 0x9557 +#define GL_MESH_OUTPUT_PER_VERTEX_GRANULARITY_NV 0x92DF +#define GL_MESH_OUTPUT_PER_PRIMITIVE_GRANULARITY_NV 0x9543 +#define GL_MAX_MESH_WORK_GROUP_SIZE_NV 0x953B +#define GL_MAX_TASK_WORK_GROUP_SIZE_NV 0x953C +#define GL_MESH_WORK_GROUP_SIZE_NV 0x953E +#define GL_TASK_WORK_GROUP_SIZE_NV 0x953F +#define GL_MESH_VERTICES_OUT_NV 0x9579 +#define GL_MESH_PRIMITIVES_OUT_NV 0x957A +#define GL_MESH_OUTPUT_TYPE_NV 0x957B +#define GL_UNIFORM_BLOCK_REFERENCED_BY_MESH_SHADER_NV 0x959C +#define GL_UNIFORM_BLOCK_REFERENCED_BY_TASK_SHADER_NV 0x959D +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_MESH_SHADER_NV 0x959E +#define GL_ATOMIC_COUNTER_BUFFER_REFERENCED_BY_TASK_SHADER_NV 0x959F +#define GL_REFERENCED_BY_MESH_SHADER_NV 0x95A0 +#define GL_REFERENCED_BY_TASK_SHADER_NV 0x95A1 +#define GL_MESH_SUBROUTINE_NV 0x957C +#define GL_TASK_SUBROUTINE_NV 0x957D +#define GL_MESH_SUBROUTINE_UNIFORM_NV 0x957E +#define GL_TASK_SUBROUTINE_UNIFORM_NV 0x957F +#define GL_MESH_SHADER_BIT_NV 0x00000040 +#define GL_TASK_SHADER_BIT_NV 0x00000080 +typedef void (APIENTRYP PFNGLDRAWMESHTASKSNVPROC) (GLuint first, GLuint count); +typedef void (APIENTRYP PFNGLDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect); +typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTNVPROC) (GLintptr indirect, GLsizei drawcount, GLsizei stride); +typedef void (APIENTRYP PFNGLMULTIDRAWMESHTASKSINDIRECTCOUNTNVPROC) (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glDrawMeshTasksNV (GLuint first, GLuint count); +GLAPI void APIENTRY glDrawMeshTasksIndirectNV (GLintptr indirect); +GLAPI void APIENTRY glMultiDrawMeshTasksIndirectNV (GLintptr indirect, GLsizei drawcount, GLsizei stride); +GLAPI void APIENTRY glMultiDrawMeshTasksIndirectCountNV (GLintptr indirect, GLintptr drawcount, GLsizei maxdrawcount, GLsizei stride); +#endif +#endif /* GL_NV_mesh_shader */ + #ifndef GL_NV_multisample_coverage #define GL_NV_multisample_coverage 1 #endif /* GL_NV_multisample_coverage */ @@ -10311,6 +10732,32 @@ GLAPI void APIENTRY glPrimitiveRestartIndexNV (GLuint index); #endif #endif /* GL_NV_primitive_restart */ +#ifndef GL_NV_query_resource +#define GL_NV_query_resource 1 +#define GL_QUERY_RESOURCE_TYPE_VIDMEM_ALLOC_NV 0x9540 +#define GL_QUERY_RESOURCE_MEMTYPE_VIDMEM_NV 0x9542 +#define GL_QUERY_RESOURCE_SYS_RESERVED_NV 0x9544 +#define GL_QUERY_RESOURCE_TEXTURE_NV 0x9545 +#define GL_QUERY_RESOURCE_RENDERBUFFER_NV 0x9546 +#define GL_QUERY_RESOURCE_BUFFEROBJECT_NV 0x9547 +typedef GLint (APIENTRYP PFNGLQUERYRESOURCENVPROC) (GLenum queryType, GLint tagId, GLuint bufSize, GLint *buffer); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLint APIENTRY glQueryResourceNV (GLenum queryType, GLint tagId, GLuint bufSize, GLint *buffer); +#endif +#endif /* GL_NV_query_resource */ + +#ifndef GL_NV_query_resource_tag +#define GL_NV_query_resource_tag 1 +typedef void (APIENTRYP PFNGLGENQUERYRESOURCETAGNVPROC) (GLsizei n, GLint *tagIds); +typedef void (APIENTRYP PFNGLDELETEQUERYRESOURCETAGNVPROC) (GLsizei n, const GLint *tagIds); +typedef void (APIENTRYP PFNGLQUERYRESOURCETAGNVPROC) (GLint tagId, const GLchar *tagString); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glGenQueryResourceTagNV (GLsizei n, GLint *tagIds); +GLAPI void APIENTRY glDeleteQueryResourceTagNV (GLsizei n, const GLint *tagIds); +GLAPI void APIENTRY glQueryResourceTagNV (GLint tagId, const GLchar *tagString); +#endif +#endif /* GL_NV_query_resource_tag */ + #ifndef GL_NV_register_combiners #define GL_NV_register_combiners 1 #define GL_REGISTER_COMBINERS_NV 0x8522 @@ -10403,6 +10850,11 @@ GLAPI void APIENTRY glGetCombinerStageParameterfvNV (GLenum stage, GLenum pname, #endif #endif /* GL_NV_register_combiners2 */ +#ifndef GL_NV_representative_fragment_test +#define GL_NV_representative_fragment_test 1 +#define GL_REPRESENTATIVE_FRAGMENT_TEST_NV 0x937F +#endif /* GL_NV_representative_fragment_test */ + #ifndef GL_NV_robustness_video_memory_purge #define GL_NV_robustness_video_memory_purge 1 #define GL_PURGED_CONTEXT_RESET_NV 0x92BB @@ -10432,6 +10884,18 @@ GLAPI void APIENTRY glResolveDepthValuesNV (void); #define GL_NV_sample_mask_override_coverage 1 #endif /* GL_NV_sample_mask_override_coverage */ +#ifndef GL_NV_scissor_exclusive +#define GL_NV_scissor_exclusive 1 +#define GL_SCISSOR_TEST_EXCLUSIVE_NV 0x9555 +#define GL_SCISSOR_BOX_EXCLUSIVE_NV 0x9556 +typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVENVPROC) (GLint x, GLint y, GLsizei width, GLsizei height); +typedef void (APIENTRYP PFNGLSCISSOREXCLUSIVEARRAYVNVPROC) (GLuint first, GLsizei count, const GLint *v); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glScissorExclusiveNV (GLint x, GLint y, GLsizei width, GLsizei height); +GLAPI void APIENTRY glScissorExclusiveArrayvNV (GLuint first, GLsizei count, const GLint *v); +#endif +#endif /* GL_NV_scissor_exclusive */ + #ifndef GL_NV_shader_atomic_counters #define GL_NV_shader_atomic_counters 1 #endif /* GL_NV_shader_atomic_counters */ @@ -10496,6 +10960,10 @@ GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLs #define GL_NV_shader_storage_buffer_object 1 #endif /* GL_NV_shader_storage_buffer_object */ +#ifndef GL_NV_shader_texture_footprint +#define GL_NV_shader_texture_footprint 1 +#endif /* GL_NV_shader_texture_footprint */ + #ifndef GL_NV_shader_thread_group #define GL_NV_shader_thread_group 1 #define GL_WARP_SIZE_NV 0x9339 @@ -10507,6 +10975,47 @@ GLAPI void APIENTRY glProgramUniformui64vNV (GLuint program, GLint location, GLs #define GL_NV_shader_thread_shuffle 1 #endif /* GL_NV_shader_thread_shuffle */ +#ifndef GL_NV_shading_rate_image +#define GL_NV_shading_rate_image 1 +#define GL_SHADING_RATE_IMAGE_NV 0x9563 +#define GL_SHADING_RATE_NO_INVOCATIONS_NV 0x9564 +#define GL_SHADING_RATE_1_INVOCATION_PER_PIXEL_NV 0x9565 +#define GL_SHADING_RATE_1_INVOCATION_PER_1X2_PIXELS_NV 0x9566 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X1_PIXELS_NV 0x9567 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X2_PIXELS_NV 0x9568 +#define GL_SHADING_RATE_1_INVOCATION_PER_2X4_PIXELS_NV 0x9569 +#define GL_SHADING_RATE_1_INVOCATION_PER_4X2_PIXELS_NV 0x956A +#define GL_SHADING_RATE_1_INVOCATION_PER_4X4_PIXELS_NV 0x956B +#define GL_SHADING_RATE_2_INVOCATIONS_PER_PIXEL_NV 0x956C +#define GL_SHADING_RATE_4_INVOCATIONS_PER_PIXEL_NV 0x956D +#define GL_SHADING_RATE_8_INVOCATIONS_PER_PIXEL_NV 0x956E +#define GL_SHADING_RATE_16_INVOCATIONS_PER_PIXEL_NV 0x956F +#define GL_SHADING_RATE_IMAGE_BINDING_NV 0x955B +#define GL_SHADING_RATE_IMAGE_TEXEL_WIDTH_NV 0x955C +#define GL_SHADING_RATE_IMAGE_TEXEL_HEIGHT_NV 0x955D +#define GL_SHADING_RATE_IMAGE_PALETTE_SIZE_NV 0x955E +#define GL_MAX_COARSE_FRAGMENT_SAMPLES_NV 0x955F +#define GL_SHADING_RATE_SAMPLE_ORDER_DEFAULT_NV 0x95AE +#define GL_SHADING_RATE_SAMPLE_ORDER_PIXEL_MAJOR_NV 0x95AF +#define GL_SHADING_RATE_SAMPLE_ORDER_SAMPLE_MAJOR_NV 0x95B0 +typedef void (APIENTRYP PFNGLBINDSHADINGRATEIMAGENVPROC) (GLuint texture); +typedef void (APIENTRYP PFNGLGETSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint entry, GLenum *rate); +typedef void (APIENTRYP PFNGLGETSHADINGRATESAMPLELOCATIONIVNVPROC) (GLenum rate, GLuint samples, GLuint index, GLint *location); +typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEBARRIERNVPROC) (GLboolean synchronize); +typedef void (APIENTRYP PFNGLSHADINGRATEIMAGEPALETTENVPROC) (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates); +typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERNVPROC) (GLenum order); +typedef void (APIENTRYP PFNGLSHADINGRATESAMPLEORDERCUSTOMNVPROC) (GLenum rate, GLuint samples, const GLint *locations); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI void APIENTRY glBindShadingRateImageNV (GLuint texture); +GLAPI void APIENTRY glGetShadingRateImagePaletteNV (GLuint viewport, GLuint entry, GLenum *rate); +GLAPI void APIENTRY glGetShadingRateSampleLocationivNV (GLenum rate, GLuint samples, GLuint index, GLint *location); +GLAPI void APIENTRY glShadingRateImageBarrierNV (GLboolean synchronize); +GLAPI void APIENTRY glShadingRateImagePaletteNV (GLuint viewport, GLuint first, GLsizei count, const GLenum *rates); +GLAPI void APIENTRY glShadingRateSampleOrderNV (GLenum order); +GLAPI void APIENTRY glShadingRateSampleOrderCustomNV (GLenum rate, GLuint samples, const GLint *locations); +#endif +#endif /* GL_NV_shading_rate_image */ + #ifndef GL_NV_stereo_view_rendering #define GL_NV_stereo_view_rendering 1 #endif /* GL_NV_stereo_view_rendering */ @@ -10587,6 +11096,10 @@ GLAPI void APIENTRY glTextureImage3DMultisampleCoverageNV (GLuint texture, GLenu #define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV 0x84F8 #endif /* GL_NV_texture_rectangle */ +#ifndef GL_NV_texture_rectangle_compressed +#define GL_NV_texture_rectangle_compressed 1 +#endif /* GL_NV_texture_rectangle_compressed */ + #ifndef GL_NV_texture_shader #define GL_NV_texture_shader 1 #define GL_OFFSET_TEXTURE_RECTANGLE_NV 0x864C @@ -10813,6 +11326,14 @@ GLAPI void APIENTRY glVDPAUUnmapSurfacesNV (GLsizei numSurface, const GLvdpauSur #endif #endif /* GL_NV_vdpau_interop */ +#ifndef GL_NV_vdpau_interop2 +#define GL_NV_vdpau_interop2 1 +typedef GLvdpauSurfaceNV (APIENTRYP PFNGLVDPAUREGISTERVIDEOSURFACEWITHPICTURESTRUCTURENVPROC) (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames, GLboolean isFrameStructure); +#ifdef GL_GLEXT_PROTOTYPES +GLAPI GLvdpauSurfaceNV APIENTRY glVDPAURegisterVideoSurfaceWithPictureStructureNV (const void *vdpSurface, GLenum target, GLsizei numTextureNames, const GLuint *textureNames, GLboolean isFrameStructure); +#endif +#endif /* GL_NV_vdpau_interop2 */ + #ifndef GL_NV_vertex_array_range #define GL_NV_vertex_array_range 1 #define GL_VERTEX_ARRAY_RANGE_NV 0x851D diff --git a/src/gui/opengl/qopenglextensions_p.h b/src/gui/opengl/qopenglextensions_p.h index af8ee8201d..137f1e831f 100644 --- a/src/gui/opengl/qopenglextensions_p.h +++ b/src/gui/opengl/qopenglextensions_p.h @@ -107,7 +107,7 @@ public: QOpenGLExtensionsPrivate *d() const; private: - static bool isInitialized(const QOpenGLFunctionsPrivate *d) { return d != 0; } + static bool isInitialized(const QOpenGLFunctionsPrivate *d) { return d != nullptr; } }; Q_DECLARE_OPERATORS_FOR_FLAGS(QOpenGLExtensions::OpenGLExtensions) diff --git a/src/gui/opengl/qopenglframebufferobject_p.h b/src/gui/opengl/qopenglframebufferobject_p.h index 778a38b823..644bb6c59b 100644 --- a/src/gui/opengl/qopenglframebufferobject_p.h +++ b/src/gui/opengl/qopenglframebufferobject_p.h @@ -109,8 +109,8 @@ public: class QOpenGLFramebufferObjectPrivate { public: - QOpenGLFramebufferObjectPrivate() : fbo_guard(0), depth_buffer_guard(0) - , stencil_buffer_guard(0) + QOpenGLFramebufferObjectPrivate() : fbo_guard(nullptr), depth_buffer_guard(nullptr) + , stencil_buffer_guard(nullptr) , valid(false) {} ~QOpenGLFramebufferObjectPrivate() {} @@ -135,9 +135,9 @@ public: QOpenGLExtensions funcs; struct ColorAttachment { - ColorAttachment() : internalFormat(0), guard(0) { } + ColorAttachment() : internalFormat(0), guard(nullptr) { } ColorAttachment(const QSize &size, GLenum internalFormat) - : size(size), internalFormat(internalFormat), guard(0) { } + : size(size), internalFormat(internalFormat), guard(nullptr) { } QSize size; GLenum internalFormat; QOpenGLSharedResourceGuard *guard; diff --git a/src/gui/opengl/qopenglpaintengine_p.h b/src/gui/opengl/qopenglpaintengine_p.h index 15ac240b89..81f17572b2 100644 --- a/src/gui/opengl/qopenglpaintengine_p.h +++ b/src/gui/opengl/qopenglpaintengine_p.h @@ -187,9 +187,9 @@ public: QOpenGL2PaintEngineExPrivate(QOpenGL2PaintEngineEx *q_ptr) : q(q_ptr), - shaderManager(0), + shaderManager(nullptr), width(0), height(0), - ctx(0), + ctx(nullptr), useSystemClip(true), elementIndicesVBOId(0), opacityArray(0), @@ -361,9 +361,9 @@ void QOpenGL2PaintEngineExPrivate::uploadData(unsigned int arrayIndex, const GLf opacityBuffer.allocate(data, count * sizeof(float)); } if (arrayIndex == QT_OPACITY_ATTR) - funcs.glVertexAttribPointer(arrayIndex, 1, GL_FLOAT, GL_FALSE, 0, 0); + funcs.glVertexAttribPointer(arrayIndex, 1, GL_FLOAT, GL_FALSE, 0, nullptr); else - funcs.glVertexAttribPointer(arrayIndex, 2, GL_FLOAT, GL_FALSE, 0, 0); + funcs.glVertexAttribPointer(arrayIndex, 2, GL_FLOAT, GL_FALSE, 0, nullptr); } else { // If we already uploaded the data we don't have to do it again if (data == vertexAttribPointers[arrayIndex]) diff --git a/src/gui/opengl/qopenglqueryhelper_p.h b/src/gui/opengl/qopenglqueryhelper_p.h index 60dbf9c743..ad91ca9f96 100644 --- a/src/gui/opengl/qopenglqueryhelper_p.h +++ b/src/gui/opengl/qopenglqueryhelper_p.h @@ -65,18 +65,18 @@ class QOpenGLQueryHelper { public: QOpenGLQueryHelper(QOpenGLContext *context) - : GetQueryObjectuiv(0), - GetQueryObjectiv(0), - GetQueryiv(0), - EndQuery(0), - BeginQuery(0), - IsQuery(0), - DeleteQueries(0), - GenQueries(0), - GetInteger64v(0), - GetQueryObjectui64v(0), - GetQueryObjecti64v(0), - QueryCounter(0) + : GetQueryObjectuiv(nullptr), + GetQueryObjectiv(nullptr), + GetQueryiv(nullptr), + EndQuery(nullptr), + BeginQuery(nullptr), + IsQuery(nullptr), + DeleteQueries(nullptr), + GenQueries(nullptr), + GetInteger64v(nullptr), + GetQueryObjectui64v(nullptr), + GetQueryObjecti64v(nullptr), + QueryCounter(nullptr) { Q_ASSERT(context); diff --git a/src/gui/opengl/qopengltexture.cpp b/src/gui/opengl/qopengltexture.cpp index e04a00e592..61a6202017 100644 --- a/src/gui/opengl/qopengltexture.cpp +++ b/src/gui/opengl/qopengltexture.cpp @@ -1467,6 +1467,122 @@ void QOpenGLTexturePrivate::setData(int mipLevel, int layer, int layerCount, QOp } } +void QOpenGLTexturePrivate::setData(int xOffset, int yOffset, int zOffset, int width, int height, int depth, + int mipLevel, int layer, int layerCount, QOpenGLTexture::CubeMapFace cubeFace, + QOpenGLTexture::PixelFormat sourceFormat, QOpenGLTexture::PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options) +{ + switch (target) { + case QOpenGLTexture::Target1D: + Q_UNUSED(layer); + Q_UNUSED(cubeFace); + Q_UNUSED(layerCount); + Q_UNUSED(yOffset); + Q_UNUSED(zOffset); + Q_UNUSED(height); + Q_UNUSED(depth); + texFuncs->glTextureSubImage1D(textureId, target, bindingTarget, mipLevel, + xOffset, width, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::Target1DArray: + Q_UNUSED(cubeFace); + Q_UNUSED(yOffset); + Q_UNUSED(zOffset); + Q_UNUSED(height); + Q_UNUSED(depth); + texFuncs->glTextureSubImage2D(textureId, target, bindingTarget, mipLevel, + xOffset, layer, + width, + layerCount, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::Target2D: + Q_UNUSED(layer); + Q_UNUSED(cubeFace); + Q_UNUSED(layerCount); + Q_UNUSED(zOffset); + Q_UNUSED(depth); + texFuncs->glTextureSubImage2D(textureId, target, bindingTarget, mipLevel, + xOffset, yOffset, + width, height, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::Target2DArray: + Q_UNUSED(cubeFace); + Q_UNUSED(zOffset); + Q_UNUSED(depth); + texFuncs->glTextureSubImage3D(textureId, target, bindingTarget, mipLevel, + xOffset, yOffset, layer, + width, height, layerCount, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::Target3D: + Q_UNUSED(cubeFace); + Q_UNUSED(layerCount); + texFuncs->glTextureSubImage3D(textureId, target, bindingTarget, mipLevel, + xOffset, yOffset, zOffset, + width, height, depth, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::TargetCubeMap: + Q_UNUSED(layer); + Q_UNUSED(layerCount); + Q_UNUSED(zOffset); + Q_UNUSED(depth); + texFuncs->glTextureSubImage2D(textureId, cubeFace, bindingTarget, mipLevel, + xOffset, yOffset, + width, height, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::TargetCubeMapArray: { + Q_UNUSED(zOffset); + Q_UNUSED(depth); + int faceIndex = cubeFace - QOpenGLTexture::CubeMapPositiveX; + int layerFace = 6 * layer + faceIndex; + texFuncs->glTextureSubImage3D(textureId, target, bindingTarget, mipLevel, + xOffset, yOffset, layerFace, + width, height, + layerCount, + sourceFormat, sourceType, data, options); + break; + } + + case QOpenGLTexture::TargetRectangle: + Q_UNUSED(mipLevel); + Q_UNUSED(layer); + Q_UNUSED(cubeFace); + Q_UNUSED(layerCount); + Q_UNUSED(zOffset); + Q_UNUSED(depth); + texFuncs->glTextureSubImage2D(textureId, target, bindingTarget, 0, + xOffset, yOffset, + width, height, + sourceFormat, sourceType, data, options); + break; + + case QOpenGLTexture::Target2DMultisample: + case QOpenGLTexture::Target2DMultisampleArray: + case QOpenGLTexture::TargetBuffer: + // We don't upload pixel data for these targets + qWarning("QOpenGLTexture::setData(): Texture target does not support pixel data upload"); + break; + } + + // If requested perform automatic mip map generation + if (mipLevel == 0 && autoGenerateMipMaps && mipLevels > 1) { + Q_Q(QOpenGLTexture); + q->generateMipMaps(); + } +} + + void QOpenGLTexturePrivate::setCompressedData(int mipLevel, int layer, int layerCount, QOpenGLTexture::CubeMapFace cubeFace, int dataSize, const void *data, @@ -3380,6 +3496,153 @@ void QOpenGLTexture::setData(PixelFormat sourceFormat, PixelType sourceType, d->setData(0, 0, 1, QOpenGLTexture::CubeMapPositiveX, sourceFormat, sourceType, data, options); } +/*! + \since 5.14 + \overload + + This overload is to be used to update a part of the texture. Parameters \a + xOffset, \a yOffset, \a zOffset specify the texel offsets within the + texture. Parameters \a width, \a height and \a depth specify the dimensions + of the sub image. + + The structure of the pixel data pointed to by \a data is specified by \a + sourceFormat and \a sourceType. The pixel data upload can optionally be + controlled by \a options. +*/ +void QOpenGLTexture::setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options) +{ + Q_D(QOpenGLTexture); + Q_ASSERT(d->textureId); + d->setData(xOffset, yOffset, zOffset, + width, height, depth, + 0, 0, 1, + QOpenGLTexture::CubeMapPositiveX, sourceFormat, + sourceType, data, options); +} + +/*! + \since 5.14 + \overload + + This overload is to be used to update a part of the texture. Parameters \a + xOffset, \a yOffset, \a zOffset specify the texel offsets within the + texture. Parameters \a width, \a height and \a depth specify the dimensions + of the sub image. The mip map level the sub image we want to + update is specified with \a mipLevel. + + The structure of the pixel data pointed to by \a data is specified by \a + sourceFormat and \a sourceType. The pixel data upload can optionally be + controlled by \a options. +*/ +void QOpenGLTexture::setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options) +{ + Q_D(QOpenGLTexture); + Q_ASSERT(d->textureId); + d->setData(xOffset, yOffset, zOffset, + width, height, depth, + mipLevel, 0, 1, + QOpenGLTexture::CubeMapPositiveX, sourceFormat, + sourceType, data, options); +} + +/*! + \since 5.14 + \overload + + This overload is to be used to update a part of the texture. Parameters \a + xOffset, \a yOffset, \a zOffset specify the texel offsets within the + texture. Parameters \a width, \a height and \a depth specify the dimensions + of the sub image. The mip map level and layerof the sub image we want to + update are specified with \a mipLevel and \a layer. + + The structure of the pixel data pointed to by \a data is specified by \a + sourceFormat and \a sourceType. The pixel data upload can optionally be + controlled by \a options. +*/ +void QOpenGLTexture::setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, int layer, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options) +{ + Q_D(QOpenGLTexture); + Q_ASSERT(d->textureId); + d->setData(xOffset, yOffset, zOffset, + width, height, depth, + mipLevel, layer, 1, + QOpenGLTexture::CubeMapPositiveX, sourceFormat, + sourceType, data, options); +} + +/*! + \since 5.14 + \overload + + This overload is to be used to update a part of the texture. Parameters \a + xOffset, \a yOffset, \a zOffset specify the texel offsets within the + texture. Parameters \a width, \a height and \a depth specify the dimensions + of the sub image.The mip map level, layer and cube map face of the sub + image we want to update are specified with \a mipLevel, \a layer and \a + face. + + The structure of the pixel data pointed to by \a data is specified by \a + sourceFormat and \a sourceType. The pixel data upload can optionally be + controlled by \a options. +*/ +void QOpenGLTexture::setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, int layer, + CubeMapFace face, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options) +{ + Q_D(QOpenGLTexture); + Q_ASSERT(d->textureId); + d->setData(xOffset, yOffset, zOffset, + width, height, depth, + mipLevel, layer, 1, + face, sourceFormat, + sourceType, data, options); +} + +/*! + \since 5.14 + \overload + + This overload is to be used to update a part of the texture. Parameters \a + xOffset, \a yOffset, \a zOffset specify the texel offsets within the + texture. Parameters \a width, \a height and \a depth specify the dimensions + of the sub image.The mip map level, starting layer, cube map face and + number of layers of the sub image we want to update are specified with \a + mipLevel, \a layer, \a face and \a layerCount. + + The structure of the pixel data pointed to by \a data is specified by \a + sourceFormat and \a sourceType. The pixel data upload can optionally be + controlled by \a options. +*/ +void QOpenGLTexture::setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, int layer, + CubeMapFace face, int layerCount, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options) +{ + Q_D(QOpenGLTexture); + Q_ASSERT(d->textureId); + d->setData(xOffset, yOffset, zOffset, + width, height, depth, + mipLevel, layer, layerCount, + face, sourceFormat, + sourceType, data, options); +} + #if QT_DEPRECATED_SINCE(5, 3) /*! \obsolete diff --git a/src/gui/opengl/qopengltexture.h b/src/gui/opengl/qopengltexture.h index c0c5283374..7d984babc8 100644 --- a/src/gui/opengl/qopengltexture.h +++ b/src/gui/opengl/qopengltexture.h @@ -485,6 +485,32 @@ public: void setData(PixelFormat sourceFormat, PixelType sourceType, const void *data, const QOpenGLPixelTransferOptions * const options = nullptr); + void setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options = nullptr); + void setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, int mipLevel, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options = nullptr); + void setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, int layer, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options = nullptr); + void setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, int layer, + CubeMapFace cubeFace, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options = nullptr); + void setData(int xOffset, int yOffset, int zOffset, + int width, int height, int depth, + int mipLevel, int layer, + CubeMapFace cubeFace, int layerCount, + PixelFormat sourceFormat, PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options = nullptr); + // Compressed data upload // ### Qt 6: remove the non-const void * overloads #if QT_DEPRECATED_SINCE(5, 3) diff --git a/src/gui/opengl/qopengltexture_p.h b/src/gui/opengl/qopengltexture_p.h index f7694f77bc..9f3457ad0a 100644 --- a/src/gui/opengl/qopengltexture_p.h +++ b/src/gui/opengl/qopengltexture_p.h @@ -101,6 +101,10 @@ public: void setData(int mipLevel, int layer, int layerCount, QOpenGLTexture::CubeMapFace cubeFace, QOpenGLTexture::PixelFormat sourceFormat, QOpenGLTexture::PixelType sourceType, const void *data, const QOpenGLPixelTransferOptions * const options); + void setData(int xOffset, int yOffset, int zOffset, int width, int height, int depth, + int mipLevel, int layer, int layerCount, QOpenGLTexture::CubeMapFace cubeFace, + QOpenGLTexture::PixelFormat sourceFormat, QOpenGLTexture::PixelType sourceType, + const void *data, const QOpenGLPixelTransferOptions * const options); void setCompressedData(int mipLevel, int layer, int layerCount, QOpenGLTexture::CubeMapFace cubeFace, int dataSize, const void *data, const QOpenGLPixelTransferOptions * const options); diff --git a/src/gui/opengl/qopengltextureglyphcache_p.h b/src/gui/opengl/qopengltextureglyphcache_p.h index 598cb00ee5..aed128cf9e 100644 --- a/src/gui/opengl/qopengltextureglyphcache_p.h +++ b/src/gui/opengl/qopengltextureglyphcache_p.h @@ -139,7 +139,7 @@ public: inline void setPaintEnginePrivate(QOpenGL2PaintEngineExPrivate *p) { pex = p; } - inline const QOpenGLContextGroup *contextGroup() const { return m_textureResource ? m_textureResource->group() : 0; } + inline const QOpenGLContextGroup *contextGroup() const { return m_textureResource ? m_textureResource->group() : nullptr; } inline int serialNumber() const { return m_serialNumber; } diff --git a/src/gui/opengl/qopengltexturehelper_p.h b/src/gui/opengl/qopengltexturehelper_p.h index 00f6f9e5aa..62d0125daf 100644 --- a/src/gui/opengl/qopengltexturehelper_p.h +++ b/src/gui/opengl/qopengltexturehelper_p.h @@ -167,7 +167,7 @@ public: inline void glTextureSubImage3D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, - const GLvoid *pixels, const QOpenGLPixelTransferOptions * const options = 0) + const GLvoid *pixels, const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -181,7 +181,7 @@ public: inline void glTextureSubImage2D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLenum type, - const GLvoid *pixels, const QOpenGLPixelTransferOptions * const options = 0) + const GLvoid *pixels, const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -195,7 +195,7 @@ public: inline void glTextureSubImage1D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLint xoffset, GLsizei width, GLenum format, GLenum type, - const GLvoid *pixels, const QOpenGLPixelTransferOptions * const options = 0) + const GLvoid *pixels, const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -222,7 +222,7 @@ public: inline void glCompressedTextureSubImage1D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid *bits, - const QOpenGLPixelTransferOptions * const options = 0) + const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -238,7 +238,7 @@ public: GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid *bits, - const QOpenGLPixelTransferOptions * const options = 0) + const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -254,7 +254,7 @@ public: GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid *bits, - const QOpenGLPixelTransferOptions * const options = 0) + const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -269,7 +269,7 @@ public: inline void glCompressedTextureImage1D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLenum internalFormat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid *bits, - const QOpenGLPixelTransferOptions * const options = 0) + const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); @@ -284,7 +284,7 @@ public: inline void glCompressedTextureImage2D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLenum internalFormat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid *bits, - const QOpenGLPixelTransferOptions * const options = 0) + const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { @@ -300,7 +300,7 @@ public: inline void glCompressedTextureImage3D(GLuint texture, GLenum target, GLenum bindingTarget, GLint level, GLenum internalFormat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid *bits, - const QOpenGLPixelTransferOptions * const options = 0) + const QOpenGLPixelTransferOptions * const options = nullptr) { if (options) { QOpenGLPixelTransferOptions oldOptions = savePixelUploadOptions(); diff --git a/src/gui/painting/painting.pri b/src/gui/painting/painting.pri index a90abed4c0..972cf387ff 100644 --- a/src/gui/painting/painting.pri +++ b/src/gui/painting/painting.pri @@ -8,7 +8,15 @@ HEADERS += \ painting/qbrush.h \ painting/qcolor.h \ painting/qcolor_p.h \ - painting/qcolorprofile_p.h \ + painting/qcolormatrix_p.h \ + painting/qcolorspace.h \ + painting/qcolorspace_p.h \ + painting/qcolortransferfunction_p.h \ + painting/qcolortransfertable_p.h \ + painting/qcolortransform.h \ + painting/qcolortransform_p.h \ + painting/qcolortrc_p.h \ + painting/qcolortrclut_p.h \ painting/qcosmeticstroker_p.h \ painting/qdatabuffer_p.h \ painting/qdrawhelper_p.h \ @@ -17,6 +25,7 @@ HEADERS += \ painting/qemulationpaintengine_p.h \ painting/qfixed_p.h \ painting/qgrayraster_p.h \ + painting/qicc_p.h \ painting/qmatrix.h \ painting/qmemrotate_p.h \ painting/qoutlinemapper_p.h \ @@ -64,12 +73,15 @@ SOURCES += \ painting/qblittable.cpp \ painting/qbrush.cpp \ painting/qcolor.cpp \ - painting/qcolorprofile.cpp \ + painting/qcolorspace.cpp \ + painting/qcolortransform.cpp \ + painting/qcolortrclut.cpp \ painting/qcompositionfunctions.cpp \ painting/qcosmeticstroker.cpp \ painting/qdrawhelper.cpp \ painting/qemulationpaintengine.cpp \ painting/qgrayraster.c \ + painting/qicc.cpp \ painting/qimagescale.cpp \ painting/qmatrix.cpp \ painting/qmemrotate.cpp \ diff --git a/src/gui/painting/qcolormatrix_p.h b/src/gui/painting/qcolormatrix_p.h new file mode 100644 index 0000000000..3d1dca6222 --- /dev/null +++ b/src/gui/painting/qcolormatrix_p.h @@ -0,0 +1,214 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QCOLORMATRIX_H +#define QCOLORMATRIX_H + +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// + +#include <QtGui/qtguiglobal.h> +#include <cmath> + +QT_BEGIN_NAMESPACE + +// An abstract 3 value color +class QColorVector +{ +public: + QColorVector() = default; + constexpr QColorVector(float x, float y, float z) : x(x), y(y), z(z), _unused(0.0f) { } + float x; // X, x or red + float y; // Y, y or green + float z; // Z, Y or blue + float _unused; + + friend inline bool operator==(const QColorVector &v1, const QColorVector &v2); + friend inline bool operator!=(const QColorVector &v1, const QColorVector &v2); + + static constexpr QColorVector null() { return QColorVector(0.0f, 0.0f, 0.0f); } + // Common whitepoints on normalized XYZ form: + static constexpr QColorVector D50() { return QColorVector(0.96421f, 1.0f, 0.82519f); } + static constexpr QColorVector D65() { return QColorVector(0.95043f, 1.0f, 1.08890f); } +}; + +inline bool operator==(const QColorVector &v1, const QColorVector &v2) +{ + return (std::abs(v1.x - v2.x) < (1.0f / 2048.0f)) + && (std::abs(v1.y - v2.y) < (1.0f / 2048.0f)) + && (std::abs(v1.z - v2.z) < (1.0f / 2048.0f)); +} + +inline bool operator!=(const QColorVector &v1, const QColorVector &v2) +{ + return !(v1 == v2); +} + + +// A matrix mapping 3 value colors. +// Not using QMatrix because only floats are needed and performance is critical. +class QColorMatrix +{ +public: + // We are storing the matrix transposed as that is more convenient: + QColorVector r; + QColorVector g; + QColorVector b; + + friend inline bool operator==(const QColorMatrix &m1, const QColorMatrix &m2); + friend inline bool operator!=(const QColorMatrix &m1, const QColorMatrix &m2); + + bool isValid() const + { + // A color matrix must be invertible + float det = r.x * (b.z * g.y - g.z * b.y) - + r.y * (b.z * g.x - g.z * b.x) + + r.z * (b.y * g.x - g.y * b.x); + return !qFuzzyIsNull(det); + } + + QColorMatrix inverted() const + { + float det = r.x * (b.z * g.y - g.z * b.y) - + r.y * (b.z * g.x - g.z * b.x) + + r.z * (b.y * g.x - g.y * b.x); + det = 1.0f / det; + QColorMatrix inv; + inv.r.x = (g.y * b.z - b.y * g.z) * det; + inv.r.y = (b.y * r.z - r.y * b.z) * det; + inv.r.z = (r.y * g.z - g.y * r.z) * det; + inv.g.x = (b.x * g.z - g.x * b.z) * det; + inv.g.y = (r.x * b.z - b.x * r.z) * det; + inv.g.z = (g.x * r.z - r.x * g.z) * det; + inv.b.x = (g.x * b.y - b.x * g.y) * det; + inv.b.y = (b.x * r.y - r.x * b.y) * det; + inv.b.z = (r.x * g.y - g.x * r.y) * det; + return inv; + } + QColorMatrix operator*(const QColorMatrix &o) const + { + QColorMatrix comb; + comb.r.x = r.x * o.r.x + g.x * o.r.y + b.x * o.r.z; + comb.g.x = r.x * o.g.x + g.x * o.g.y + b.x * o.g.z; + comb.b.x = r.x * o.b.x + g.x * o.b.y + b.x * o.b.z; + + comb.r.y = r.y * o.r.x + g.y * o.r.y + b.y * o.r.z; + comb.g.y = r.y * o.g.x + g.y * o.g.y + b.y * o.g.z; + comb.b.y = r.y * o.b.x + g.y * o.b.y + b.y * o.b.z; + + comb.r.z = r.z * o.r.x + g.z * o.r.y + b.z * o.r.z; + comb.g.z = r.z * o.g.x + g.z * o.g.y + b.z * o.g.z; + comb.b.z = r.z * o.b.x + g.z * o.b.y + b.z * o.b.z; + return comb; + + } + QColorVector map(const QColorVector &c) const + { + return QColorVector { c.x * r.x + c.y * g.x + c.z * b.x, + c.x * r.y + c.y * g.y + c.z * b.y, + c.x * r.z + c.y * g.z + c.z * b.z }; + } + QColorMatrix transposed() const + { + return QColorMatrix { { r.x, g.x, b.x }, + { r.y, g.y, b.y }, + { r.z, g.z, b.z } }; + } + + static QColorMatrix null() + { + return { QColorVector::null(), QColorVector::null(), QColorVector::null() }; + } + static QColorMatrix identity() + { + return { { 1.0f, 0.0f, 0.0f }, { 0.0f, 1.0f, 0.0f }, { 0.0f, 0.0f, 1.0f } }; + } + static QColorMatrix toXyzFromSRgb() + { + return QColorMatrix { { 0.4360217452f, 0.2224751115f, 0.0139281144f }, + { 0.3851087987f, 0.7169067264f, 0.0971015394f }, + { 0.1430812478f, 0.0606181994f, 0.7141585946f } }; + } + static QColorMatrix toXyzFromAdobeRgb() + { + return QColorMatrix { { 0.6097189188f, 0.3111021519f, 0.0194766335f }, + { 0.2052682191f, 0.6256770492f, 0.0608891509f }, + { 0.1492247432f, 0.0632209629f, 0.7448224425f } }; + } + static QColorMatrix toXyzFromDciP3D65() + { + return QColorMatrix { { 0.5150973201f, 0.2411795557f, -0.0010491034f }, + { 0.2919696569f, 0.6922441125f, 0.0418830328f }, + { 0.1571449190f, 0.0665764511f, 0.7843542695f } }; + } + static QColorMatrix toXyzFromProPhotoRgb() + { + return QColorMatrix { { 0.7976672649f, 0.2880374491f, 0.0000000000f }, + { 0.1351922452f, 0.7118769884f, 0.0000000000f }, + { 0.0313525312f, 0.0000856627f, 0.8251883388f } }; + } + static QColorMatrix toXyzFromBt2020() + { + return QColorMatrix { { 0.6506130099f, 0.2695676684f, -0.0018652577f }, + { 0.1865101457f, 0.6840794086f, 0.0172256753f }, + { 0.1270887405f, 0.0463530831f, 0.8098278046f } }; + } +}; + +inline bool operator==(const QColorMatrix &m1, const QColorMatrix &m2) +{ + return (m1.r == m2.r) && (m1.g == m2.g) && (m1.b == m2.b); +} + +inline bool operator!=(const QColorMatrix &m1, const QColorMatrix &m2) +{ + return !(m1 == m2); +} + +QT_END_NAMESPACE + +#endif // QCOLORMATRIX_P_H diff --git a/src/gui/painting/qcolorspace.cpp b/src/gui/painting/qcolorspace.cpp new file mode 100644 index 0000000000..24785f7b61 --- /dev/null +++ b/src/gui/painting/qcolorspace.cpp @@ -0,0 +1,633 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#include "qcolorspace.h" +#include "qcolorspace_p.h" + +#include "qcolortransform.h" +#include "qcolormatrix_p.h" +#include "qcolortransferfunction_p.h" +#include "qcolortransform_p.h" +#include "qicc_p.h" + +#include <qmath.h> +#include <qtransform.h> + +#include <qdebug.h> + +QT_BEGIN_NAMESPACE + +QColorSpacePrivate::QColorSpacePrivate() + : id(QColorSpace::Unknown) + , gamut(QColorSpace::Gamut::Custom) + , transferFunction(QColorSpace::TransferFunction::Custom) + , gamma(0.0f) + , whitePoint(QColorVector::null()) + , toXyz(QColorMatrix::null()) +{ +} + +QColorSpacePrivate::QColorSpacePrivate(QColorSpace::ColorSpaceId colorSpaceId) + : id(colorSpaceId) +{ + switch (colorSpaceId) { + case QColorSpace::Undefined: + gamut = QColorSpace::Gamut::Custom; + transferFunction = QColorSpace::TransferFunction::Custom; + gamma = 0.0f; + description = QStringLiteral("Undefined"); + break; + case QColorSpace::SRgb: + gamut = QColorSpace::Gamut::SRgb; + transferFunction = QColorSpace::TransferFunction::SRgb; + gamma = 2.31f; // ? + description = QStringLiteral("sRGB"); + break; + case QColorSpace::SRgbLinear: + gamut = QColorSpace::Gamut::SRgb; + transferFunction = QColorSpace::TransferFunction::Linear; + gamma = 1.0f; + description = QStringLiteral("Linear sRGB"); + break; + case QColorSpace::AdobeRgb: + gamut = QColorSpace::Gamut::AdobeRgb; + transferFunction = QColorSpace::TransferFunction::Gamma; + gamma = 2.19921875f; // Not quite 2.2, see https://www.adobe.com/digitalimag/pdfs/AdobeRGB1998.pdf + description = QStringLiteral("Adobe RGB"); + break; + case QColorSpace::DisplayP3: + gamut = QColorSpace::Gamut::DciP3D65; + transferFunction = QColorSpace::TransferFunction::SRgb; + gamma = 2.31f; // ? + description = QStringLiteral("Display P3"); + break; + case QColorSpace::ProPhotoRgb: + gamut = QColorSpace::Gamut::ProPhotoRgb; + transferFunction = QColorSpace::TransferFunction::ProPhotoRgb; + gamma = 1.8f; + description = QStringLiteral("ProPhoto RGB"); + break; + case QColorSpace::Bt2020: + gamut = QColorSpace::Gamut::Bt2020; + transferFunction = QColorSpace::TransferFunction::Bt2020; + gamma = 2.1f; // ? + description = QStringLiteral("BT.2020"); + break; + case QColorSpace::Unknown: + qWarning("Can not create an unknown color space"); + Q_FALLTHROUGH(); + default: + Q_UNREACHABLE(); + } + initialize(); +} + +QColorSpacePrivate::QColorSpacePrivate(QColorSpace::Gamut gamut, QColorSpace::TransferFunction fun, float gamma) + : gamut(gamut) + , transferFunction(fun) + , gamma(gamma) +{ + if (!identifyColorSpace()) + id = QColorSpace::Unknown; + initialize(); +} + +bool QColorSpacePrivate::identifyColorSpace() +{ + switch (gamut) { + case QColorSpace::Gamut::SRgb: + if (transferFunction == QColorSpace::TransferFunction::SRgb) { + id = QColorSpace::SRgb; + description = QStringLiteral("sRGB"); + return true; + } + if (transferFunction == QColorSpace::TransferFunction::Linear) { + id = QColorSpace::SRgbLinear; + description = QStringLiteral("Linear sRGB"); + return true; + } + break; + case QColorSpace::Gamut::AdobeRgb: + if (transferFunction == QColorSpace::TransferFunction::Gamma) { + if (qAbs(gamma - 2.19921875f) < (1/1024.0f)) { + id = QColorSpace::AdobeRgb; + description = QStringLiteral("Adobe RGB"); + return true; + } + } + break; + case QColorSpace::Gamut::DciP3D65: + if (transferFunction == QColorSpace::TransferFunction::SRgb) { + id = QColorSpace::DisplayP3; + description = QStringLiteral("Display P3"); + return true; + } + break; + case QColorSpace::Gamut::ProPhotoRgb: + if (transferFunction == QColorSpace::TransferFunction::ProPhotoRgb) { + id = QColorSpace::ProPhotoRgb; + description = QStringLiteral("ProPhoto RGB"); + return true; + } + if (transferFunction == QColorSpace::TransferFunction::Gamma) { + // ProPhoto RGB's curve is effectively gamma 1.8 for 8bit precision. + if (qAbs(gamma - 1.8f) < (1/1024.0f)) { + id = QColorSpace::ProPhotoRgb; + description = QStringLiteral("ProPhoto RGB"); + return true; + } + } + break; + case QColorSpace::Gamut::Bt2020: + if (transferFunction == QColorSpace::TransferFunction::Bt2020) { + id = QColorSpace::Bt2020; + description = QStringLiteral("BT.2020"); + return true; + } + break; + default: + break; + } + return false; +} + +void QColorSpacePrivate::initialize() +{ + setToXyzMatrix(); + setTransferFunction(); +} + +void QColorSpacePrivate::setToXyzMatrix() +{ + switch (gamut) { + case QColorSpace::Gamut::SRgb: + toXyz = QColorMatrix::toXyzFromSRgb(); + whitePoint = QColorVector::D65(); + return; + case QColorSpace::Gamut::AdobeRgb: + toXyz = QColorMatrix::toXyzFromAdobeRgb(); + whitePoint = QColorVector::D65(); + return; + case QColorSpace::Gamut::DciP3D65: + toXyz = QColorMatrix::toXyzFromDciP3D65(); + whitePoint = QColorVector::D65(); + return; + case QColorSpace::Gamut::ProPhotoRgb: + toXyz = QColorMatrix::toXyzFromProPhotoRgb(); + whitePoint = QColorVector::D50(); + return; + case QColorSpace::Gamut::Bt2020: + toXyz = QColorMatrix::toXyzFromBt2020(); + whitePoint = QColorVector::D65(); + return; + case QColorSpace::Gamut::Custom: + toXyz = QColorMatrix::null(); + whitePoint = QColorVector::D50(); + return; + } + Q_UNREACHABLE(); +} + +void QColorSpacePrivate::setTransferFunction() +{ + switch (transferFunction) { + case QColorSpace::TransferFunction::Linear: + trc[0].m_type = QColorTrc::Type::Function; + trc[0].m_fun = QColorTransferFunction(); + break; + case QColorSpace::TransferFunction::Gamma: + trc[0].m_type = QColorTrc::Type::Function; + trc[0].m_fun = QColorTransferFunction::fromGamma(gamma); + break; + case QColorSpace::TransferFunction::SRgb: + trc[0].m_type = QColorTrc::Type::Function; + trc[0].m_fun = QColorTransferFunction::fromSRgb(); + break; + case QColorSpace::TransferFunction::ProPhotoRgb: + trc[0].m_type = QColorTrc::Type::Function; + trc[0].m_fun = QColorTransferFunction::fromProPhotoRgb(); + break; + case QColorSpace::TransferFunction::Bt2020: + trc[0].m_type = QColorTrc::Type::Function; + trc[0].m_fun = QColorTransferFunction::fromBt2020(); + break; + case QColorSpace::TransferFunction::Custom: + break; + default: + Q_UNREACHABLE(); + break; + } + trc[1] = trc[0]; + trc[2] = trc[0]; +} + +QColorTransform QColorSpacePrivate::transformationToColorSpace(const QColorSpacePrivate *out) const +{ + Q_ASSERT(out); + QColorTransform combined; + combined.d_ptr.reset(new QColorTransformPrivate); + combined.d_ptr->colorSpaceIn = this; + combined.d_ptr->colorSpaceOut = out; + combined.d_ptr->colorMatrix = out->toXyz.inverted() * toXyz; + return combined; +} + +/*! + \class QColorSpace + \brief The QColorSpace class provides a color space abstraction. + \since 5.14 + + \ingroup painting + \ingroup appearance + \inmodule QtGui + + Color values can be interpreted in different ways, and based on the interpretation + can live in different spaces. We call this \e {color spaces}. + + QColorSpace provides access to creating several predefined color spaces and + can generate QColorTransforms for converting colors from one color space to + another. + + QColorSpace can also represent color spaces defined by ICC profiles or embedded + in images, that do not otherwise fit the predefined color spaces. + + A color space can generally speaking be conceived as a combination of a transfer + function and a gamut. The gamut defines which colors the color space can represent. + A color space that can represent a wider range of colors is also known as a + wide-gamut color space. The gamut is defined by three primary colors that represent + exactly how red, green, and blue look in this particular color space, and a white + color that represents where and how bright pure white is. + + The transfer function or gamma curve determines how each component in the + color space is encoded. These are used because human perception does not operate + linearly, and the transfer functions try to ensure that colors will seem evenly + spaced to human eyes. +*/ + + +/*! + \enum QColorSpace::ColorSpaceId + + Predefined color spaces. + + \value Undefined An empty, invalid or unsupported color space. + \value Unknown A valid color space that doesn't match any of the predefined color spaces. + \value SRgb The sRGB color space, which Qt operates in by default. It is a close approximation + of how most classic monitors operate, and a mode most software and hardware support. + \l{http://www.color.org/chardata/rgb/srgb.xalter}{ICC registration of sRGB}. + \value SRgbLinear The sRGB color space with linear gamma. Useful for gamma-corrected blending. + \value AdobeRgb The Adobe RGB color space is a classic wide-gamut color space, using a gamma of 2.2. + \l{http://www.color.org/chardata/rgb/adobergb.xalter}{ICC registration of Adobe RGB (1998)} + \value DisplayP3 A color-space using the primaries of DCI-P3, but with the whitepoint and transfer + function of sRGB. Common in modern wide-gamut screens. + \l{http://www.color.org/chardata/rgb/DCIP3.xalter}{ICC registration of DCI-P3} + \value ProPhotoRgb The Pro Photo RGB color space, also known as ROMM RGB is a very wide gamut color space. + \l{http://www.color.org/chardata/rgb/rommrgb.xalter}{ICC registration of ROMM RGB} + \value Bt2020 BT.2020 also known as Rec.2020 is the color space of HDR TVs. + \l{http://www.color.org/chardata/rgb/BT2020.xalter}{ICC registration of BT.2020} +*/ + +/*! + \enum QColorSpace::Gamut + + Predefined gamuts, or sets of primary colors. + + \value Custom The gamut is undefined or does not match any predefined sets. + \value SRgb The sRGB gamut + \value AdobeRgb The Adobe RGB gamut + \value DciP3D65 The DCI-P3 gamut with the D65 whitepoint + \value ProPhotoRgb The ProPhoto RGB gamut with the D50 whitepoint + \value Bt2020 The BT.2020 gamut +*/ + +/*! + \enum QColorSpace::TransferFunction + + Predefined transfer functions or gamma curves. + + \value Custom The custom or null transfer function + \value Linear The linear transfer functions + \value Gamma A transfer function that is a real gamma curve based on the value of gamma() + \value SRgb The sRGB transfer function, composed of linear and gamma parts + \value ProPhotoRgb The ProPhoto RGB transfer function, composed of linear and gamma parts + \value Bt2020 The BT.2020 transfer function, composed of linear and gamma parts +*/ + +/*! + Creates a new colorspace object that represents \a colorSpaceId. + */ +QColorSpace::QColorSpace(QColorSpace::ColorSpaceId colorSpaceId) +{ + static QExplicitlySharedDataPointer<QColorSpacePrivate> predefinedColorspacePrivates[QColorSpace::Bt2020]; + if (colorSpaceId <= QColorSpace::Unknown) { + if (!predefinedColorspacePrivates[0]) + predefinedColorspacePrivates[0] = new QColorSpacePrivate(QColorSpace::Undefined); + d_ptr = predefinedColorspacePrivates[0]; // unknown and undefined both returns the static undefined colorspace. + } else { + if (!predefinedColorspacePrivates[colorSpaceId - 1]) + predefinedColorspacePrivates[colorSpaceId - 1] = new QColorSpacePrivate(colorSpaceId); + d_ptr = predefinedColorspacePrivates[colorSpaceId - 1]; + } + + Q_ASSERT(colorSpaceId == QColorSpace::Undefined || isValid()); +} + +/*! + Creates a custom color space with the gamut \a gamut, using the transfer function \a fun and + optionally \a gamma. + */ +QColorSpace::QColorSpace(QColorSpace::Gamut gamut, QColorSpace::TransferFunction fun, float gamma) + : d_ptr(new QColorSpacePrivate(gamut, fun, gamma)) +{ +} + +/*! + Creates a custom color space with the gamut \a gamut, using a gamma transfer function of + \a gamma. + */ +QColorSpace::QColorSpace(QColorSpace::Gamut gamut, float gamma) + : d_ptr(new QColorSpacePrivate(gamut, TransferFunction::Gamma, gamma)) +{ +} + +QColorSpace::~QColorSpace() +{ +} + +QColorSpace::QColorSpace(QColorSpace &&colorSpace) + : d_ptr(std::move(colorSpace.d_ptr)) +{ +} + +QColorSpace::QColorSpace(const QColorSpace &colorSpace) + : d_ptr(colorSpace.d_ptr) +{ +} + +QColorSpace &QColorSpace::operator=(QColorSpace &&colorSpace) +{ + d_ptr = std::move(colorSpace.d_ptr); + return *this; +} + +QColorSpace &QColorSpace::operator=(const QColorSpace &colorSpace) +{ + d_ptr = colorSpace.d_ptr; + return *this; +} + +/*! + Returns the id of the predefined color space this object + represents or \c Unknown if it doesn't match any of them. +*/ +QColorSpace::ColorSpaceId QColorSpace::colorSpaceId() const noexcept +{ + return d_ptr->id; +} + +/*! + Returns the predefined gamut of the color space + or \c Gamut::Custom if it doesn't match any of them. +*/ +QColorSpace::Gamut QColorSpace::gamut() const noexcept +{ + return d_ptr->gamut; +} + +/*! + Returns the predefined transfer function of the color space + or \c TransferFunction::Custom if it doesn't match any of them. + + \sa gamma() +*/ +QColorSpace::TransferFunction QColorSpace::transferFunction() const noexcept +{ + return d_ptr->transferFunction; +} + +/*! + Returns the gamma value of color spaces with \c TransferFunction::Gamma, + an approximate gamma value for other predefined color spaces, or + 0.0 if no approximate gamma is known. + + \sa transferFunction() +*/ +float QColorSpace::gamma() const noexcept +{ + return d_ptr->gamma; +} + +/*! + Returns an ICC profile representing the color space. + + If the color space was generated from an ICC profile, that profile + is returned, otherwise one is generated. + + \note Even invalid color spaces may return the ICC profile if they + were generated from one, to allow applications to implement wider + support themselves. + + \sa fromIccProfile() +*/ +QByteArray QColorSpace::iccProfile() const +{ + if (!d_ptr->iccProfile.isEmpty()) + return d_ptr->iccProfile; + if (!isValid()) + return QByteArray(); + return QIcc::toIccProfile(*this); +} + +/*! + Creates a QColorSpace from ICC profile \a iccProfile. + + \note Not all ICC profiles are supported. QColorSpace only supports + RGB-XYZ ICC profiles that are three-component matrix-based. + + If the ICC profile is not supported an invalid QColorSpace is returned + where you can still read the original ICC profile using iccProfile(). + + \sa iccProfile() +*/ +QColorSpace QColorSpace::fromIccProfile(const QByteArray &iccProfile) +{ + QColorSpace colorSpace; + if (QIcc::fromIccProfile(iccProfile, &colorSpace)) + return colorSpace; + colorSpace.d_ptr->id = QColorSpace::Undefined; + colorSpace.d_ptr->iccProfile = iccProfile; + return colorSpace; +} + +/*! + Returns \c true if the color space is valid. +*/ +bool QColorSpace::isValid() const noexcept +{ + return d_ptr->id != QColorSpace::Undefined && d_ptr->toXyz.isValid() + && d_ptr->trc[0].isValid() && d_ptr->trc[1].isValid() && d_ptr->trc[2].isValid(); +} + +/*! + \relates QColorSpace + Returns \c true if colorspace \a colorSpace1 is equal to colorspace \a colorSpace2; + otherwise returns \c false +*/ +bool operator==(const QColorSpace &colorSpace1, const QColorSpace &colorSpace2) +{ + if (colorSpace1.d_ptr == colorSpace2.d_ptr) + return true; + + if (colorSpace1.colorSpaceId() == QColorSpace::Undefined && colorSpace2.colorSpaceId() == QColorSpace::Undefined) + return colorSpace1.d_ptr->iccProfile == colorSpace2.d_ptr->iccProfile; + + if (colorSpace1.colorSpaceId() != QColorSpace::Unknown && colorSpace2.colorSpaceId() != QColorSpace::Unknown) + return colorSpace1.colorSpaceId() == colorSpace2.colorSpaceId(); + + if (colorSpace1.gamut() != QColorSpace::Gamut::Custom && colorSpace2.gamut() != QColorSpace::Gamut::Custom) { + if (colorSpace1.gamut() != colorSpace2.gamut()) + return false; + } else { + if (colorSpace1.d_ptr->toXyz != colorSpace2.d_ptr->toXyz) + return false; + } + + if (colorSpace1.transferFunction() != QColorSpace::TransferFunction::Custom && + colorSpace2.transferFunction() != QColorSpace::TransferFunction::Custom) { + if (colorSpace1.transferFunction() != colorSpace2.transferFunction()) + return false; + if (colorSpace1.transferFunction() == QColorSpace::TransferFunction::Gamma) + return colorSpace1.gamma() == colorSpace2.gamma(); + return true; + } + + if (colorSpace1.d_ptr->trc[0] != colorSpace2.d_ptr->trc[0] || + colorSpace1.d_ptr->trc[1] != colorSpace2.d_ptr->trc[1] || + colorSpace1.d_ptr->trc[2] != colorSpace2.d_ptr->trc[2]) + return false; + + return true; +} + +/*! + \fn bool operator!=(const QColorSpace &colorSpace1, const QColorSpace &colorSpace2) + \relates QColorSpace + + Returns \c true if colorspace \a colorspace1 is not equal to colorspace \a colorspace2; + otherwise returns \c false +*/ + +/*! + Generates and returns a color space transformation from this color space to + \a colorspace. +*/ +QColorTransform QColorSpace::transformationToColorSpace(const QColorSpace &colorspace) const +{ + if (!isValid() || !colorspace.isValid()) + return QColorTransform(); + + return d_ptr->transformationToColorSpace(colorspace.d_ptr.constData()); +} + +/*! + \internal +*/ +QColorSpacePrivate *QColorSpace::d_func() +{ + d_ptr.detach(); + return d_ptr.data(); +} + +/*! + \fn const QColorSpacePrivate* QColorSpacePrivate::d_func() const + \internal +*/ + +/***************************************************************************** + QColorSpace stream functions + *****************************************************************************/ +#if !defined(QT_NO_DATASTREAM) +/*! + \fn QDataStream &operator<<(QDataStream &stream, const QColorSpace &colorSpace) + \relates QColorSpace + + Writes the given \a colorSpace to the given \a stream as an ICC profile. + + \sa QColorSpace::iccProfile(), {Serializing Qt Data Types} +*/ + +QDataStream &operator<<(QDataStream &s, const QColorSpace &image) +{ + s << image.iccProfile(); + return s; +} + +/*! + \fn QDataStream &operator>>(QDataStream &stream, QColorSpace &colorSpace) + \relates QColorSpace + + Reads a color space from the given \a stream and stores it in the given + \a colorSpace. + + \sa QColorSpace::fromIccProfile(), {Serializing Qt Data Types} +*/ + +QDataStream &operator>>(QDataStream &s, QColorSpace &colorSpace) +{ + QByteArray iccProfile; + s >> iccProfile; + colorSpace = QColorSpace::fromIccProfile(iccProfile); + return s; +} +#endif // QT_NO_DATASTREAM + +#ifndef QT_NO_DEBUG_STREAM +QDebug operator<<(QDebug dbg, const QColorSpace &colorSpace) +{ + QDebugStateSaver saver(dbg); + dbg.nospace(); + dbg << "QColorSpace("; + dbg << colorSpace.colorSpaceId() << ", " << colorSpace.gamut() << ", " << colorSpace.transferFunction(); + dbg << ", gamma=" << colorSpace.gamma(); + dbg << ')'; + return dbg; +} +#endif + +QT_END_NAMESPACE diff --git a/src/gui/painting/qcolorspace.h b/src/gui/painting/qcolorspace.h new file mode 100644 index 0000000000..923546ec6f --- /dev/null +++ b/src/gui/painting/qcolorspace.h @@ -0,0 +1,136 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QCOLORSPACE_H +#define QCOLORSPACE_H + +#include <QtGui/qtguiglobal.h> +#include <QtGui/qcolortransform.h> +#include <QtCore/qshareddata.h> + +QT_BEGIN_NAMESPACE + +class QColorSpacePrivate; + +class Q_GUI_EXPORT QColorSpace +{ + Q_GADGET +public: + enum ColorSpaceId { + Undefined = 0, + Unknown = 1, + SRgb, + SRgbLinear, + AdobeRgb, + DisplayP3, + ProPhotoRgb, + Bt2020, + }; + Q_ENUM(ColorSpaceId) + enum class Gamut { + Custom = 0, + SRgb, + AdobeRgb, + DciP3D65, + ProPhotoRgb, + Bt2020, + }; + Q_ENUM(Gamut) + enum class TransferFunction { + Custom = 0, + Linear, + Gamma, + SRgb, + ProPhotoRgb, + Bt2020, + }; + Q_ENUM(TransferFunction) + + QColorSpace(ColorSpaceId colorSpaceId = Undefined); + QColorSpace(Gamut gamut, TransferFunction fun, float gamma = 0.0f); + QColorSpace(Gamut gamut, float gamma); + ~QColorSpace(); + + QColorSpace(QColorSpace &&colorSpace); + QColorSpace(const QColorSpace &colorSpace); + QColorSpace &operator=(QColorSpace &&colorSpace); + QColorSpace &operator=(const QColorSpace &colorSpace); + + ColorSpaceId colorSpaceId() const noexcept; + Gamut gamut() const noexcept; + TransferFunction transferFunction() const noexcept; + float gamma() const noexcept; + + bool isValid() const noexcept; + + friend Q_GUI_EXPORT bool operator==(const QColorSpace &colorSpace1, const QColorSpace &colorSpace2); + friend inline bool operator!=(const QColorSpace &colorSpace1, const QColorSpace &colorSpace2); + + static QColorSpace fromIccProfile(const QByteArray &iccProfile); + QByteArray iccProfile() const; + + QColorTransform transformationToColorSpace(const QColorSpace &colorspace) const; + + QColorSpacePrivate *d_func(); + inline const QColorSpacePrivate *d_func() const { return d_ptr.constData(); } + +private: + friend class QColorSpacePrivate; + QExplicitlySharedDataPointer<QColorSpacePrivate> d_ptr; +}; + +bool Q_GUI_EXPORT operator==(const QColorSpace &colorSpace1, const QColorSpace &colorSpace2); +inline bool operator!=(const QColorSpace &colorSpace1, const QColorSpace &colorSpace2) +{ + return !(colorSpace1 == colorSpace2); +} + +// QColorSpace stream functions +#if !defined(QT_NO_DATASTREAM) +Q_GUI_EXPORT QDataStream &operator<<(QDataStream &, const QColorSpace &); +Q_GUI_EXPORT QDataStream &operator>>(QDataStream &, QColorSpace &); +#endif + +#ifndef QT_NO_DEBUG_STREAM +Q_GUI_EXPORT QDebug operator<<(QDebug, const QColorSpace &); +#endif + +QT_END_NAMESPACE + +#endif // QCOLORSPACE_P_H diff --git a/src/plugins/platforms/mirclient/qmirclientclipboard.h b/src/gui/painting/qcolorspace_p.h index 09e9bcdf38..91107a9a89 100644 --- a/src/plugins/platforms/mirclient/qmirclientclipboard.h +++ b/src/gui/painting/qcolorspace_p.h @@ -1,9 +1,9 @@ /**************************************************************************** ** -** Copyright (C) 2016 Canonical, Ltd. +** Copyright (C) 2018 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the plugins of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage @@ -37,56 +37,60 @@ ** ****************************************************************************/ +#ifndef QCOLORSPACE_P_H +#define QCOLORSPACE_P_H -#ifndef QMIRCLIENTCLIPBOARD_H -#define QMIRCLIENTCLIPBOARD_H +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// -#include <qpa/qplatformclipboard.h> +#include "qcolorspace.h" +#include "qcolormatrix_p.h" +#include "qcolortrc_p.h" +#include "qcolortrclut_p.h" -#include <QMimeData> -#include <QPointer> +#include <QtCore/qshareddata.h> -namespace com { - namespace ubuntu { - namespace content { - class Hub; - } - } -} +QT_BEGIN_NAMESPACE -class QDBusPendingCallWatcher; - -class QMirClientClipboard : public QObject, public QPlatformClipboard +class QColorSpacePrivate : public QSharedData { - Q_OBJECT public: - QMirClientClipboard(); - virtual ~QMirClientClipboard(); - - // QPlatformClipboard methods. - QMimeData* mimeData(QClipboard::Mode mode = QClipboard::Clipboard) override; - void setMimeData(QMimeData* data, QClipboard::Mode mode = QClipboard::Clipboard) override; - bool supportsMode(QClipboard::Mode mode) const override; - bool ownsMode(QClipboard::Mode mode) const override; + QColorSpacePrivate(); + QColorSpacePrivate(QColorSpace::ColorSpaceId colorSpaceId); + QColorSpacePrivate(QColorSpace::Gamut gamut, QColorSpace::TransferFunction fun, float gamma); + QColorSpacePrivate(const QColorSpacePrivate &other) = default; + QColorSpacePrivate &operator=(const QColorSpacePrivate &other) = default; -private Q_SLOTS: - void onApplicationStateChanged(Qt::ApplicationState state); + void initialize(); + void setToXyzMatrix(); + void setTransferFunction(); + bool identifyColorSpace(); + QColorTransform transformationToColorSpace(const QColorSpacePrivate *out) const; -private: - void updateMimeData(); - void requestMimeData(); + QColorSpace::ColorSpaceId id; + QColorSpace::Gamut gamut; + QColorSpace::TransferFunction transferFunction; + float gamma; + QColorVector whitePoint; - QMimeData *mMimeData; + QColorTrc trc[3]; + QColorMatrix toXyz; - enum { - OutdatedClipboard, // Our mimeData is outdated, need to fetch latest from ContentHub - SyncingClipboard, // Our mimeData is outdated and we are waiting for ContentHub to reply with the latest paste - SyncedClipboard // Our mimeData is in sync with what ContentHub has - } mClipboardState{OutdatedClipboard}; + QString description; + QByteArray iccProfile; - com::ubuntu::content::Hub *mContentHub; - - QDBusPendingCallWatcher *mPasteReply{nullptr}; + mutable QSharedPointer<QColorTrcLut> lut[3]; + mutable QAtomicInt lutsGenerated; }; -#endif // QMIRCLIENTCLIPBOARD_H +QT_END_NAMESPACE + +#endif // QCOLORSPACE_P_H diff --git a/src/gui/painting/qcolortransferfunction_p.h b/src/gui/painting/qcolortransferfunction_p.h new file mode 100644 index 0000000000..fd7cfa2b2b --- /dev/null +++ b/src/gui/painting/qcolortransferfunction_p.h @@ -0,0 +1,207 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QCOLORTRANSFERFUNCTION_P_H +#define QCOLORTRANSFERFUNCTION_P_H + +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// + +#include <QtGui/private/qtguiglobal_p.h> + +#include <cmath> + +QT_BEGIN_NAMESPACE + +// Defines a ICC parametric curve type 4 +class Q_GUI_EXPORT QColorTransferFunction +{ +public: + QColorTransferFunction() noexcept + : m_a(1.0f), m_b(0.0f), m_c(1.0f), m_d(0.0f), m_e(0.0f), m_f(0.0f), m_g(1.0f), m_flags(0) + { } + QColorTransferFunction(float a, float b, float c, float d, float e, float f, float g) noexcept + : m_a(a), m_b(b), m_c(c), m_d(d), m_e(e), m_f(f), m_g(g), m_flags(0) + { } + + bool isGamma() const + { + updateHints(); + return m_flags & quint32(Hints::IsGamma); + } + bool isLinear() const + { + updateHints(); + return m_flags & quint32(Hints::IsLinear); + } + bool isSRgb() const + { + updateHints(); + return m_flags & quint32(Hints::IsSRgb); + } + + float apply(float x) const + { + if (x < m_d) + return m_c * x + m_f; + else + return std::pow(m_a * x + m_b, m_g) + m_e; + } + + QColorTransferFunction inverted() const + { + float a, b, c, d, e, f, g; + + d = m_c * m_d + m_f; + + if (!qFuzzyIsNull(m_c)) { + c = 1.0f / m_c; + f = -m_f / m_c; + } else { + c = 0.0f; + f = 0.0f; + } + + if (!qFuzzyIsNull(m_a) && !qFuzzyIsNull(m_g)) { + a = std::pow(1.0f / m_a, m_g); + b = -a * m_e; + e = -m_b / m_a; + g = 1.0f / m_g; + } else { + a = 0.0f; + b = 0.0f; + e = 1.0f; + g = 1.0f; + } + + return QColorTransferFunction(a, b, c, d, e, f, g); + } + + // A few predefined curves: + static QColorTransferFunction fromGamma(float gamma) + { + return QColorTransferFunction(1.0f, 0.0f, 0.0f, 0.0f, 0.0f, 0.0f, gamma); + } + static QColorTransferFunction fromSRgb() + { + return QColorTransferFunction(1.0f / 1.055f, 0.055f / 1.055f, 1.0f / 12.92f, 0.04045f, 0.0f, 0.0f, 2.4f); + } + static QColorTransferFunction fromBt2020() + { + return QColorTransferFunction(1.0f / 1.0993f, 0.0993f / 1.0993f, 1.0f / 4.5f, 0.08145f, 0.0f, 0.0f, 2.2f); + } + static QColorTransferFunction fromProPhotoRgb() + { + return QColorTransferFunction(1.0f, 0.0f, 1.0f / 16.0f, 16.0f / 512.0f, 0.0f, 0.0f, 1.8f); + } + bool matches(const QColorTransferFunction &o) const + { + return paramCompare(m_a, o.m_a) && paramCompare(m_b, o.m_b) + && paramCompare(m_c, o.m_c) && paramCompare(m_d, o.m_d) + && paramCompare(m_e, o.m_e) && paramCompare(m_f, o.m_f) + && paramCompare(m_g, o.m_g); + } + friend inline bool operator==(const QColorTransferFunction &f1, const QColorTransferFunction &f2); + friend inline bool operator!=(const QColorTransferFunction &f1, const QColorTransferFunction &f2); + + float m_a; + float m_b; + float m_c; + float m_d; + float m_e; + float m_f; + float m_g; + +private: + static inline bool paramCompare(float p1, float p2) + { + // Much fuzzier than fuzzy compare. + // It tries match parameters that has been passed through a 8.8 + // fixed point form. + return (qAbs(p1 - p2) <= (1.0f / 512.0f)); + } + + void updateHints() const + { + if (m_flags & quint32(Hints::Calculated)) + return; + // We do not consider the case with m_d = 1.0f linear or simple, + // since it wouldn't be linear for applyExtended(). + bool simple = paramCompare(m_a, 1.0f) && paramCompare(m_b, 0.0f) + && paramCompare(m_d, 0.0f) + && paramCompare(m_e, 0.0f); + if (simple) { + m_flags |= quint32(Hints::IsGamma); + if (qFuzzyCompare(m_g, 1.0f)) + m_flags |= quint32(Hints::IsLinear); + } else { + if (*this == fromSRgb()) + m_flags |= quint32(Hints::IsSRgb); + } + m_flags |= quint32(Hints::Calculated); + } + enum class Hints : quint32 { + Calculated = 1, + IsGamma = 2, + IsLinear = 4, + IsSRgb = 8 + }; + mutable quint32 m_flags; +}; + +inline bool operator==(const QColorTransferFunction &f1, const QColorTransferFunction &f2) +{ + return f1.matches(f2); +} +inline bool operator!=(const QColorTransferFunction &f1, const QColorTransferFunction &f2) +{ + return !f1.matches(f2); +} + +QT_END_NAMESPACE + +#endif // QCOLORTRANSFERFUNCTION_P_H diff --git a/src/gui/painting/qcolortransfertable_p.h b/src/gui/painting/qcolortransfertable_p.h new file mode 100644 index 0000000000..c8b2f7bd92 --- /dev/null +++ b/src/gui/painting/qcolortransfertable_p.h @@ -0,0 +1,245 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QCOLORTRANSFERTABLE_P_H +#define QCOLORTRANSFERTABLE_P_H + +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// + +#include <QtGui/private/qtguiglobal_p.h> +#include "qcolortransferfunction_p.h" + +#include <QVector> +#include <cmath> + +QT_BEGIN_NAMESPACE + +// Defines either an ICC TRC 'curve' or a lut8/lut16 A or B table +class Q_GUI_EXPORT QColorTransferTable +{ +public: + QColorTransferTable() noexcept + : m_tableSize(0) + { } + QColorTransferTable(uint32_t size, const QVector<uint8_t> &table) noexcept + : m_tableSize(size) + , m_table8(table) + { } + QColorTransferTable(uint32_t size, const QVector<uint16_t> &table) noexcept + : m_tableSize(size) + , m_table16(table) + { } + + bool isValid() const + { + if (m_tableSize < 2) + return false; + +#if !defined(QT_NO_DEBUG) + // The table must describe an injective curve: + if (!m_table8.isEmpty()) { + uint8_t val = 0; + for (uint i = 0; i < m_tableSize; ++i) { + Q_ASSERT(m_table8[i] >= val); + val = m_table8[i]; + } + } + if (!m_table16.isEmpty()) { + uint16_t val = 0; + for (uint i = 0; i < m_tableSize; ++i) { + Q_ASSERT(m_table16[i] >= val); + val = m_table16[i]; + } + } +#endif + return !m_table8.isEmpty() || !m_table16.isEmpty(); + } + + float apply(float x) const + { + x = std::min(std::max(x, 0.0f), 1.0f); + x *= m_tableSize - 1; + uint32_t lo = (int)std::floor(x); + uint32_t hi = std::min(lo + 1, m_tableSize); + float frac = x - lo; + if (!m_table16.isEmpty()) + return (m_table16[lo] * (1.0f - frac) + m_table16[hi] * frac) * (1.0f/65535.0f); + if (!m_table8.isEmpty()) + return (m_table8[lo] * (1.0f - frac) + m_table8[hi] * frac) * (1.0f/255.0f); + return x; + } + + // Apply inverse, optimized by giving a previous result a value < x. + float applyInverse(float x, float resultLargerThan = 0.0f) const + { + Q_ASSERT(resultLargerThan >= 0.0f && resultLargerThan <= 1.0f); + if (x <= 0.0f) + return 0.0f; + if (x >= 1.0f) + return 1.0f; + if (!m_table16.isEmpty()) { + float v = x * 65535.0f; + uint i = std::floor(resultLargerThan * (m_tableSize - 1)) + 1; + for ( ; i < m_tableSize; ++i) { + if (m_table16[i] > v) + break; + } + if (i >= m_tableSize - 1) + return 1.0f; + float y1 = m_table16[i - 1]; + float y2 = m_table16[i]; + Q_ASSERT(x >= y1 && x < y2); + float fr = (v - y1) / (y2 - y1); + return (i + fr) * (1.0f / (m_tableSize - 1)); + + } + if (!m_table8.isEmpty()) { + float v = x * 255.0f; + uint i = std::floor(resultLargerThan * (m_tableSize - 1)) + 1; + for ( ; i < m_tableSize; ++i) { + if (m_table8[i] > v) + break; + } + if (i >= m_tableSize - 1) + return 1.0f; + float y1 = m_table8[i - 1]; + float y2 = m_table8[i]; + Q_ASSERT(x >= y1 && x < y2); + float fr = (v - y1) / (y2 - y1); + return (i + fr) * (1.0f / (m_tableSize - 1)); + } + return x; + } + + bool asColorTransferFunction(QColorTransferFunction *transferFn) + { + Q_ASSERT(isValid()); + Q_ASSERT(transferFn); + if (!m_table8.isEmpty() && (m_table8[0] != 0 || m_table8[m_tableSize - 1] != 255)) + return false; + if (!m_table16.isEmpty() && (m_table16[0] != 0 || m_table16[m_tableSize - 1] != 65535)) + return false; + if (m_tableSize == 2) { + *transferFn = QColorTransferFunction(); // Linear + return true; + } + // The following heuristics are based on those from Skia: + if (m_tableSize == 26 && !m_table16.isEmpty()) { + // code.facebook.com/posts/411525055626587/under-the-hood-improving-facebook-photos + if (m_table16[6] != 3062) + return false; + if (m_table16[12] != 12824) + return false; + if (m_table16[18] != 31237) + return false; + *transferFn = QColorTransferFunction::fromSRgb(); + return true; + } + if (m_tableSize == 1024 && !m_table16.isEmpty()) { + // HP and Canon sRGB gamma tables: + if (m_table16[257] != 3366) + return false; + if (m_table16[513] != 14116) + return false; + if (m_table16[768] != 34318) + return false; + *transferFn = QColorTransferFunction::fromSRgb(); + return true; + } + if (m_tableSize == 4096 && !m_table16.isEmpty()) { + // Nikon, Epson, and lcms2 sRGB gamma tables: + if (m_table16[515] != 960) + return false; + if (m_table16[1025] != 3342) + return false; + if (m_table16[2051] != 14079) + return false; + *transferFn = QColorTransferFunction::fromSRgb(); + return true; + } + return false; + } + friend inline bool operator!=(const QColorTransferTable &t1, const QColorTransferTable &t2); + friend inline bool operator==(const QColorTransferTable &t1, const QColorTransferTable &t2); + + uint32_t m_tableSize; + QVector<uint8_t> m_table8; + QVector<uint16_t> m_table16; +}; + +inline bool operator!=(const QColorTransferTable &t1, const QColorTransferTable &t2) +{ + if (t1.m_tableSize != t2.m_tableSize) + return true; + if (t1.m_table8.isEmpty() != t2.m_table8.isEmpty()) + return true; + if (t1.m_table16.isEmpty() != t2.m_table16.isEmpty()) + return true; + if (!t1.m_table8.isEmpty()) { + for (quint32 i = 0; i < t1.m_tableSize; ++i) { + if (t1.m_table8[i] != t2.m_table8[i]) + return true; + } + } + if (!t1.m_table16.isEmpty()) { + for (quint32 i = 0; i < t1.m_tableSize; ++i) { + if (t1.m_table16[i] != t2.m_table16[i]) + return true; + } + } + return false; +} + +inline bool operator==(const QColorTransferTable &t1, const QColorTransferTable &t2) +{ + return !(t1 != t2); +} + +QT_END_NAMESPACE + +#endif // QCOLORTRANSFERTABLE_P_H diff --git a/src/gui/painting/qcolortransform.cpp b/src/gui/painting/qcolortransform.cpp new file mode 100644 index 0000000000..b677c4b36b --- /dev/null +++ b/src/gui/painting/qcolortransform.cpp @@ -0,0 +1,679 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + + +#include "qcolortransform.h" +#include "qcolortransform_p.h" + +#include "qcolormatrix_p.h" +#include "qcolorspace_p.h" +#include "qcolortrc_p.h" +#include "qcolortrclut_p.h" + +#include <QtCore/qatomic.h> +#include <QtCore/qmath.h> +#include <QtGui/qcolor.h> +#include <QtGui/qtransform.h> +#include <QtCore/private/qsimd_p.h> + +#include <qdebug.h> + +QT_BEGIN_NAMESPACE + +QColorTrcLut *lutFromTrc(const QColorTrc &trc) +{ + if (trc.m_type == QColorTrc::Type::Table) + return QColorTrcLut::fromTransferTable(trc.m_table); + if (trc.m_type == QColorTrc::Type::Function) + return QColorTrcLut::fromTransferFunction(trc.m_fun); + qWarning() << "TRC uninitialized"; + return nullptr; +} + +void QColorTransformPrivate::updateLutsIn() const +{ + if (colorSpaceIn->lutsGenerated.loadAcquire()) + return; + for (int i = 0; i < 3; ++i) { + if (!colorSpaceIn->trc[i].isValid()) + return; + } + + if (colorSpaceIn->trc[0] == colorSpaceIn->trc[1] && colorSpaceIn->trc[0] == colorSpaceIn->trc[2]) { + colorSpaceIn->lut[0].reset(lutFromTrc(colorSpaceIn->trc[0])); + colorSpaceIn->lut[1] = colorSpaceIn->lut[0]; + colorSpaceIn->lut[2] = colorSpaceIn->lut[0]; + } else { + for (int i = 0; i < 3; ++i) + colorSpaceIn->lut[i].reset(lutFromTrc(colorSpaceIn->trc[i])); + } + + colorSpaceIn->lutsGenerated.storeRelease(1); +} + +void QColorTransformPrivate::updateLutsOut() const +{ + if (colorSpaceOut->lutsGenerated.loadAcquire()) + return; + for (int i = 0; i < 3; ++i) { + if (!colorSpaceOut->trc[i].isValid()) + return; + } + + if (colorSpaceOut->trc[0] == colorSpaceOut->trc[1] && colorSpaceOut->trc[0] == colorSpaceOut->trc[2]) { + colorSpaceOut->lut[0].reset(lutFromTrc(colorSpaceOut->trc[0])); + colorSpaceOut->lut[1] = colorSpaceOut->lut[0]; + colorSpaceOut->lut[2] = colorSpaceOut->lut[0]; + } else { + for (int i = 0; i < 3; ++i) + colorSpaceOut->lut[i].reset(lutFromTrc(colorSpaceOut->trc[i])); + } + + colorSpaceOut->lutsGenerated.storeRelease(1); +} + +/*! + \class QColorTransform + \brief The QColorTransform class is a transformation between color spaces. + \since 5.14 + + \ingroup painting + \ingroup appearance + \inmodule QtGui + + QColorTransform is an instantiation of a transformation between color spaces. + It can be applied on color and pixels to convert them from one color space to + another. + + Setting up a QColorTransform takes some preprocessing, so keeping around + QColorTransforms that you need often is recommended, instead of generating + them on the fly. +*/ + + +QColorTransform::~QColorTransform() noexcept +{ +} + +/*! + Applies the color transformation on the QRgb value \a argb. + + The input should be opaque or unpremultiplied. +*/ +QRgb QColorTransform::map(const QRgb &argb) const +{ + if (!d_ptr) + return argb; + Q_D(const QColorTransform); + constexpr float f = 1.0f / 255.0f; + QColorVector c = { qRed(argb) * f, qGreen(argb) * f, qBlue(argb) * f }; + c.x = d->colorSpaceIn->trc[0].apply(c.x); + c.y = d->colorSpaceIn->trc[1].apply(c.y); + c.z = d->colorSpaceIn->trc[2].apply(c.z); + c = d->colorMatrix.map(c); + c.x = std::max(0.0f, std::min(1.0f, c.x)); + c.y = std::max(0.0f, std::min(1.0f, c.y)); + c.z = std::max(0.0f, std::min(1.0f, c.z)); + if (d->colorSpaceOut->lutsGenerated.loadAcquire()) { + c.x = d->colorSpaceOut->lut[0]->fromLinear(c.x); + c.y = d->colorSpaceOut->lut[1]->fromLinear(c.y); + c.z = d->colorSpaceOut->lut[2]->fromLinear(c.z); + } else { + c.x = d->colorSpaceOut->trc[0].applyInverse(c.x); + c.y = d->colorSpaceOut->trc[1].applyInverse(c.y); + c.z = d->colorSpaceOut->trc[2].applyInverse(c.z); + } + + return qRgba(c.x * 255 + 0.5f, c.y * 255 + 0.5f, c.z * 255 + 0.5f, qAlpha(argb)); +} + +/*! + Applies the color transformation on the QRgba64 value \a rgba64. + + The input should be opaque or unpremultiplied. +*/ +QRgba64 QColorTransform::map(const QRgba64 &rgba64) const +{ + if (!d_ptr) + return rgba64; + Q_D(const QColorTransform); + constexpr float f = 1.0f / 65535.0f; + QColorVector c = { rgba64.red() * f, rgba64.green() * f, rgba64.blue() * f }; + c.x = d->colorSpaceIn->trc[0].apply(c.x); + c.y = d->colorSpaceIn->trc[1].apply(c.y); + c.z = d->colorSpaceIn->trc[2].apply(c.z); + c = d->colorMatrix.map(c); + c.x = std::max(0.0f, std::min(1.0f, c.x)); + c.y = std::max(0.0f, std::min(1.0f, c.y)); + c.z = std::max(0.0f, std::min(1.0f, c.z)); + if (d->colorSpaceOut->lutsGenerated.loadAcquire()) { + c.x = d->colorSpaceOut->lut[0]->fromLinear(c.x); + c.y = d->colorSpaceOut->lut[1]->fromLinear(c.y); + c.z = d->colorSpaceOut->lut[2]->fromLinear(c.z); + } else { + c.x = d->colorSpaceOut->trc[0].applyInverse(c.x); + c.y = d->colorSpaceOut->trc[1].applyInverse(c.y); + c.z = d->colorSpaceOut->trc[2].applyInverse(c.z); + } + + return QRgba64::fromRgba64(c.x * 65535, c.y * 65535, c.z * 65535, rgba64.alpha()); +} + +/*! + Applies the color transformation on the QColor value \a color. + +*/ +QColor QColorTransform::map(const QColor &color) const +{ + if (!d_ptr) + return color; + Q_D(const QColorTransform); + QColorVector c = { (float)color.redF(), (float)color.greenF(), (float)color.blueF() }; + c.x = d->colorSpaceIn->trc[0].apply(c.x); + c.y = d->colorSpaceIn->trc[1].apply(c.y); + c.z = d->colorSpaceIn->trc[2].apply(c.z); + c = d->colorMatrix.map(c); + if (d_ptr->colorSpaceOut->lutsGenerated.loadAcquire()) { + c.x = d->colorSpaceOut->lut[0]->fromLinear(c.x); + c.y = d->colorSpaceOut->lut[1]->fromLinear(c.y); + c.z = d->colorSpaceOut->lut[2]->fromLinear(c.z); + } else { + c.x = d->colorSpaceOut->trc[0].applyInverse(c.x); + c.y = d->colorSpaceOut->trc[1].applyInverse(c.y); + c.z = d->colorSpaceOut->trc[2].applyInverse(c.z); + } + QColor out; + out.setRgbF(c.x, c.y, c.z, color.alphaF()); + return out; +} + +// Optimized sub-routines for fast block based conversion: + +static void applyMatrix(QColorVector *buffer, const qsizetype len, const QColorMatrix &colorMatrix) +{ +#if defined(__SSE2__) + const __m128 minV = _mm_set1_ps(0.0f); + const __m128 maxV = _mm_set1_ps(1.0f); + const __m128 xMat = _mm_loadu_ps(&colorMatrix.r.x); + const __m128 yMat = _mm_loadu_ps(&colorMatrix.g.x); + const __m128 zMat = _mm_loadu_ps(&colorMatrix.b.x); + for (qsizetype j = 0; j < len; ++j) { + __m128 c = _mm_loadu_ps(&buffer[j].x); + __m128 cx = _mm_shuffle_ps(c, c, _MM_SHUFFLE(0, 0, 0, 0)); + __m128 cy = _mm_shuffle_ps(c, c, _MM_SHUFFLE(1, 1, 1, 1)); + __m128 cz = _mm_shuffle_ps(c, c, _MM_SHUFFLE(2, 2, 2, 2)); + cx = _mm_mul_ps(cx, xMat); + cy = _mm_mul_ps(cy, yMat); + cz = _mm_mul_ps(cz, zMat); + cx = _mm_add_ps(cx, cy); + cx = _mm_add_ps(cx, cz); + // Clamp: + cx = _mm_min_ps(cx, maxV); + cx = _mm_max_ps(cx, minV); + _mm_storeu_ps(&buffer[j].x, cx); + } +#else + for (int j = 0; j < len; ++j) { + const QColorVector cv = colorMatrix.map(buffer[j]); + buffer[j].x = std::max(0.0f, std::min(1.0f, cv.x)); + buffer[j].y = std::max(0.0f, std::min(1.0f, cv.y)); + buffer[j].z = std::max(0.0f, std::min(1.0f, cv.z)); + } +#endif +} + +template<typename T> +static void loadPremultiplied(QColorVector *buffer, const T *src, const qsizetype len, const QColorTransformPrivate *d_ptr); +template<typename T> +static void loadUnpremultiplied(QColorVector *buffer, const T *src, const qsizetype len, const QColorTransformPrivate *d_ptr); + +#if defined(__SSE2__) +// Load to [0-alpha] in 4x32 SIMD +template<typename T> +static inline void loadP(const T &p, __m128i &v); + +template<> +inline void loadP<QRgb>(const QRgb &p, __m128i &v) +{ + v = _mm_cvtsi32_si128(p); +#if defined(__SSE4_1__) + v = _mm_cvtepu8_epi32(v); +#else + v = _mm_unpacklo_epi8(v, _mm_setzero_si128()); + v = _mm_unpacklo_epi16(v, _mm_setzero_si128()); +#endif +} + +template<> +inline void loadP<QRgba64>(const QRgba64 &p, __m128i &v) +{ + v = _mm_loadl_epi64((const __m128i *)&p); +#if defined(__SSE4_1__) + v = _mm_cvtepu16_epi32(v); +#else + v = _mm_unpacklo_epi16(v, _mm_setzero_si128()); +#endif + // Shuffle to ARGB as the template below expects it + v = _mm_shuffle_epi32(v, _MM_SHUFFLE(3, 0, 1, 2)); +} + +template<typename T> +static void loadPremultiplied(QColorVector *buffer, const T *src, const qsizetype len, const QColorTransformPrivate *d_ptr) +{ + const __m128 v4080 = _mm_set1_ps(4080.f); + const __m128 iFF00 = _mm_set1_ps(1.0f / (255 * 256)); + for (qsizetype i = 0; i < len; ++i) { + __m128i v; + loadP<T>(src[i], v); + __m128 vf = _mm_cvtepi32_ps(v); + // Approximate 1/a: + __m128 va = _mm_shuffle_ps(vf, vf, _MM_SHUFFLE(3, 3, 3, 3)); + __m128 via = _mm_rcp_ps(va); + via = _mm_sub_ps(_mm_add_ps(via, via), _mm_mul_ps(via, _mm_mul_ps(via, va))); + // v * (1/a) + vf = _mm_mul_ps(vf, via); + + // Handle zero alpha + __m128 vAlphaMask = _mm_cmpeq_ps(va, _mm_set1_ps(0.0f)); + vf = _mm_andnot_ps(vAlphaMask, vf); + + // LUT + v = _mm_cvtps_epi32(_mm_mul_ps(vf, v4080)); + const int ridx = _mm_extract_epi16(v, 4); + const int gidx = _mm_extract_epi16(v, 2); + const int bidx = _mm_extract_epi16(v, 0); + v = _mm_insert_epi16(v, d_ptr->colorSpaceIn->lut[0]->m_toLinear[ridx], 0); + v = _mm_insert_epi16(v, d_ptr->colorSpaceIn->lut[1]->m_toLinear[gidx], 2); + v = _mm_insert_epi16(v, d_ptr->colorSpaceIn->lut[2]->m_toLinear[bidx], 4); + vf = _mm_mul_ps(_mm_cvtepi32_ps(v), iFF00); + + _mm_storeu_ps(&buffer[i].x, vf); + } +} + +// Load to [0-4080] in 4x32 SIMD +template<typename T> +static inline void loadPU(const T &p, __m128i &v); + +template<> +inline void loadPU<QRgb>(const QRgb &p, __m128i &v) +{ + v = _mm_cvtsi32_si128(p); +#if defined(__SSE4_1__) + v = _mm_cvtepu8_epi32(v); +#else + v = _mm_unpacklo_epi8(v, _mm_setzero_si128()); + v = _mm_unpacklo_epi16(v, _mm_setzero_si128()); +#endif + v = _mm_slli_epi32(v, 4); +} + +template<> +inline void loadPU<QRgba64>(const QRgba64 &p, __m128i &v) +{ + v = _mm_loadl_epi64((const __m128i *)&p); + v = _mm_sub_epi16(v, _mm_srli_epi16(v, 8)); +#if defined(__SSE4_1__) + v = _mm_cvtepu16_epi32(v); +#else + v = _mm_unpacklo_epi16(v, _mm_setzero_si128()); +#endif + v = _mm_srli_epi32(v, 4); + // Shuffle to ARGB as the template below expects it + v = _mm_shuffle_epi32(v, _MM_SHUFFLE(3, 0, 1, 2)); +} + +template<typename T> +void loadUnpremultiplied(QColorVector *buffer, const T *src, const qsizetype len, const QColorTransformPrivate *d_ptr) +{ + const __m128 iFF00 = _mm_set1_ps(1.0f / (255 * 256)); + for (qsizetype i = 0; i < len; ++i) { + __m128i v; + loadPU<T>(src[i], v); + const int ridx = _mm_extract_epi16(v, 4); + const int gidx = _mm_extract_epi16(v, 2); + const int bidx = _mm_extract_epi16(v, 0); + v = _mm_insert_epi16(v, d_ptr->colorSpaceIn->lut[0]->m_toLinear[ridx], 0); + v = _mm_insert_epi16(v, d_ptr->colorSpaceIn->lut[1]->m_toLinear[gidx], 2); + v = _mm_insert_epi16(v, d_ptr->colorSpaceIn->lut[2]->m_toLinear[bidx], 4); + __m128 vf = _mm_mul_ps(_mm_cvtepi32_ps(v), iFF00); + _mm_storeu_ps(&buffer[i].x, vf); + } +} + +#else +template<> +void loadPremultiplied<QRgb>(QColorVector *buffer, const QRgb *src, const qsizetype len, const QColorTransformPrivate *d_ptr) +{ + for (qsizetype i = 0; i < len; ++i) { + const uint p = src[i]; + const int a = qAlpha(p); + if (a) { + const float ia = 4080.0f / a; + const int ridx = int(qRed(p) * ia + 0.5f); + const int gidx = int(qGreen(p) * ia + 0.5f); + const int bidx = int(qBlue(p) * ia + 0.5f); + buffer[i].x = d_ptr->colorSpaceIn->lut[0]->m_toLinear[ridx] * (1.0f / (255 * 256)); + buffer[i].y = d_ptr->colorSpaceIn->lut[1]->m_toLinear[gidx] * (1.0f / (255 * 256)); + buffer[i].z = d_ptr->colorSpaceIn->lut[2]->m_toLinear[bidx] * (1.0f / (255 * 256)); + } else { + buffer[i].x = buffer[i].y = buffer[i].z = 0.0f; + } + } +} + +template<> +void loadPremultiplied<QRgba64>(QColorVector *buffer, const QRgba64 *src, const qsizetype len, const QColorTransformPrivate *d_ptr) +{ + for (qsizetype i = 0; i < len; ++i) { + const QRgba64 &p = src[i]; + const int a = p.alpha(); + if (a) { + const float ia = 4080.0f / a; + const int ridx = int(p.red() * ia + 0.5f); + const int gidx = int(p.green() * ia + 0.5f); + const int bidx = int(p.blue() * ia + 0.5f); + buffer[i].x = d_ptr->colorSpaceIn->lut[0]->m_toLinear[ridx] * (1.0f / (255 * 256)); + buffer[i].y = d_ptr->colorSpaceIn->lut[1]->m_toLinear[gidx] * (1.0f / (255 * 256)); + buffer[i].z = d_ptr->colorSpaceIn->lut[2]->m_toLinear[bidx] * (1.0f / (255 * 256)); + } else { + buffer[i].x = buffer[i].y = buffer[i].z = 0.0f; + } + } +} + +template<> +void loadUnpremultiplied<QRgb>(QColorVector *buffer, const QRgb *src, const qsizetype len, const QColorTransformPrivate *d_ptr) +{ + for (qsizetype i = 0; i < len; ++i) { + const uint p = src[i]; + buffer[i].x = d_ptr->colorSpaceIn->lut[0]->u8ToLinearF32(qRed(p)); + buffer[i].y = d_ptr->colorSpaceIn->lut[1]->u8ToLinearF32(qGreen(p)); + buffer[i].z = d_ptr->colorSpaceIn->lut[2]->u8ToLinearF32(qBlue(p)); + } +} + +template<> +void loadUnpremultiplied<QRgba64>(QColorVector *buffer, const QRgba64 *src, const qsizetype len, const QColorTransformPrivate *d_ptr) +{ + for (qsizetype i = 0; i < len; ++i) { + const QRgba64 &p = src[i]; + buffer[i].x = d_ptr->colorSpaceIn->lut[0]->u16ToLinearF32(p.red()); + buffer[i].y = d_ptr->colorSpaceIn->lut[1]->u16ToLinearF32(p.green()); + buffer[i].z = d_ptr->colorSpaceIn->lut[2]->u16ToLinearF32(p.blue()); + } +} +#endif + +static void storePremultiplied(QRgb *dst, const QRgb *src, const QColorVector *buffer, const qsizetype len, + const QColorTransformPrivate *d_ptr) +{ +#if defined(__SSE2__) + const __m128 v4080 = _mm_set1_ps(4080.f); + const __m128 iFF00 = _mm_set1_ps(1.0f / (255 * 256)); + for (qsizetype i = 0; i < len; ++i) { + const int a = qAlpha(src[i]); + __m128 vf = _mm_loadu_ps(&buffer[i].x); + __m128i v = _mm_cvtps_epi32(_mm_mul_ps(vf, v4080)); + __m128 va = _mm_set1_ps(a); + va = _mm_mul_ps(va, iFF00); + const int ridx = _mm_extract_epi16(v, 0); + const int gidx = _mm_extract_epi16(v, 2); + const int bidx = _mm_extract_epi16(v, 4); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[0]->m_fromLinear[ridx], 4); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[1]->m_fromLinear[gidx], 2); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[2]->m_fromLinear[bidx], 0); + vf = _mm_cvtepi32_ps(v); + vf = _mm_mul_ps(vf, va); + v = _mm_cvtps_epi32(vf); + v = _mm_packs_epi32(v, v); + v = _mm_insert_epi16(v, a, 3); + v = _mm_packus_epi16(v, v); + dst[i] = _mm_cvtsi128_si32(v); + } +#else + for (qsizetype i = 0; i < len; ++i) { + const int a = qAlpha(src[i]); + const float fa = a / (255.0f * 256.0f); + const float r = d_ptr->colorSpaceOut->lut[0]->m_fromLinear[int(buffer[i].x * 4080.0f + 0.5f)]; + const float g = d_ptr->colorSpaceOut->lut[1]->m_fromLinear[int(buffer[i].y * 4080.0f + 0.5f)]; + const float b = d_ptr->colorSpaceOut->lut[2]->m_fromLinear[int(buffer[i].z * 4080.0f + 0.5f)]; + dst[i] = qRgba(r * fa + 0.5f, g * fa + 0.5f, b * fa + 0.5f, a); + } +#endif +} + +static void storeUnpremultiplied(QRgb *dst, const QRgb *src, const QColorVector *buffer, const qsizetype len, + const QColorTransformPrivate *d_ptr) +{ +#if defined(__SSE2__) + const __m128 v4080 = _mm_set1_ps(4080.f); + for (qsizetype i = 0; i < len; ++i) { + const int a = qAlpha(src[i]); + __m128 vf = _mm_loadu_ps(&buffer[i].x); + __m128i v = _mm_cvtps_epi32(_mm_mul_ps(vf, v4080)); + const int ridx = _mm_extract_epi16(v, 0); + const int gidx = _mm_extract_epi16(v, 2); + const int bidx = _mm_extract_epi16(v, 4); + v = _mm_setzero_si128(); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[0]->m_fromLinear[ridx], 2); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[1]->m_fromLinear[gidx], 1); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[2]->m_fromLinear[bidx], 0); + v = _mm_add_epi16(v, _mm_set1_epi16(0x80)); + v = _mm_srli_epi16(v, 8); + v = _mm_insert_epi16(v, a, 3); + v = _mm_packus_epi16(v, v); + dst[i] = _mm_cvtsi128_si32(v); + } +#else + for (qsizetype i = 0; i < len; ++i) { + const int r = d_ptr->colorSpaceOut->lut[0]->u8FromLinearF32(buffer[i].x); + const int g = d_ptr->colorSpaceOut->lut[1]->u8FromLinearF32(buffer[i].y); + const int b = d_ptr->colorSpaceOut->lut[2]->u8FromLinearF32(buffer[i].z); + dst[i] = (src[i] & 0xff000000) | (r << 16) | (g << 8) | (b << 0); + } +#endif +} + +static void storeOpaque(QRgb *dst, const QRgb *src, const QColorVector *buffer, const qsizetype len, + const QColorTransformPrivate *d_ptr) +{ + Q_UNUSED(src); +#if defined(__SSE2__) + const __m128 v4080 = _mm_set1_ps(4080.f); + for (qsizetype i = 0; i < len; ++i) { + __m128 vf = _mm_loadu_ps(&buffer[i].x); + __m128i v = _mm_cvtps_epi32(_mm_mul_ps(vf, v4080)); + const int ridx = _mm_extract_epi16(v, 0); + const int gidx = _mm_extract_epi16(v, 2); + const int bidx = _mm_extract_epi16(v, 4); + v = _mm_setzero_si128(); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[0]->m_fromLinear[ridx], 2); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[1]->m_fromLinear[gidx], 1); + v = _mm_insert_epi16(v, d_ptr->colorSpaceOut->lut[2]->m_fromLinear[bidx], 0); + v = _mm_add_epi16(v, _mm_set1_epi16(0x80)); + v = _mm_srli_epi16(v, 8); + v = _mm_insert_epi16(v, 255, 3); + v = _mm_packus_epi16(v, v); + dst[i] = _mm_cvtsi128_si32(v); + } +#else + for (qsizetype i = 0; i < len; ++i) { + const int r = d_ptr->colorSpaceOut->lut[0]->u8FromLinearF32(buffer[i].x); + const int g = d_ptr->colorSpaceOut->lut[1]->u8FromLinearF32(buffer[i].y); + const int b = d_ptr->colorSpaceOut->lut[2]->u8FromLinearF32(buffer[i].z); + dst[i] = 0xff000000 | (r << 16) | (g << 8) | (b << 0); + } +#endif +} + +static void storePremultiplied(QRgba64 *dst, const QRgba64 *src, const QColorVector *buffer, const qsizetype len, + const QColorTransformPrivate *d_ptr) +{ + for (qsizetype i = 0; i < len; ++i) { + const int a = src[i].alpha(); + const float fa = a / (255.0f * 256.0f); + const float r = d_ptr->colorSpaceOut->lut[0]->m_fromLinear[int(buffer[i].x * 4080.0f + 0.5f)]; + const float g = d_ptr->colorSpaceOut->lut[1]->m_fromLinear[int(buffer[i].y * 4080.0f + 0.5f)]; + const float b = d_ptr->colorSpaceOut->lut[2]->m_fromLinear[int(buffer[i].z * 4080.0f + 0.5f)]; + dst[i] = qRgba64(r * fa + 0.5f, g * fa + 0.5f, b * fa + 0.5f, a); + } +} + +static void storeUnpremultiplied(QRgba64 *dst, const QRgba64 *src, const QColorVector *buffer, const qsizetype len, + const QColorTransformPrivate *d_ptr) +{ + for (qsizetype i = 0; i < len; ++i) { + const int r = d_ptr->colorSpaceOut->lut[0]->u16FromLinearF32(buffer[i].x); + const int g = d_ptr->colorSpaceOut->lut[1]->u16FromLinearF32(buffer[i].y); + const int b = d_ptr->colorSpaceOut->lut[2]->u16FromLinearF32(buffer[i].z); + dst[i] = qRgba64(r, g, b, src[i].alpha()); + } +} + +static void storeOpaque(QRgba64 *dst, const QRgba64 *src, const QColorVector *buffer, const qsizetype len, + const QColorTransformPrivate *d_ptr) +{ + Q_UNUSED(src); + for (qsizetype i = 0; i < len; ++i) { + const int r = d_ptr->colorSpaceOut->lut[0]->u16FromLinearF32(buffer[i].x); + const int g = d_ptr->colorSpaceOut->lut[1]->u16FromLinearF32(buffer[i].y); + const int b = d_ptr->colorSpaceOut->lut[2]->u16FromLinearF32(buffer[i].z); + dst[i] = qRgba64(r, g, b, 0xFFFF); + } +} + +static constexpr qsizetype WorkBlockSize = 256; + +template<typename T> +void QColorTransformPrivate::apply(T *dst, const T *src, qsizetype count, TransformFlags flags) const +{ + if (!colorMatrix.isValid()) + return; + + updateLutsIn(); + updateLutsOut(); + + bool doApplyMatrix = (colorMatrix != QColorMatrix::identity()); + + QColorVector buffer[WorkBlockSize]; + qsizetype i = 0; + while (i < count) { + const qsizetype len = qMin(count - i, WorkBlockSize); + if (flags & InputPremultiplied) + loadPremultiplied(buffer, src + i, len, this); + else + loadUnpremultiplied(buffer, src + i, len, this); + + if (doApplyMatrix) + applyMatrix(buffer, len, colorMatrix); + + if (flags & InputOpaque) + storeOpaque(dst + i, src + i, buffer, len, this); + else if (flags & OutputPremultiplied) + storePremultiplied(dst + i, src + i, buffer, len, this); + else + storeUnpremultiplied(dst + i, src + i, buffer, len, this); + + i += len; + } +} + +/*! + \internal + \enum QColorTransformPrivate::TransformFlag + + Defines how the transform is to be applied. + + \value Unpremultiplied The input and output should both be unpremultiplied. + \value InputOpaque The input is guaranteed to be opaque. + \value InputPremultiplied The input is premultiplied. + \value OutputPremultiplied The output should be premultiplied. + \value Premultiplied Both input and output should both be premultiplied. +*/ + +/*! + \internal + Prepares a color transformation for fast application. You do not need to + call this explicitly as it will be called implicitly on the first transforms, but + if you want predictable performance on the first transforms, you can perform it + in advance. + + \sa QColorTransform::map(), apply() +*/ +void QColorTransformPrivate::prepare() +{ + updateLutsIn(); + updateLutsOut(); +} + +/*! + \internal + Applies the color transformation on \a count QRgb pixels starting from + \a src and stores the result in \a dst. + + Thread-safe if prepare() has been called first. + + Assumes unpremultiplied data by default. Set \a flags to change defaults. + + \sa prepare() +*/ +void QColorTransformPrivate::apply(QRgb *dst, const QRgb *src, qsizetype count, TransformFlags flags) const +{ + apply<QRgb>(dst, src, count, flags); +} + +/*! + \internal + Applies the color transformation on \a count QRgba64 pixels starting from + \a src and stores the result in \a dst. + + Thread-safe if prepare() has been called first. + + Assumes unpremultiplied data by default. Set \a flags to change defaults. + + \sa prepare() +*/ +void QColorTransformPrivate::apply(QRgba64 *dst, const QRgba64 *src, qsizetype count, TransformFlags flags) const +{ + apply<QRgba64>(dst, src, count, flags); +} + + +QT_END_NAMESPACE diff --git a/src/plugins/platforms/mirclient/qmirclientscreenobserver.h b/src/gui/painting/qcolortransform.h index ad927319c1..9274387b97 100644 --- a/src/plugins/platforms/mirclient/qmirclientscreenobserver.h +++ b/src/gui/painting/qcolortransform.h @@ -1,9 +1,9 @@ /**************************************************************************** ** -** Copyright (C) 2016 Canonical, Ltd. +** Copyright (C) 2018 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the plugins of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage @@ -37,42 +37,57 @@ ** ****************************************************************************/ +#ifndef QCOLORTRANSFORM_H +#define QCOLORTRANSFORM_H -#ifndef QMIRCLIENTSCREENOBSERVER_H -#define QMIRCLIENTSCREENOBSERVER_H +#include <QtGui/qtguiglobal.h> +#include <QtCore/qsharedpointer.h> +#include <QtGui/qrgb.h> -#include <QObject> +QT_BEGIN_NAMESPACE -#include <mir_toolkit/mir_connection.h> +class QColor; +class QRgba64; +class QColorSpacePrivate; +class QColorTransformPrivate; -class QMirClientScreen; - -class QMirClientScreenObserver : public QObject +class Q_GUI_EXPORT QColorTransform { - Q_OBJECT - public: - QMirClientScreenObserver(MirConnection *connection); - - QList<QMirClientScreen*> screens() const { return mScreenList; } - QMirClientScreen *findScreenWithId(int id); + QColorTransform() noexcept : d_ptr(nullptr) { } + ~QColorTransform() noexcept; + QColorTransform(const QColorTransform &colorTransform) noexcept + : d_ptr(colorTransform.d_ptr) + { } + QColorTransform(QColorTransform &&colorTransform) noexcept + : d_ptr(std::move(colorTransform.d_ptr)) + { } + QColorTransform &operator=(const QColorTransform &other) noexcept + { + d_ptr = other.d_ptr; + return *this; + } + QColorTransform &operator=(QColorTransform &&other) noexcept + { + d_ptr = std::move(other.d_ptr); + return *this; + } - void handleScreenPropertiesChange(QMirClientScreen *screen, int dpi, - MirFormFactor formFactor, float scale); + bool isNull() const { return d_ptr.isNull(); } -Q_SIGNALS: - void screenAdded(QMirClientScreen *screen); - void screenRemoved(QMirClientScreen *screen); - -private Q_SLOTS: - void update(); + QRgb map(const QRgb &argb) const; + QRgba64 map(const QRgba64 &rgba64) const; + QColor map(const QColor &color) const; private: - QMirClientScreen *findScreenWithId(const QList<QMirClientScreen *> &list, int id); - void removeScreen(QMirClientScreen *screen); + friend class QColorSpace; + friend class QColorSpacePrivate; + friend class QImage; - MirConnection *mMirConnection; - QList<QMirClientScreen*> mScreenList; + Q_DECLARE_PRIVATE(QColorTransform) + QSharedPointer<QColorTransformPrivate> d_ptr; }; -#endif // QMIRCLIENTSCREENOBSERVER_H +QT_END_NAMESPACE + +#endif // QCOLORTRANSFORM_H diff --git a/src/corelib/global/qfloat16_p.h b/src/gui/painting/qcolortransform_p.h index f3fc96e119..74a1e7fe0a 100644 --- a/src/corelib/global/qfloat16_p.h +++ b/src/gui/painting/qcolortransform_p.h @@ -1,9 +1,9 @@ /**************************************************************************** ** -** Copyright (C) 2016 by Southwest Research Institute (R) -** Contact: http://www.qt-project.org/legal +** Copyright (C) 2019 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ ** -** This file is part of the QtCore module of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage @@ -37,8 +37,8 @@ ** ****************************************************************************/ -#ifndef QFLOAT16_P_H -#define QFLOAT16_P_H +#ifndef QCOLORTRANSFORM_P_H +#define QCOLORTRANSFORM_P_H // // W A R N I N G @@ -51,45 +51,39 @@ // We mean it. // -#include <QtCore/qfloat16.h> -#include <QtCore/qsysinfo.h> +#include "qcolormatrix_p.h" +#include "qcolorspace_p.h" QT_BEGIN_NAMESPACE -static inline bool qt_is_inf(qfloat16 d) Q_DECL_NOTHROW +class QColorTransformPrivate { - bool is_inf; - uchar *ch = (uchar *)&d; - if (QSysInfo::ByteOrder == QSysInfo::BigEndian) - is_inf = (ch[0] & 0x7c) == 0x7c && (ch[0] & 0x02) == 0; - else - is_inf = (ch[1] & 0x7c) == 0x7c && (ch[1] & 0x02) == 0; - return is_inf; -} +public: + QColorMatrix colorMatrix; + QExplicitlySharedDataPointer<const QColorSpacePrivate> colorSpaceIn; + QExplicitlySharedDataPointer<const QColorSpacePrivate> colorSpaceOut; -static inline bool qt_is_nan(qfloat16 d) Q_DECL_NOTHROW -{ - bool is_nan; - uchar *ch = (uchar *)&d; - if (QSysInfo::ByteOrder == QSysInfo::BigEndian) - is_nan = (ch[0] & 0x7c) == 0x7c && (ch[0] & 0x02) != 0; - else - is_nan = (ch[1] & 0x7c) == 0x7c && (ch[1] & 0x02) != 0; - return is_nan; -} + void updateLutsIn() const; + void updateLutsOut() const; + bool simpleGammaCorrection() const; -static inline bool qt_is_finite(qfloat16 d) Q_DECL_NOTHROW -{ - bool is_finite; - uchar *ch = (uchar *)&d; - if (QSysInfo::ByteOrder == QSysInfo::BigEndian) - is_finite = (ch[0] & 0x7c) != 0x7c; - else - is_finite = (ch[1] & 0x7c) != 0x7c; - return is_finite; -} + void prepare(); + enum TransformFlag { + Unpremultiplied = 0, + InputOpaque = 1, + InputPremultiplied = 2, + OutputPremultiplied = 4, + Premultiplied = (InputPremultiplied | OutputPremultiplied) + }; + Q_DECLARE_FLAGS(TransformFlags, TransformFlag) + + void apply(QRgb *dst, const QRgb *src, qsizetype count, TransformFlags flags = Unpremultiplied) const; + void apply(QRgba64 *dst, const QRgba64 *src, qsizetype count, TransformFlags flags = Unpremultiplied) const; + template<typename T> + void apply(T *dst, const T *src, qsizetype count, TransformFlags flags) const; +}; QT_END_NAMESPACE -#endif // QFLOAT16_P_H +#endif // QCOLORTRANSFORM_P_H diff --git a/src/gui/painting/qcolortrc_p.h b/src/gui/painting/qcolortrc_p.h new file mode 100644 index 0000000000..3a649f3756 --- /dev/null +++ b/src/gui/painting/qcolortrc_p.h @@ -0,0 +1,129 @@ +/**************************************************************************** +** +** Copyright (C) 2018 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#ifndef QCOLORTRC_P_H +#define QCOLORTRC_P_H + +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// + +#include <QtGui/private/qtguiglobal_p.h> +#include "qcolortransferfunction_p.h" +#include "qcolortransfertable_p.h" + +QT_BEGIN_NAMESPACE + + +// Defines an ICC TRC (Tone Reproduction Curve) +class Q_GUI_EXPORT QColorTrc +{ +public: + QColorTrc() noexcept : m_type(Type::Uninitialized) + { } + QColorTrc(const QColorTransferFunction &fun) : m_type(Type::Function), m_fun(fun) + { } + QColorTrc(const QColorTransferTable &table) : m_type(Type::Table), m_table(table) + { } + + enum class Type { + Uninitialized, + Function, + Table + }; + + bool isLinear() const + { + return m_type == Type::Uninitialized || (m_type == Type::Function && m_fun.isLinear()); + } + bool isValid() const + { + return m_type != Type::Uninitialized; + } + float apply(float x) const + { + if (m_type == Type::Table) + return m_table.apply(x); + if (m_type == Type::Function) + return m_fun.apply(x); + return x; + } + + float applyInverse(float x) const + { + if (m_type == Type::Table) + return m_table.applyInverse(x); + if (m_type == Type::Function) + return m_fun.inverted().apply(x); + return x; + } + + friend inline bool operator!=(const QColorTrc &o1, const QColorTrc &o2); + friend inline bool operator==(const QColorTrc &o1, const QColorTrc &o2); + + Type m_type; + QColorTransferFunction m_fun; + QColorTransferTable m_table; +}; + +inline bool operator!=(const QColorTrc &o1, const QColorTrc &o2) +{ + if (o1.m_type != o2.m_type) + return true; + if (o1.m_type == QColorTrc::Type::Function) + return o1.m_fun != o2.m_fun; + if (o1.m_type == QColorTrc::Type::Table) + return o1.m_table != o2.m_table; + return false; +} +inline bool operator==(const QColorTrc &o1, const QColorTrc &o2) +{ + return !(o1 != o2); +} + +QT_END_NAMESPACE + +#endif // QCOLORTRC diff --git a/src/gui/painting/qcolorprofile.cpp b/src/gui/painting/qcolortrclut.cpp index 3b7b0a248b..268d7252b4 100644 --- a/src/gui/painting/qcolorprofile.cpp +++ b/src/gui/painting/qcolortrclut.cpp @@ -37,14 +37,16 @@ ** ****************************************************************************/ -#include "qcolorprofile_p.h" +#include "qcolortrclut_p.h" +#include "qcolortransferfunction_p.h" +#include "qcolortransfertable_p.h" #include <qmath.h> QT_BEGIN_NAMESPACE -QColorProfile *QColorProfile::fromGamma(qreal gamma) +QColorTrcLut *QColorTrcLut::fromGamma(qreal gamma) { - QColorProfile *cp = new QColorProfile; + QColorTrcLut *cp = new QColorTrcLut; for (int i = 0; i <= (255 * 16); ++i) { cp->m_toLinear[i] = ushort(qRound(qPow(i / qreal(255 * 16), gamma) * (255 * 256))); @@ -54,31 +56,28 @@ QColorProfile *QColorProfile::fromGamma(qreal gamma) return cp; } -static qreal srgbToLinear(qreal v) +QColorTrcLut *QColorTrcLut::fromTransferFunction(const QColorTransferFunction &fun) { - const qreal a = 0.055; - if (v <= qreal(0.04045)) - return v / qreal(12.92); - else - return qPow((v + a) / (qreal(1) + a), qreal(2.4)); -} + QColorTrcLut *cp = new QColorTrcLut; + QColorTransferFunction inv = fun.inverted(); -static qreal linearToSrgb(qreal v) -{ - const qreal a = 0.055; - if (v <= qreal(0.0031308)) - return v * qreal(12.92); - else - return (qreal(1) + a) * qPow(v, qreal(1.0 / 2.4)) - a; + for (int i = 0; i <= (255 * 16); ++i) { + cp->m_toLinear[i] = ushort(qRound(fun.apply(i / qreal(255 * 16)) * (255 * 256))); + cp->m_fromLinear[i] = ushort(qRound(inv.apply(i / qreal(255 * 16)) * (255 * 256))); + } + + return cp; } -QColorProfile *QColorProfile::fromSRgb() +QColorTrcLut *QColorTrcLut::fromTransferTable(const QColorTransferTable &table) { - QColorProfile *cp = new QColorProfile; + QColorTrcLut *cp = new QColorTrcLut; + float minInverse = 0.0f; for (int i = 0; i <= (255 * 16); ++i) { - cp->m_toLinear[i] = ushort(qRound(srgbToLinear(i / qreal(255 * 16)) * (255 * 256))); - cp->m_fromLinear[i] = ushort(qRound(linearToSrgb(i / qreal(255 * 16)) * (255 * 256))); + cp->m_toLinear[i] = ushort(qBound(0, qRound(table.apply(i / qreal(255 * 16)) * (255 * 256)), 65280)); + minInverse = table.applyInverse(i / qreal(255 * 16), minInverse); + cp->m_fromLinear[i] = ushort(qBound(0, qRound(minInverse * (255 * 256)), 65280)); } return cp; diff --git a/src/gui/painting/qcolorprofile_p.h b/src/gui/painting/qcolortrclut_p.h index 425e9abace..76a6a60803 100644 --- a/src/gui/painting/qcolorprofile_p.h +++ b/src/gui/painting/qcolortrclut_p.h @@ -37,8 +37,8 @@ ** ****************************************************************************/ -#ifndef QCOLORPROFILE_P_H -#define QCOLORPROFILE_P_H +#ifndef QCOLORTRCLUT_P_H +#define QCOLORTRCLUT_P_H // // W A R N I N G @@ -52,21 +52,29 @@ // #include <QtGui/private/qtguiglobal_p.h> +#include <QtCore/qsharedpointer.h> #include <QtGui/qrgb.h> #include <QtGui/qrgba64.h> +#include <cmath> + #if defined(__SSE2__) #include <emmintrin.h> #elif defined(__ARM_NEON__) || defined(__ARM_NEON) #include <arm_neon.h> #endif + QT_BEGIN_NAMESPACE -class Q_GUI_EXPORT QColorProfile +class QColorTransferFunction; +class QColorTransferTable; + +class Q_GUI_EXPORT QColorTrcLut : public QEnableSharedFromThis<QColorTrcLut> { public: - static QColorProfile *fromGamma(qreal gamma); - static QColorProfile *fromSRgb(); + static QColorTrcLut *fromGamma(qreal gamma); + static QColorTrcLut *fromTransferFunction(const QColorTransferFunction &transfn); + static QColorTrcLut *fromTransferTable(const QColorTransferTable &transTable); // The following methods all convert opaque or unpremultiplied colors: @@ -121,6 +129,25 @@ public: return convertWithTable(rgb64, m_toLinear); } + float u8ToLinearF32(int c) const + { + ushort v = m_toLinear[c << 4]; + return v * (1.0f / (255*256)); + } + + float u16ToLinearF32(int c) const + { + c -= (c >> 8); + ushort v = m_toLinear[c >> 4]; + return v * (1.0f / (255*256)); + } + + float toLinear(float f) const + { + ushort v = m_toLinear[(int)(f * (255 * 16) + 0.5f)]; + return v * (1.0f / (255*256)); + } + QRgb fromLinear64(QRgba64 rgb64) const { #if defined(__SSE2__) @@ -176,8 +203,31 @@ public: return convertWithTable(rgb64, m_fromLinear); } + int u8FromLinearF32(float f) const + { + ushort v = m_fromLinear[(int)(f * (255 * 16) + 0.5f)]; + return (v + 0x80) >> 8; + } + int u16FromLinearF32(float f) const + { + ushort v = m_fromLinear[(int)(f * (255 * 16) + 0.5f)]; + return v + (v >> 8); + } + float fromLinear(float f) const + { + ushort v = m_fromLinear[(int)(f * (255 * 16) + 0.5f)]; + return v * (1.0f / (255*256)); + } + + // We translate to 0-65280 (255*256) instead to 0-65535 to make simple + // shifting an accurate conversion. + // We translate from 0-4080 (255*16) for the same speed up, and to keep + // the tables small enough to fit in most inner caches. + ushort m_toLinear[(255 * 16) + 1]; // [0-4080] -> [0-65280] + ushort m_fromLinear[(255 * 16) + 1]; // [0-4080] -> [0-65280] + private: - QColorProfile() { } + QColorTrcLut() { } Q_ALWAYS_INLINE static QRgb convertWithTable(QRgb rgb32, const ushort *table) { @@ -230,16 +280,8 @@ private: return QRgba64::fromRgba64(r, g, b, rgb64.alpha()); #endif } - - // We translate to 0-65280 (255*256) instead to 0-65535 to make simple - // shifting an accurate conversion. - // We translate from 0-4080 (255*16) for the same speed up, and to keep - // the tables small enough to fit in most inner caches. - ushort m_toLinear[(255 * 16) + 1]; // [0-4080] -> [0-65280] - ushort m_fromLinear[(255 * 16) + 1]; // [0-4080] -> [0-65280] - }; QT_END_NAMESPACE -#endif // QCOLORPROFILE_P_H +#endif // QCOLORTRCLUT_P_H diff --git a/src/gui/painting/qcosmeticstroker_p.h b/src/gui/painting/qcosmeticstroker_p.h index 082ddee30f..8571b0476a 100644 --- a/src/gui/painting/qcosmeticstroker_p.h +++ b/src/gui/painting/qcosmeticstroker_p.h @@ -98,8 +98,8 @@ public: : state(s), deviceRect(dr_unclipped), clip(dr), - pattern(0), - reversePattern(0), + pattern(nullptr), + reversePattern(nullptr), patternSize(0), patternLength(0), patternOffset(0), diff --git a/src/gui/painting/qdatabuffer_p.h b/src/gui/painting/qdatabuffer_p.h index 28d5f6d6c5..181d19da0b 100644 --- a/src/gui/painting/qdatabuffer_p.h +++ b/src/gui/painting/qdatabuffer_p.h @@ -69,7 +69,7 @@ public: buffer = (Type*) malloc(capacity * sizeof(Type)); Q_CHECK_PTR(buffer); } else { - buffer = 0; + buffer = nullptr; } siz = 0; } @@ -128,7 +128,7 @@ public: Q_CHECK_PTR(buffer); } else { free(buffer); - buffer = 0; + buffer = nullptr; } } diff --git a/src/gui/painting/qdrawhelper.cpp b/src/gui/painting/qdrawhelper.cpp index 2dd18f6dfc..1ed51d26a2 100644 --- a/src/gui/painting/qdrawhelper.cpp +++ b/src/gui/painting/qdrawhelper.cpp @@ -43,7 +43,7 @@ #include <qstylehints.h> #include <qguiapplication.h> #include <qatomic.h> -#include <private/qcolorprofile_p.h> +#include <private/qcolortrclut_p.h> #include <private/qdrawhelper_p.h> #include <private/qpaintengine_raster_p.h> #include <private/qpainter_p.h> @@ -5523,7 +5523,7 @@ inline static void qt_bitmapblit_quint16(QRasterBuffer *rasterBuffer, map, mapWidth, mapHeight, mapStride); } -static inline void alphamapblend_generic(int coverage, QRgba64 *dest, int x, const QRgba64 &srcLinear, const QRgba64 &src, const QColorProfile *colorProfile) +static inline void alphamapblend_generic(int coverage, QRgba64 *dest, int x, const QRgba64 &srcLinear, const QRgba64 &src, const QColorTrcLut *colorProfile) { if (coverage == 0) { // nothing @@ -5558,7 +5558,7 @@ static void qt_alphamapblit_generic(QRasterBuffer *rasterBuffer, if (color.isTransparent()) return; - const QColorProfile *colorProfile = nullptr; + const QColorTrcLut *colorProfile = nullptr; if (useGammaCorrection) colorProfile = QGuiApplicationPrivate::instance()->colorProfileForA8Text(); @@ -5684,7 +5684,7 @@ void qt_alphamapblit_quint16(QRasterBuffer *rasterBuffer, } } -static inline void rgbBlendPixel(quint32 *dst, int coverage, QRgba64 slinear, const QColorProfile *colorProfile) +static inline void rgbBlendPixel(quint32 *dst, int coverage, QRgba64 slinear, const QColorTrcLut *colorProfile) { // Do a gammacorrected RGB alphablend... const QRgba64 dlinear = colorProfile ? colorProfile->toLinear64(*dst) : QRgba64::fromArgb32(*dst); @@ -5694,7 +5694,7 @@ static inline void rgbBlendPixel(quint32 *dst, int coverage, QRgba64 slinear, co *dst = colorProfile ? colorProfile->fromLinear64(blend) : toArgb32(blend); } -static inline void grayBlendPixel(quint32 *dst, int coverage, QRgba64 srcLinear, const QColorProfile *colorProfile) +static inline void grayBlendPixel(quint32 *dst, int coverage, QRgba64 srcLinear, const QColorTrcLut *colorProfile) { // Do a gammacorrected gray alphablend... const QRgba64 dstLinear = colorProfile ? colorProfile->toLinear64(*dst) : QRgba64::fromArgb32(*dst); @@ -5704,7 +5704,7 @@ static inline void grayBlendPixel(quint32 *dst, int coverage, QRgba64 srcLinear, *dst = colorProfile ? colorProfile->fromLinear64(blend) : toArgb32(blend); } -static inline void alphamapblend_argb32(quint32 *dst, int coverage, QRgba64 srcLinear, quint32 src, const QColorProfile *colorProfile) +static inline void alphamapblend_argb32(quint32 *dst, int coverage, QRgba64 srcLinear, quint32 src, const QColorTrcLut *colorProfile) { if (coverage == 0) { // nothing @@ -5734,7 +5734,7 @@ static void qt_alphamapblit_argb32(QRasterBuffer *rasterBuffer, if (color.isTransparent()) return; - const QColorProfile *colorProfile = nullptr; + const QColorTrcLut *colorProfile = nullptr; if (useGammaCorrection) colorProfile = QGuiApplicationPrivate::instance()->colorProfileForA8Text(); @@ -5830,7 +5830,7 @@ static inline QRgb rgbBlend(QRgb d, QRgb s, uint rgbAlpha) #endif } -static inline void alphargbblend_generic(uint coverage, QRgba64 *dest, int x, const QRgba64 &srcLinear, const QRgba64 &src, const QColorProfile *colorProfile) +static inline void alphargbblend_generic(uint coverage, QRgba64 *dest, int x, const QRgba64 &srcLinear, const QRgba64 &src, const QColorTrcLut *colorProfile) { if (coverage == 0xff000000) { // nothing @@ -5852,7 +5852,7 @@ static inline void alphargbblend_generic(uint coverage, QRgba64 *dest, int x, co } } -static inline void alphargbblend_argb32(quint32 *dst, uint coverage, const QRgba64 &srcLinear, quint32 src, const QColorProfile *colorProfile) +static inline void alphargbblend_argb32(quint32 *dst, uint coverage, const QRgba64 &srcLinear, quint32 src, const QColorTrcLut *colorProfile) { if (coverage == 0xff000000) { // nothing @@ -5877,7 +5877,7 @@ static void qt_alphargbblit_generic(QRasterBuffer *rasterBuffer, if (color.isTransparent()) return; - const QColorProfile *colorProfile = nullptr; + const QColorTrcLut *colorProfile = nullptr; if (useGammaCorrection) colorProfile = QGuiApplicationPrivate::instance()->colorProfileForA32Text(); @@ -5954,7 +5954,7 @@ static void qt_alphargbblit_argb32(QRasterBuffer *rasterBuffer, const quint32 c = color.toArgb32(); - const QColorProfile *colorProfile = nullptr; + const QColorTrcLut *colorProfile = nullptr; if (useGammaCorrection) colorProfile = QGuiApplicationPrivate::instance()->colorProfileForA32Text(); diff --git a/src/gui/painting/qdrawhelper_p.h b/src/gui/painting/qdrawhelper_p.h index 37108949d6..1e99a34842 100644 --- a/src/gui/painting/qdrawhelper_p.h +++ b/src/gui/painting/qdrawhelper_p.h @@ -328,7 +328,7 @@ struct QTextureData struct QSpanData { - QSpanData() : tempImage(0) {} + QSpanData() : tempImage(nullptr) {} ~QSpanData() { delete tempImage; } QRasterBuffer *rasterBuffer; diff --git a/src/gui/painting/qicc.cpp b/src/gui/painting/qicc.cpp new file mode 100644 index 0000000000..d88b005782 --- /dev/null +++ b/src/gui/painting/qicc.cpp @@ -0,0 +1,669 @@ +/**************************************************************************** +** +** Copyright (C) 2016 The Qt Company Ltd. +** Contact: https://www.qt.io/licensing/ +** +** This file is part of the QtGui module of the Qt Toolkit. +** +** $QT_BEGIN_LICENSE:LGPL$ +** Commercial License Usage +** Licensees holding valid commercial Qt licenses may use this file in +** accordance with the commercial license agreement provided with the +** Software or, alternatively, in accordance with the terms contained in +** a written agreement between you and The Qt Company. For licensing terms +** and conditions see https://www.qt.io/terms-conditions. For further +** information use the contact form at https://www.qt.io/contact-us. +** +** GNU Lesser General Public License Usage +** Alternatively, this file may be used under the terms of the GNU Lesser +** General Public License version 3 as published by the Free Software +** Foundation and appearing in the file LICENSE.LGPL3 included in the +** packaging of this file. Please review the following information to +** ensure the GNU Lesser General Public License version 3 requirements +** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. +** +** GNU General Public License Usage +** Alternatively, this file may be used under the terms of the GNU +** General Public License version 2.0 or (at your option) the GNU General +** Public license version 3 or any later version approved by the KDE Free +** Qt Foundation. The licenses are as published by the Free Software +** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 +** included in the packaging of this file. Please review the following +** information to ensure the GNU General Public License requirements will +** be met: https://www.gnu.org/licenses/gpl-2.0.html and +** https://www.gnu.org/licenses/gpl-3.0.html. +** +** $QT_END_LICENSE$ +** +****************************************************************************/ + +#include "qicc_p.h" + +#include <qbuffer.h> +#include <qbytearray.h> +#include <qdatastream.h> +#include <qloggingcategory.h> +#include <qendian.h> + +#include "qcolorspace_p.h" +#include "qcolortrc_p.h" + +QT_BEGIN_NAMESPACE +Q_LOGGING_CATEGORY(lcIcc, "qt.gui.icc") + +struct ICCProfileHeader +{ + quint32_be profileSize; + + quint32_be preferredCmmType; + + quint32_be profileVersion; + quint32_be profileClass; + quint32_be inputColorSpace; + quint32_be pcs; + quint32_be datetime[3]; + quint32_be signature; + quint32_be platformSignature; + quint32_be flags; + quint32_be deviceManufacturer; + quint32_be deviceModel; + quint32_be deviceAttributes[2]; + + quint32_be renderingIntent; + qint32_be illuminantXyz[3]; + + quint32_be creatorSignature; + quint32_be profileId[4]; + + quint32_be reserved[7]; + +// Technically after the header, but easier to include here: + quint32_be tagCount; +}; + +constexpr quint32 IccTag(uchar a, uchar b, uchar c, uchar d) +{ + return (a << 24) | (b << 16) | (c << 8) | d; +} + +enum class ProfileClass : quint32 { + Input = IccTag('s', 'c', 'r', 'n'), + Display = IccTag('m', 'n', 't', 'r'), + // Not supported: + Output = IccTag('p', 'r', 't', 'r'), + ColorSpace = IccTag('s', 'p', 'a', 'c'), +}; + +enum class Tag : quint32 { + acsp = IccTag('a', 'c', 's', 'p'), + RGB_ = IccTag('R', 'G', 'B', ' '), + XYZ_ = IccTag('X', 'Y', 'Z', ' '), + rXYZ = IccTag('r', 'X', 'Y', 'Z'), + gXYZ = IccTag('g', 'X', 'Y', 'Z'), + bXYZ = IccTag('b', 'X', 'Y', 'Z'), + rTRC = IccTag('r', 'T', 'R', 'C'), + gTRC = IccTag('g', 'T', 'R', 'C'), + bTRC = IccTag('b', 'T', 'R', 'C'), + A2B0 = IccTag('A', '2', 'B', '0'), + A2B1 = IccTag('A', '2', 'B', '1'), + B2A0 = IccTag('B', '2', 'A', '0'), + B2A1 = IccTag('B', '2', 'A', '1'), + desc = IccTag('d', 'e', 's', 'c'), + text = IccTag('t', 'e', 'x', 't'), + cprt = IccTag('c', 'p', 'r', 't'), + curv = IccTag('c', 'u', 'r', 'v'), + para = IccTag('p', 'a', 'r', 'a'), + wtpt = IccTag('w', 't', 'p', 't'), + bkpt = IccTag('b', 'k', 'p', 't'), + mft1 = IccTag('m', 'f', 't', '1'), + mft2 = IccTag('m', 'f', 't', '2'), + mAB_ = IccTag('m', 'A', 'B', ' '), + mBA_ = IccTag('m', 'B', 'A', ' '), + chad = IccTag('c', 'h', 'a', 'd'), + sf32 = IccTag('s', 'f', '3', '2'), + + // Apple extensions for ICCv2: + aarg = IccTag('a', 'a', 'r', 'g'), + aagg = IccTag('a', 'a', 'g', 'g'), + aabg = IccTag('a', 'a', 'b', 'g'), +}; + +inline uint qHash(const Tag &key, uint seed = 0) +{ + return qHash(quint32(key), seed); +} + +namespace QIcc { + +struct TagTableEntry +{ + quint32_be signature; + quint32_be offset; + quint32_be size; +}; + +struct GenericTagData { + quint32_be type; + quint32_be null; +}; + +struct XYZTagData : GenericTagData { + qint32_be fixedX; + qint32_be fixedY; + qint32_be fixedZ; +}; + +struct CurvTagData : GenericTagData { + quint32_be valueCount; + quint16_be value[1]; +}; + +struct ParaTagData : GenericTagData { + quint16_be curveType; + quint16_be null2; + quint32_be parameter[1]; +}; + +// For both mAB and mBA +struct mABTagData : GenericTagData { + quint8 inputChannels; + quint8 outputChannels; + quint8 padding[2]; + quint32_be bCurvesOffset; + quint32_be matrixOffset; + quint32_be mCurvesOffset; + quint32_be clutOffset; + quint32_be aCurvesOffset; +}; + +struct Sf32TagData : GenericTagData { + quint32_be value[1]; +}; + +static int toFixedS1516(float x) +{ + return int(x * 65536.0f + 0.5f); +} + +static float fromFixedS1516(int x) +{ + return x * (1.0f / 65536.0f); +} + +QColorVector fromXyzData(const XYZTagData *xyz) +{ + const float x = fromFixedS1516(xyz->fixedX); + const float y = fromFixedS1516(xyz->fixedY); + const float z = fromFixedS1516(xyz->fixedZ); + qCDebug(lcIcc) << "XYZ_ " << x << y << z; + + return QColorVector(x, y, z); +} + +static bool isValidIccProfile(const ICCProfileHeader &header) +{ + if (header.signature != uint(Tag::acsp)) { + qCWarning(lcIcc, "Failed ICC signature test"); + return false; + } + if (header.profileSize < (sizeof(ICCProfileHeader) + header.tagCount * sizeof(TagTableEntry))) { + qCWarning(lcIcc, "Failed basic size sanity"); + return false; + } + + if (header.profileClass != uint(ProfileClass::Input) + && header.profileClass != uint(ProfileClass::Display)) { + qCWarning(lcIcc, "Unsupported ICC profile class %x", quint32(header.profileClass)); + return false; + } + if (header.inputColorSpace != 0x52474220 /* 'RGB '*/) { + qCWarning(lcIcc, "Unsupported ICC input color space %x", quint32(header.inputColorSpace)); + return false; + } + if (header.pcs != 0x58595a20 /* 'XYZ '*/) { + // ### support PCSLAB + qCWarning(lcIcc, "Unsupported ICC profile connection space %x", quint32(header.pcs)); + return false; + } + + QColorVector illuminant; + illuminant.x = fromFixedS1516(header.illuminantXyz[0]); + illuminant.y = fromFixedS1516(header.illuminantXyz[1]); + illuminant.z = fromFixedS1516(header.illuminantXyz[2]); + if (illuminant != QColorVector::D50()) { + qCWarning(lcIcc, "Invalid ICC illuminant"); + return false; + } + + return true; +} + +static int writeColorTrc(QDataStream &stream, const QColorTrc &trc) +{ + if (trc.isLinear()) { + stream << uint(Tag::curv) << uint(0); + stream << uint(0); + return 12; + } + + if (trc.m_type == QColorTrc::Type::Function) { + const QColorTransferFunction &fun = trc.m_fun; + stream << uint(Tag::para) << uint(0); + if (fun.isGamma()) { + stream << ushort(0) << ushort(0); + stream << toFixedS1516(fun.m_g); + return 12 + 4; + } + bool type3 = qFuzzyIsNull(fun.m_e) && qFuzzyIsNull(fun.m_f); + stream << ushort(type3 ? 3 : 4) << ushort(0); + stream << toFixedS1516(fun.m_g); + stream << toFixedS1516(fun.m_a); + stream << toFixedS1516(fun.m_b); + stream << toFixedS1516(fun.m_c); + stream << toFixedS1516(fun.m_d); + if (type3) + return 12 + 5 * 4; + stream << toFixedS1516(fun.m_e); + stream << toFixedS1516(fun.m_f); + return 12 + 7 * 4; + } + + Q_ASSERT(trc.m_type == QColorTrc::Type::Table); + stream << uint(Tag::curv) << uint(0); + stream << uint(trc.m_table.m_tableSize); + if (!trc.m_table.m_table16.isEmpty()) { + for (uint i = 0; i < trc.m_table.m_tableSize; ++i) { + stream << ushort(trc.m_table.m_table16[i]); + } + } else { + for (uint i = 0; i < trc.m_table.m_tableSize; ++i) { + stream << ushort(trc.m_table.m_table8[i] * 257U); + } + } + return 12 + 2 * trc.m_table.m_tableSize; +} + +QByteArray toIccProfile(const QColorSpace &space) +{ + if (!space.isValid()) + return QByteArray(); + + const QColorSpacePrivate *spaceDPtr = space.d_func(); + + constexpr int tagCount = 9; + constexpr uint profileDataOffset = 128 + 4 + 12 * tagCount; + constexpr uint variableTagTableOffsets = 128 + 4 + 12 * 5; + uint currentOffset = 0; + uint rTrcOffset, gTrcOffset, bTrcOffset; + uint rTrcSize, gTrcSize, bTrcSize; + uint descOffset, descSize; + + QBuffer buffer; + buffer.open(QIODevice::WriteOnly); + QDataStream stream(&buffer); + + // Profile header: + stream << uint(0); // Size, we will update this later + stream << uint(0); + stream << uint(0x02400000); // Version 2.4 (note we use 'para' from version 4) + stream << uint(ProfileClass::Display); + stream << uint(Tag::RGB_); + stream << uint(Tag::XYZ_); + stream << uint(0) << uint(0) << uint(0); + stream << uint(Tag::acsp); + stream << uint(0) << uint(0) << uint(0); + stream << uint(0) << uint(0) << uint(0); + stream << uint(1); // Rendering intent + stream << uint(0x0000f6d6); // D50 X + stream << uint(0x00010000); // D50 Y + stream << uint(0x0000d32d); // D50 Z + stream << IccTag('Q','t', QT_VERSION_MAJOR, QT_VERSION_MINOR); + stream << uint(0) << uint(0) << uint(0) << uint(0); + stream << uint(0) << uint(0) << uint(0) << uint(0) << uint(0) << uint(0) << uint(0); + + // Tag table: + stream << uint(tagCount); + stream << uint(Tag::rXYZ) << uint(profileDataOffset + 00) << uint(20); + stream << uint(Tag::gXYZ) << uint(profileDataOffset + 20) << uint(20); + stream << uint(Tag::bXYZ) << uint(profileDataOffset + 40) << uint(20); + stream << uint(Tag::wtpt) << uint(profileDataOffset + 60) << uint(20); + stream << uint(Tag::cprt) << uint(profileDataOffset + 80) << uint(12); + // From here the offset and size will be updated later: + stream << uint(Tag::rTRC) << uint(0) << uint(0); + stream << uint(Tag::gTRC) << uint(0) << uint(0); + stream << uint(Tag::bTRC) << uint(0) << uint(0); + stream << uint(Tag::desc) << uint(0) << uint(0); + // TODO: consider adding 'chad' tag (required in ICC >=4 when we have non-D50 whitepoint) + currentOffset = profileDataOffset; + + // Tag data: + stream << uint(Tag::XYZ_) << uint(0); + stream << toFixedS1516(spaceDPtr->toXyz.r.x); + stream << toFixedS1516(spaceDPtr->toXyz.r.y); + stream << toFixedS1516(spaceDPtr->toXyz.r.z); + stream << uint(Tag::XYZ_) << uint(0); + stream << toFixedS1516(spaceDPtr->toXyz.g.x); + stream << toFixedS1516(spaceDPtr->toXyz.g.y); + stream << toFixedS1516(spaceDPtr->toXyz.g.z); + stream << uint(Tag::XYZ_) << uint(0); + stream << toFixedS1516(spaceDPtr->toXyz.b.x); + stream << toFixedS1516(spaceDPtr->toXyz.b.y); + stream << toFixedS1516(spaceDPtr->toXyz.b.z); + stream << uint(Tag::XYZ_) << uint(0); + stream << toFixedS1516(spaceDPtr->whitePoint.x); + stream << toFixedS1516(spaceDPtr->whitePoint.y); + stream << toFixedS1516(spaceDPtr->whitePoint.z); + stream << uint(Tag::text) << uint(0); + stream << uint(IccTag('N', '/', 'A', '\0')); + currentOffset += 92; + + // From now on the data is variable sized: + rTrcOffset = currentOffset; + rTrcSize = writeColorTrc(stream, spaceDPtr->trc[0]); + currentOffset += rTrcSize; + if (spaceDPtr->trc[0] == spaceDPtr->trc[1]) { + gTrcOffset = rTrcOffset; + gTrcSize = rTrcSize; + } else { + gTrcOffset = currentOffset; + gTrcSize = writeColorTrc(stream, spaceDPtr->trc[1]); + currentOffset += gTrcSize; + } + if (spaceDPtr->trc[0] == spaceDPtr->trc[2]) { + bTrcOffset = rTrcOffset; + bTrcSize = rTrcSize; + } else { + bTrcOffset = currentOffset; + bTrcSize = writeColorTrc(stream, spaceDPtr->trc[2]); + currentOffset += bTrcSize; + } + + descOffset = currentOffset; + QByteArray description = spaceDPtr->description.toUtf8(); + stream << uint(Tag::desc) << uint(0); + stream << uint(description.size() + 1); + stream.writeRawData(description.constData(), description.size() + 1); + stream << uint(0) << uint(0); + stream << ushort(0) << uchar(0); + QByteArray macdesc(67, '\0'); + stream.writeRawData(macdesc.constData(), 67); + descSize = 90 + description.size() + 1; + currentOffset += descSize; + + buffer.close(); + QByteArray iccProfile = buffer.buffer(); + // Now write final size + *(quint32_be *)iccProfile.data() = iccProfile.size(); + // And the final indices and sizes of variable size tags: + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 4) = rTrcOffset; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 8) = rTrcSize; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 12 + 4) = gTrcOffset; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 12 + 8) = gTrcSize; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 2 * 12 + 4) = bTrcOffset; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 2 * 12 + 8) = bTrcSize; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 3 * 12 + 4) = descOffset; + *(quint32_be *)(iccProfile.data() + variableTagTableOffsets + 3 * 12 + 8) = descSize; + +#if !defined(QT_NO_DEBUG) || defined(QT_FORCE_ASSERTS) + const ICCProfileHeader *iccHeader = (const ICCProfileHeader *)iccProfile.constData(); + Q_ASSERT(qsizetype(iccHeader->profileSize) == qsizetype(iccProfile.size())); + Q_ASSERT(isValidIccProfile(*iccHeader)); +#endif + + return iccProfile; +} + +bool parseTRC(const GenericTagData *trcData, QColorTrc &gamma) +{ + if (trcData->type == quint32(Tag::curv)) { + const CurvTagData *curv = reinterpret_cast<const CurvTagData *>(trcData); + qCDebug(lcIcc) << "curv" << uint(curv->valueCount); + if (curv->valueCount == 0) { + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction(); // Linear + } else if (curv->valueCount == 1) { + float g = curv->value[0] * (1.0f / 256.0f); + qCDebug(lcIcc) << g; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction::fromGamma(g); + } else { + QVector<quint16> tabl; + tabl.resize(curv->valueCount); + for (uint i = 0; i < curv->valueCount; ++i) + tabl[i] = curv->value[i]; + QColorTransferTable table = QColorTransferTable(curv->valueCount, std::move(tabl)); + QColorTransferFunction curve; + if (!table.asColorTransferFunction(&curve)) { + gamma.m_type = QColorTrc::Type::Table; + gamma.m_table = table; + } else { + qCDebug(lcIcc) << "Detected curv table as function"; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = curve; + } + } + return true; + } + if (trcData->type == quint32(Tag::para)) { + const ParaTagData *para = reinterpret_cast<const ParaTagData *>(trcData); + qCDebug(lcIcc) << "para" << uint(para->curveType); + switch (para->curveType) { + case 0: { + float g = fromFixedS1516(para->parameter[0]); + qCDebug(lcIcc) << g; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction::fromGamma(g); + break; + } + case 1: { + float g = fromFixedS1516(para->parameter[0]); + float a = fromFixedS1516(para->parameter[1]); + float b = fromFixedS1516(para->parameter[2]); + float d = -b / a; + qCDebug(lcIcc) << g << a << b; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction(a, b, 0.0f, d, 0.0f, 0.0f, g); + break; + } + case 2: { + float g = fromFixedS1516(para->parameter[0]); + float a = fromFixedS1516(para->parameter[1]); + float b = fromFixedS1516(para->parameter[2]); + float c = fromFixedS1516(para->parameter[3]); + float d = -b / a; + qCDebug(lcIcc) << g << a << b << c; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction(a, b, 0.0f, d, c, c, g); + break; + } + case 3: { + float g = fromFixedS1516(para->parameter[0]); + float a = fromFixedS1516(para->parameter[1]); + float b = fromFixedS1516(para->parameter[2]); + float c = fromFixedS1516(para->parameter[3]); + float d = fromFixedS1516(para->parameter[4]); + qCDebug(lcIcc) << g << a << b << c << d; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction(a, b, c, d, 0.0f, 0.0f, g); + break; + } + case 4: { + float g = fromFixedS1516(para->parameter[0]); + float a = fromFixedS1516(para->parameter[1]); + float b = fromFixedS1516(para->parameter[2]); + float c = fromFixedS1516(para->parameter[3]); + float d = fromFixedS1516(para->parameter[4]); + float e = fromFixedS1516(para->parameter[5]); + float f = fromFixedS1516(para->parameter[6]); + qCDebug(lcIcc) << g << a << b << c << d << e << f; + gamma.m_type = QColorTrc::Type::Function; + gamma.m_fun = QColorTransferFunction(a, b, c, d, e, f, g); + break; + } + default: + qCWarning(lcIcc) << "Unknown para type" << uint(para->curveType); + return false; + } + return true; + } + qCWarning(lcIcc) << "Invalid TRC data type"; + return false; +} + +bool fromIccProfile(const QByteArray &data, QColorSpace *colorSpace) +{ + if (data.size() < qsizetype(sizeof(ICCProfileHeader))) { + qCWarning(lcIcc) << "fromIccProfile: failed size sanity 1"; + return false; + } + const ICCProfileHeader *header = (const ICCProfileHeader *)data.constData(); + if (!isValidIccProfile(*header)) { + qCWarning(lcIcc) << "fromIccProfile: failed general sanity check"; + return false; + } + if (qsizetype(header->profileSize) > data.size()) { + qCWarning(lcIcc) << "fromIccProfile: failed size sanity 2"; + return false; + } + + // Read tag index + const TagTableEntry *tagTable = (const TagTableEntry *)(data.constData() + sizeof(ICCProfileHeader)); + const qsizetype offsetToData = sizeof(ICCProfileHeader) + header->tagCount * sizeof(TagTableEntry); + + QHash<Tag, quint32> tagIndex; + for (uint i = 0; i < header->tagCount; ++i) { + // Sanity check tag sizes and offsets: + if (qsizetype(tagTable[i].offset) < offsetToData) { + qCWarning(lcIcc) << "fromIccProfile: failed tag offset sanity 1"; + return false; + } + // Checked separately from (+ size) to handle overflow. + if (tagTable[i].offset > header->profileSize) { + qCWarning(lcIcc) << "fromIccProfile: failed tag offset sanity 2"; + return false; + } + if ((tagTable[i].offset + tagTable[i].size) > header->profileSize) { + qCWarning(lcIcc) << "fromIccProfile: failed tag offset + size sanity"; + return false; + } +// printf("'%4s' %d %d\n", (const char *)&tagTable[i].signature, +// quint32(tagTable[i].offset), +// quint32(tagTable[i].size)); + tagIndex.insert(Tag(quint32(tagTable[i].signature)), tagTable[i].offset); + } + // Check the profile is three-component matrix based (what we currently support): + if (!tagIndex.contains(Tag::rXYZ) || !tagIndex.contains(Tag::gXYZ) || !tagIndex.contains(Tag::bXYZ) || + !tagIndex.contains(Tag::rTRC) || !tagIndex.contains(Tag::gTRC) || !tagIndex.contains(Tag::bTRC) || + !tagIndex.contains(Tag::wtpt)) { + qCWarning(lcIcc) << "fromIccProfile: Unsupported ICC profile - not three component matrix based"; + return false; + } + + // Parse XYZ tags + const XYZTagData *rXyz = (const XYZTagData *)(data.constData() + tagIndex[Tag::rXYZ]); + const XYZTagData *gXyz = (const XYZTagData *)(data.constData() + tagIndex[Tag::gXYZ]); + const XYZTagData *bXyz = (const XYZTagData *)(data.constData() + tagIndex[Tag::bXYZ]); + const XYZTagData *wXyz = (const XYZTagData *)(data.constData() + tagIndex[Tag::wtpt]); + if (rXyz->type != quint32(Tag::XYZ_) || gXyz->type != quint32(Tag::XYZ_) || + wXyz->type != quint32(Tag::XYZ_) || wXyz->type != quint32(Tag::XYZ_)) { + qCWarning(lcIcc) << "fromIccProfile: Bad XYZ data type"; + return false; + } + QColorSpacePrivate *colorspaceDPtr = colorSpace->d_func(); + + colorspaceDPtr->toXyz.r = fromXyzData(rXyz); + colorspaceDPtr->toXyz.g = fromXyzData(gXyz); + colorspaceDPtr->toXyz.b = fromXyzData(bXyz); + QColorVector whitePoint = fromXyzData(wXyz); + colorspaceDPtr->whitePoint = whitePoint; + + colorspaceDPtr->gamut = QColorSpace::Gamut::Custom; + if (colorspaceDPtr->toXyz == QColorMatrix::toXyzFromSRgb()) { + qCDebug(lcIcc) << "fromIccProfile: sRGB gamut detected"; + colorspaceDPtr->gamut = QColorSpace::Gamut::SRgb; + } else if (colorspaceDPtr->toXyz == QColorMatrix::toXyzFromAdobeRgb()) { + qCDebug(lcIcc) << "fromIccProfile: Adobe RGB gamut detected"; + colorspaceDPtr->gamut = QColorSpace::Gamut::AdobeRgb; + } else if (colorspaceDPtr->toXyz == QColorMatrix::toXyzFromDciP3D65()) { + qCDebug(lcIcc) << "fromIccProfile: DCI-P3 D65 gamut detected"; + colorspaceDPtr->gamut = QColorSpace::Gamut::DciP3D65; + } else if (colorspaceDPtr->toXyz == QColorMatrix::toXyzFromBt2020()) { + qCDebug(lcIcc) << "fromIccProfile: BT.2020 gamut detected"; + colorspaceDPtr->gamut = QColorSpace::Gamut::Bt2020; + } + if (colorspaceDPtr->toXyz == QColorMatrix::toXyzFromProPhotoRgb()) { + qCDebug(lcIcc) << "fromIccProfile: ProPhoto RGB gamut detected"; + colorspaceDPtr->gamut = QColorSpace::Gamut::ProPhotoRgb; + } + // Reset the matrix to our canonical values: + if (colorspaceDPtr->gamut != QColorSpace::Gamut::Custom) + colorspaceDPtr->setToXyzMatrix(); + + // Parse TRC tags + const GenericTagData *rTrc; + const GenericTagData *gTrc; + const GenericTagData *bTrc; + if (tagIndex.contains(Tag::aarg) && tagIndex.contains(Tag::aagg) && tagIndex.contains(Tag::aabg)) { + // Apple extension for parametric version of TRCs in ICCv2: + rTrc = (const GenericTagData *)(data.constData() + tagIndex[Tag::aarg]); + gTrc = (const GenericTagData *)(data.constData() + tagIndex[Tag::aagg]); + bTrc = (const GenericTagData *)(data.constData() + tagIndex[Tag::aabg]); + } else { + rTrc = (const GenericTagData *)(data.constData() + tagIndex[Tag::rTRC]); + gTrc = (const GenericTagData *)(data.constData() + tagIndex[Tag::gTRC]); + bTrc = (const GenericTagData *)(data.constData() + tagIndex[Tag::bTRC]); + } + + QColorTrc rCurve; + QColorTrc gCurve; + QColorTrc bCurve; + if (!parseTRC(rTrc, rCurve)) + return false; + if (!parseTRC(gTrc, gCurve)) + return false; + if (!parseTRC(bTrc, bCurve)) + return false; + if (rCurve == gCurve && gCurve == bCurve && rCurve.m_type == QColorTrc::Type::Function) { + if (rCurve.m_fun.isLinear()) { + qCDebug(lcIcc) << "fromIccProfile: Linear gamma detected"; + colorspaceDPtr->trc[0] = QColorTransferFunction(); + colorspaceDPtr->transferFunction = QColorSpace::TransferFunction::Linear; + colorspaceDPtr->gamma = 1.0f; + } else if (rCurve.m_fun.isGamma()) { + qCDebug(lcIcc) << "fromIccProfile: Simple gamma detected"; + colorspaceDPtr->trc[0] = QColorTransferFunction::fromGamma(rCurve.m_fun.m_g); + colorspaceDPtr->transferFunction = QColorSpace::TransferFunction::Gamma; + colorspaceDPtr->gamma = rCurve.m_fun.m_g; + } else if (rCurve.m_fun.isSRgb()) { + qCDebug(lcIcc) << "fromIccProfile: sRGB gamma detected"; + colorspaceDPtr->trc[0] = QColorTransferFunction::fromSRgb(); + colorspaceDPtr->transferFunction = QColorSpace::TransferFunction::SRgb; + } else { + colorspaceDPtr->trc[0] = rCurve; + colorspaceDPtr->transferFunction = QColorSpace::TransferFunction::Custom; + } + + colorspaceDPtr->trc[1] = colorspaceDPtr->trc[0]; + colorspaceDPtr->trc[2] = colorspaceDPtr->trc[0]; + } else { + colorspaceDPtr->trc[0] = rCurve; + colorspaceDPtr->trc[1] = gCurve; + colorspaceDPtr->trc[2] = bCurve; + colorspaceDPtr->transferFunction = QColorSpace::TransferFunction::Custom; + } + + // FIXME: try to parse the description.. + + if (!colorspaceDPtr->identifyColorSpace()) + colorspaceDPtr->id = QColorSpace::Unknown; + else + qCDebug(lcIcc) << "fromIccProfile: Named colorspace detected: " << colorSpace->colorSpaceId(); + + colorspaceDPtr->iccProfile = data; + + return true; +} + +} // namespace QIcc + +QT_END_NAMESPACE diff --git a/src/plugins/platforms/mirclient/qmirclientdebugextension.h b/src/gui/painting/qicc_p.h index 0596561d77..c3220391f4 100644 --- a/src/plugins/platforms/mirclient/qmirclientdebugextension.h +++ b/src/gui/painting/qicc_p.h @@ -1,9 +1,9 @@ /**************************************************************************** ** -** Copyright (C) 2016 Canonical, Ltd. +** Copyright (C) 2018 The Qt Company Ltd. ** Contact: https://www.qt.io/licensing/ ** -** This file is part of the plugins of the Qt Toolkit. +** This file is part of the QtGui module of the Qt Toolkit. ** ** $QT_BEGIN_LICENSE:LGPL$ ** Commercial License Usage @@ -37,27 +37,34 @@ ** ****************************************************************************/ +#ifndef QICC_P_H +#define QICC_P_H -#ifndef QMIRCLIENTDEBUGEXTENSION_H -#define QMIRCLIENTDEBUGEXTENSION_H +// +// W A R N I N G +// ------------- +// +// This file is not part of the Qt API. It exists purely as an +// implementation detail. This header file may change from version to +// version without notice, or even be removed. +// +// We mean it. +// -#include <QPoint> -#include <QLibrary> -struct MirSurface; +#include <QtCore/qbytearray.h> +#include <QtGui/qtguiglobal.h> -typedef bool (*MapperPrototype)(MirSurface* surface, int x, int y, int* screenX, int* screenY); +QT_BEGIN_NAMESPACE +class QColorSpace; -class QMirClientDebugExtension -{ -public: - QMirClientDebugExtension(); +namespace QIcc { - QPoint mapSurfacePointToScreen(MirSurface *, const QPoint &point); +Q_GUI_EXPORT bool fromIccProfile(const QByteArray &data, QColorSpace *colorSpace); +Q_GUI_EXPORT QByteArray toIccProfile(const QColorSpace &space); -private: - QLibrary m_mirclientDebug; - MapperPrototype m_mapper; -}; +} -#endif // QMIRCLIENTDEBUGEXTENSION_H +QT_END_NAMESPACE + +#endif // QICC_P_H diff --git a/src/gui/painting/qoutlinemapper.cpp b/src/gui/painting/qoutlinemapper.cpp index b2d02182c3..2074f98069 100644 --- a/src/gui/painting/qoutlinemapper.cpp +++ b/src/gui/painting/qoutlinemapper.cpp @@ -42,6 +42,7 @@ #include "qbezier_p.h" #include "qmath.h" #include "qpainterpath_p.h" +#include "qscopedvaluerollback.h" #include <stdlib.h> @@ -354,7 +355,7 @@ void QOutlineMapper::clipElements(const QPointF *elements, // instead of going through convenience functionallity, but since // this part of code hardly every used, it shouldn't matter. - m_in_clip_elements = true; + QScopedValueRollback<bool> in_clip_elements(m_in_clip_elements, true); QPainterPath path; @@ -397,8 +398,6 @@ void QOutlineMapper::clipElements(const QPointF *elements, convertPath(clippedPath); m_transform = oldTransform; } - - m_in_clip_elements = false; } QT_END_NAMESPACE diff --git a/src/gui/painting/qoutlinemapper_p.h b/src/gui/painting/qoutlinemapper_p.h index 71999fbdee..04a68797c2 100644 --- a/src/gui/painting/qoutlinemapper_p.h +++ b/src/gui/painting/qoutlinemapper_p.h @@ -180,13 +180,13 @@ public: QT_FT_Outline *outline() { if (m_valid) return &m_outline; - return 0; + return nullptr; } QT_FT_Outline *convertPath(const QPainterPath &path); QT_FT_Outline *convertPath(const QVectorPath &path); - inline QPainterPath::ElementType *elementTypes() const { return m_element_types.size() == 0 ? 0 : m_element_types.data(); } + inline QPainterPath::ElementType *elementTypes() const { return m_element_types.size() == 0 ? nullptr : m_element_types.data(); } public: QDataBuffer<QPainterPath::ElementType> m_element_types; diff --git a/src/gui/painting/qpaintengine_p.h b/src/gui/painting/qpaintengine_p.h index 8ac3fcff5c..40b9474165 100644 --- a/src/gui/painting/qpaintengine_p.h +++ b/src/gui/painting/qpaintengine_p.h @@ -65,7 +65,7 @@ class Q_GUI_EXPORT QPaintEnginePrivate { Q_DECLARE_PUBLIC(QPaintEngine) public: - QPaintEnginePrivate() : pdev(0), q_ptr(0), currentClipDevice(0), hasSystemTransform(0), + QPaintEnginePrivate() : pdev(nullptr), q_ptr(nullptr), currentClipDevice(nullptr), hasSystemTransform(0), hasSystemViewport(0) {} virtual ~QPaintEnginePrivate(); @@ -138,8 +138,8 @@ public: static QPaintEnginePrivate *get(QPaintEngine *paintEngine) { return paintEngine->d_func(); } - virtual QPaintEngine *aggregateEngine() { return 0; } - virtual Qt::HANDLE nativeHandle() { return 0; } + virtual QPaintEngine *aggregateEngine() { return nullptr; } + virtual Qt::HANDLE nativeHandle() { return nullptr; } }; QT_END_NAMESPACE diff --git a/src/gui/painting/qpaintengine_raster.cpp b/src/gui/painting/qpaintengine_raster.cpp index d3404c6575..afa540380f 100644 --- a/src/gui/painting/qpaintengine_raster.cpp +++ b/src/gui/painting/qpaintengine_raster.cpp @@ -555,35 +555,6 @@ bool QRasterPaintEngine::end() /*! \internal */ -void QRasterPaintEngine::releaseBuffer() -{ - Q_D(QRasterPaintEngine); - d->rasterBuffer.reset(new QRasterBuffer); -} - -/*! - \internal -*/ -QSize QRasterPaintEngine::size() const -{ - Q_D(const QRasterPaintEngine); - return QSize(d->rasterBuffer->width(), d->rasterBuffer->height()); -} - -/*! - \internal -*/ -#ifndef QT_NO_DEBUG -void QRasterPaintEngine::saveBuffer(const QString &s) const -{ - Q_D(const QRasterPaintEngine); - d->rasterBuffer->bufferImage().save(s, "PNG"); -} -#endif - -/*! - \internal -*/ void QRasterPaintEngine::updateMatrix(const QTransform &matrix) { QRasterPaintEngineState *s = state(); @@ -3845,11 +3816,6 @@ QImage::Format QRasterBuffer::prepare(QImage *image) return format; } -void QRasterBuffer::resetBuffer(int val) -{ - memset(m_buffer, val, m_height*bytes_per_line); -} - QClipData::QClipData(int height) { clipSpanHeight = height; @@ -4272,48 +4238,6 @@ static void qt_span_clip(int count, const QSpan *spans, void *userData) } } -#ifndef QT_NO_DEBUG -QImage QRasterBuffer::bufferImage() const -{ - QImage image(m_width, m_height, QImage::Format_ARGB32_Premultiplied); - - for (int y = 0; y < m_height; ++y) { - uint *span = (uint *)const_cast<QRasterBuffer *>(this)->scanLine(y); - - for (int x=0; x<m_width; ++x) { - uint argb = span[x]; - image.setPixel(x, y, argb); - } - } - return image; -} -#endif - - -void QRasterBuffer::flushToARGBImage(QImage *target) const -{ - int w = qMin(m_width, target->width()); - int h = qMin(m_height, target->height()); - - for (int y=0; y<h; ++y) { - uint *sourceLine = (uint *)const_cast<QRasterBuffer *>(this)->scanLine(y); - QRgb *dest = (QRgb *) target->scanLine(y); - for (int x=0; x<w; ++x) { - QRgb pixel = sourceLine[x]; - int alpha = qAlpha(pixel); - if (!alpha) { - dest[x] = 0; - } else { - dest[x] = (alpha << 24) - | ((255*qRed(pixel)/alpha) << 16) - | ((255*qGreen(pixel)/alpha) << 8) - | ((255*qBlue(pixel)/alpha) << 0); - } - } - } -} - - class QGradientCache { public: diff --git a/src/gui/painting/qpaintengine_raster_p.h b/src/gui/painting/qpaintengine_raster_p.h index 881144d1c2..500e0fae54 100644 --- a/src/gui/painting/qpaintengine_raster_p.h +++ b/src/gui/painting/qpaintengine_raster_p.h @@ -208,15 +208,6 @@ public: ClipType clipType() const; QRect clipBoundingRect() const; - void releaseBuffer(); - - QSize size() const; - -#ifndef QT_NO_DEBUG - void saveBuffer(const QString &s) const; -#endif - - #ifdef Q_OS_WIN void setDC(HDC hdc); HDC getDC() const; @@ -435,27 +426,16 @@ inline void QClipData::appendSpans(const QSpan *s, int num) class QRasterBuffer { public: - QRasterBuffer() : m_width(0), m_height(0), m_buffer(0) { init(); } + QRasterBuffer() : m_width(0), m_height(0), m_buffer(nullptr) { init(); } ~QRasterBuffer(); void init(); QImage::Format prepare(QImage *image); - QImage::Format prepare(QPixmap *pix); - void prepare(int w, int h); - void prepareBuffer(int w, int h); - - void resetBuffer(int val=0); uchar *scanLine(int y) { Q_ASSERT(y>=0); Q_ASSERT(y<m_height); return m_buffer + y * bytes_per_line; } -#ifndef QT_NO_DEBUG - QImage bufferImage() const; -#endif - - void flushToARGBImage(QImage *image) const; - int width() const { return m_width; } int height() const { return m_height; } int bytesPerLine() const { return bytes_per_line; } diff --git a/src/gui/painting/qpainter_p.h b/src/gui/painting/qpainter_p.h index 930180e9fa..bd2bc4c9b3 100644 --- a/src/gui/painting/qpainter_p.h +++ b/src/gui/painting/qpainter_p.h @@ -54,6 +54,8 @@ #include <QtCore/qvarlengtharray.h> #include <QtGui/private/qtguiglobal_p.h> #include "QtGui/qbrush.h" +#include "QtGui/qcolorspace.h" +#include "QtGui/qcolortransform.h" #include "QtGui/qfont.h" #include "QtGui/qpen.h" #include "QtGui/qregion.h" @@ -191,9 +193,9 @@ class QPainterPrivate Q_DECLARE_PUBLIC(QPainter) public: QPainterPrivate(QPainter *painter) - : q_ptr(painter), d_ptrs(0), state(0), dummyState(0), txinv(0), inDestructor(false), d_ptrs_size(0), - refcount(1), device(0), original_device(0), helper_device(0), engine(0), emulationEngine(0), - extended(0) + : q_ptr(painter), d_ptrs(nullptr), state(nullptr), dummyState(nullptr), txinv(0), inDestructor(false), d_ptrs_size(0), + refcount(1), device(nullptr), original_device(nullptr), helper_device(nullptr), engine(nullptr), emulationEngine(nullptr), + extended(nullptr) { } diff --git a/src/gui/painting/qpainterpath_p.h b/src/gui/painting/qpainterpath_p.h index a36c8005bc..98056483bc 100644 --- a/src/gui/painting/qpainterpath_p.h +++ b/src/gui/painting/qpainterpath_p.h @@ -168,7 +168,7 @@ public: fillRule(Qt::OddEvenFill), dirtyBounds(false), dirtyControlBounds(false), - pathConverter(0) + pathConverter(nullptr) { require_moveTo = false; convex = false; @@ -181,7 +181,7 @@ public: dirtyBounds(other.dirtyBounds), dirtyControlBounds(other.dirtyControlBounds), convex(other.convex), - pathConverter(0) + pathConverter(nullptr) { require_moveTo = false; elements = other.elements; diff --git a/src/gui/painting/qpathclipper_p.h b/src/gui/painting/qpathclipper_p.h index c25a479807..9444a87b71 100644 --- a/src/gui/painting/qpathclipper_p.h +++ b/src/gui/painting/qpathclipper_p.h @@ -82,7 +82,7 @@ public: bool intersect(); bool contains(); - static bool pathToRect(const QPainterPath &path, QRectF *rect = 0); + static bool pathToRect(const QPainterPath &path, QRectF *rect = nullptr); static QPainterPath intersect(const QPainterPath &path, const QRectF &rect); private: @@ -394,7 +394,7 @@ inline const QPathSegments::Intersection *QPathSegments::intersectionAt(int inde { const int intersection = m_segments.at(index).intersection; if (intersection < 0) - return 0; + return nullptr; else return &m_intersections.at(intersection); } @@ -428,12 +428,12 @@ inline int QWingedEdge::edgeCount() const inline QPathEdge *QWingedEdge::edge(int edge) { - return edge < 0 ? 0 : &m_edges.at(edge); + return edge < 0 ? nullptr : &m_edges.at(edge); } inline const QPathEdge *QWingedEdge::edge(int edge) const { - return edge < 0 ? 0 : &m_edges.at(edge); + return edge < 0 ? nullptr : &m_edges.at(edge); } inline int QWingedEdge::vertexCount() const @@ -449,12 +449,12 @@ inline int QWingedEdge::addVertex(const QPointF &p) inline QPathVertex *QWingedEdge::vertex(int vertex) { - return vertex < 0 ? 0 : &m_vertices.at(vertex); + return vertex < 0 ? nullptr : &m_vertices.at(vertex); } inline const QPathVertex *QWingedEdge::vertex(int vertex) const { - return vertex < 0 ? 0 : &m_vertices.at(vertex); + return vertex < 0 ? nullptr : &m_vertices.at(vertex); } inline QPathEdge::Traversal QWingedEdge::flip(QPathEdge::Traversal traversal) diff --git a/src/gui/painting/qpdf.cpp b/src/gui/painting/qpdf.cpp index 6bdc82a8e9..25d488961c 100644 --- a/src/gui/painting/qpdf.cpp +++ b/src/gui/painting/qpdf.cpp @@ -1671,19 +1671,19 @@ int QPdfEnginePrivate::writeXmpMetaData() const QDateTime now = QDateTime::currentDateTime(); const QDate date = now.date(); const QTime time = now.time(); - - QString timeStr; - timeStr.sprintf("%d-%02d-%02dT%02d:%02d:%02d", date.year(), date.month(), date.day(), - time.hour(), time.minute(), time.second()); + const QString timeStr = + QString::asprintf("%d-%02d-%02dT%02d:%02d:%02d", + date.year(), date.month(), date.day(), + time.hour(), time.minute(), time.second()); const int offset = now.offsetFromUtc(); const int hours = (offset / 60) / 60; const int mins = (offset / 60) % 60; QString tzStr; if (offset < 0) - tzStr.sprintf("-%02d:%02d", -hours, -mins); + tzStr = QString::asprintf("-%02d:%02d", -hours, -mins); else if (offset > 0) - tzStr.sprintf("+%02d:%02d", hours , mins); + tzStr = QString::asprintf("+%02d:%02d", hours , mins); else tzStr = QLatin1String("Z"); diff --git a/src/gui/painting/qpdfwriter.cpp b/src/gui/painting/qpdfwriter.cpp index 258939a763..7f18ce42be 100644 --- a/src/gui/painting/qpdfwriter.cpp +++ b/src/gui/painting/qpdfwriter.cpp @@ -379,6 +379,9 @@ int QPdfWriter::resolution() const */ #endif +#if QT_DEPRECATED_SINCE(5, 14) +QT_WARNING_PUSH +QT_WARNING_DISABLE_DEPRECATED /*! \reimp @@ -404,6 +407,8 @@ void QPdfWriter::setPageSizeMM(const QSizeF &size) { setPageSize(QPageSize(size, QPageSize::Millimeter)); } +QT_WARNING_POP +#endif /*! \internal @@ -427,6 +432,9 @@ bool QPdfWriter::newPage() } +#if QT_DEPRECATED_SINCE(5, 14) +QT_WARNING_PUSH +QT_WARNING_DISABLE_DEPRECATED /*! \reimp @@ -438,6 +446,8 @@ void QPdfWriter::setMargins(const Margins &m) { setPageMargins(QMarginsF(m.left, m.top, m.right, m.bottom), QPageLayout::Millimeter); } +QT_WARNING_POP +#endif QT_END_NAMESPACE diff --git a/src/gui/painting/qpdfwriter.h b/src/gui/painting/qpdfwriter.h index b260805b2b..668081e008 100644 --- a/src/gui/painting/qpdfwriter.h +++ b/src/gui/painting/qpdfwriter.h @@ -86,10 +86,14 @@ public: using QPagedPaintDevice::setPageSize; #endif +#if QT_DEPRECATED_SINCE(5, 14) + QT_DEPRECATED_X("Use setPageSize(QPageSize(id)) instead") void setPageSize(PageSize size) override; + QT_DEPRECATED_X("Use setPageSize(QPageSize(size, QPageSize::Millimeter)) instead") void setPageSizeMM(const QSizeF &size) override; - + QT_DEPRECATED_X("Use setPageMargins(QMarginsF(l, t, r, b), QPageLayout::Millimeter) instead") void setMargins(const Margins &m) override; +#endif protected: QPaintEngine *paintEngine() const override; diff --git a/src/gui/painting/qplatformbackingstore.h b/src/gui/painting/qplatformbackingstore.h index de5ba964dc..414d2bf0de 100644 --- a/src/gui/painting/qplatformbackingstore.h +++ b/src/gui/painting/qplatformbackingstore.h @@ -85,7 +85,7 @@ public: }; Q_DECLARE_FLAGS(Flags, Flag) - explicit QPlatformTextureList(QObject *parent = 0); + explicit QPlatformTextureList(QObject *parent = nullptr); ~QPlatformTextureList(); int count() const; @@ -99,7 +99,7 @@ public: bool isLocked() const; void appendTexture(void *source, GLuint textureId, const QRect &geometry, - const QRect &clipRect = QRect(), Flags flags = 0); + const QRect &clipRect = QRect(), Flags flags = nullptr); void clear(); Q_SIGNALS: diff --git a/src/gui/painting/qrbtree_p.h b/src/gui/painting/qrbtree_p.h index d3ee23a91c..42e88889a1 100644 --- a/src/gui/painting/qrbtree_p.h +++ b/src/gui/painting/qrbtree_p.h @@ -60,7 +60,7 @@ struct QRBTree { struct Node { - inline Node() : parent(0), left(0), right(0), red(true) { } + inline Node() : parent(nullptr), left(nullptr), right(nullptr), red(true) { } inline ~Node() {if (left) delete left; if (right) delete right;} T data; Node *parent; @@ -69,7 +69,7 @@ struct QRBTree bool red; }; - inline QRBTree() : root(0), freeList(0) { } + inline QRBTree() : root(nullptr), freeList(nullptr) { } inline ~QRBTree(); inline void clear(); @@ -120,7 +120,7 @@ inline QRBTree<T>::~QRBTree() while (freeList) { // Avoid recursively calling the destructor, as this list may become large. Node *next = freeList->right; - freeList->right = 0; + freeList->right = nullptr; delete freeList; freeList = next; } @@ -131,7 +131,7 @@ inline void QRBTree<T>::clear() { if (root) delete root; - root = 0; + root = nullptr; } template <class T> @@ -359,7 +359,7 @@ void QRBTree<T>::detach(Node *node) // call this before removing a node. ref = child; if (child) child->parent = node->parent; - node->left = node->right = node->parent = 0; + node->left = node->right = node->parent = nullptr; } // 'node' must be black. rebalance will reduce the depth of black nodes by one in the sibling tree. @@ -513,7 +513,7 @@ inline void QRBTree<T>::deleteNode(Node *&node) detach(node); node->right = freeList; freeList = node; - node = 0; + node = nullptr; } template <class T> @@ -522,7 +522,7 @@ inline typename QRBTree<T>::Node *QRBTree<T>::newNode() if (freeList) { Node *node = freeList; freeList = freeList->right; - node->parent = node->left = node->right = 0; + node->parent = node->left = node->right = nullptr; node->red = true; return node; } diff --git a/src/gui/painting/qstroker.cpp b/src/gui/painting/qstroker.cpp index c01531caf2..f8f8d72d14 100644 --- a/src/gui/painting/qstroker.cpp +++ b/src/gui/painting/qstroker.cpp @@ -173,15 +173,12 @@ template <class Iterator> bool qt_stroke_side(Iterator *it, QStroker *stroker, bool capFirst, QLineF *startTangent); /******************************************************************************* - * QLineF::angle gives us the smalles angle between two lines. Here we - * want to identify the line's angle direction on the unit circle. + * QLineF::angleTo gives us the angle between two lines with respecting the direction. + * Here we want to identify the line's angle direction on the unit circle. */ static inline qreal adapted_angle_on_x(const QLineF &line) { - qreal angle = line.angle(QLineF(0, 0, 1, 0)); - if (line.dy() > 0) - angle = 360 - angle; - return angle; + return QLineF(0, 0, 1, 0).angleTo(line); } QStrokerOps::QStrokerOps() diff --git a/src/gui/painting/qtextureglyphcache_p.h b/src/gui/painting/qtextureglyphcache_p.h index 3da28872b1..1e83ab46d1 100644 --- a/src/gui/painting/qtextureglyphcache_p.h +++ b/src/gui/painting/qtextureglyphcache_p.h @@ -75,7 +75,7 @@ class Q_GUI_EXPORT QTextureGlyphCache : public QFontEngineGlyphCache { public: QTextureGlyphCache(QFontEngine::GlyphFormat format, const QTransform &matrix) - : QFontEngineGlyphCache(format, matrix), m_current_fontengine(0), + : QFontEngineGlyphCache(format, matrix), m_current_fontengine(nullptr), m_w(0), m_h(0), m_cx(0), m_cy(0), m_currentRowHeight(0) { } diff --git a/src/gui/painting/qvectorpath_p.h b/src/gui/painting/qvectorpath_p.h index 1b649a5d2a..df5772d4cc 100644 --- a/src/gui/painting/qvectorpath_p.h +++ b/src/gui/painting/qvectorpath_p.h @@ -106,7 +106,7 @@ public: // ### Falcon: introduca a struct XY for points so lars is not so confused... QVectorPath(const qreal *points, int count, - const QPainterPath::ElementType *elements = 0, + const QPainterPath::ElementType *elements = nullptr, uint hints = ArbitraryShapeHint) : m_elements(elements), m_points(points), @@ -128,12 +128,12 @@ public: inline bool hasExplicitOpen() const { return m_hints & ExplicitOpen; } inline bool hasWindingFill() const { return m_hints & WindingFill; } - inline void makeCacheable() const { m_hints |= ShouldUseCacheHint; m_cache = 0; } + inline void makeCacheable() const { m_hints |= ShouldUseCacheHint; m_cache = nullptr; } inline uint hints() const { return m_hints; } inline const QPainterPath::ElementType *elements() const { return m_elements; } inline const qreal *points() const { return m_points; } - inline bool isEmpty() const { return m_points == 0; } + inline bool isEmpty() const { return m_points == nullptr; } inline int elementCount() const { return m_count; } inline const QPainterPath convertToPainterPath() const; @@ -165,7 +165,7 @@ public: return e; e = e->next; } - return 0; + return nullptr; } template <typename T> static inline bool isRect(const T *pts, int elementCount) { diff --git a/src/gui/text/qabstracttextdocumentlayout_p.h b/src/gui/text/qabstracttextdocumentlayout_p.h index 191c463dc6..d631ce3197 100644 --- a/src/gui/text/qabstracttextdocumentlayout_p.h +++ b/src/gui/text/qabstracttextdocumentlayout_p.h @@ -59,7 +59,7 @@ QT_BEGIN_NAMESPACE struct QTextObjectHandler { - QTextObjectHandler() : iface(0) {} + QTextObjectHandler() : iface(nullptr) {} QTextObjectInterface *iface; QPointer<QObject> component; }; @@ -71,12 +71,12 @@ public: Q_DECLARE_PUBLIC(QAbstractTextDocumentLayout) inline QAbstractTextDocumentLayoutPrivate() - : paintDevice(0) {} + : paintDevice(nullptr) {} ~QAbstractTextDocumentLayoutPrivate(); inline void setDocument(QTextDocument *doc) { document = doc; - docPrivate = 0; + docPrivate = nullptr; if (doc) docPrivate = doc->docHandle(); } diff --git a/src/gui/text/qcssparser_p.h b/src/gui/text/qcssparser_p.h index 860bbe382a..62578f75e5 100644 --- a/src/gui/text/qcssparser_p.h +++ b/src/gui/text/qcssparser_p.h @@ -467,8 +467,8 @@ struct Q_GUI_EXPORT Declaration Attachment attachmentValue() const; int styleFeaturesValue() const; - bool intValue(int *i, const char *unit = 0) const; - bool realValue(qreal *r, const char *unit = 0) const; + bool intValue(int *i, const char *unit = nullptr) const; + bool realValue(qreal *r, const char *unit = nullptr) const; QSize sizeValue() const; QRect rectValue() const; @@ -584,7 +584,7 @@ struct Q_GUI_EXPORT Selector { QVector<BasicSelector> basicSelectors; int specificity() const; - quint64 pseudoClass(quint64 *negated = 0) const; + quint64 pseudoClass(quint64 *negated = nullptr) const; QString pseudoElement() const; }; QT_CSS_DECLARE_TYPEINFO(Selector, Q_MOVABLE_TYPE) @@ -656,7 +656,7 @@ public: }; QVector<StyleRule> styleRulesForNode(NodePtr node); - QVector<Declaration> declarationsForNode(NodePtr node, const char *extraPseudo = 0); + QVector<Declaration> declarationsForNode(NodePtr node, const char *extraPseudo = nullptr); virtual bool nodeNameEquals(NodePtr node, const QString& nodeName) const; virtual QString attribute(NodePtr node, const QString &name) const = 0; @@ -744,7 +744,7 @@ QT_CSS_DECLARE_TYPEINFO(Symbol, Q_MOVABLE_TYPE) class Q_GUI_EXPORT Scanner { public: - static QString preprocess(const QString &input, bool *hasEscapeSequences = 0); + static QString preprocess(const QString &input, bool *hasEscapeSequences = nullptr); static void scan(const QString &preprocessedInput, QVector<Symbol> *symbols); }; @@ -845,7 +845,7 @@ struct Q_GUI_EXPORT ValueExtractor bool extractGeometry(int *w, int *h, int *minw, int *minh, int *maxw, int *maxh); bool extractPosition(int *l, int *t, int *r, int *b, QCss::Origin *, Qt::Alignment *, QCss::PositionMode *, Qt::Alignment *); - bool extractBox(int *margins, int *paddings, int *spacing = 0); + bool extractBox(int *margins, int *paddings, int *spacing = nullptr); bool extractBorder(int *borders, QBrush *colors, BorderStyle *Styles, QSize *radii); bool extractOutline(int *borders, QBrush *colors, BorderStyle *Styles, QSize *radii, int *offsets); bool extractPalette(QBrush *fg, QBrush *sfg, QBrush *sbg, QBrush *abg); diff --git a/src/gui/text/qdistancefield_p.h b/src/gui/text/qdistancefield_p.h index 31cdf7edd2..1a1b6866a2 100644 --- a/src/gui/text/qdistancefield_p.h +++ b/src/gui/text/qdistancefield_p.h @@ -72,7 +72,7 @@ int Q_GUI_EXPORT QT_DISTANCEFIELD_HIGHGLYPHCOUNT(); class Q_GUI_EXPORT QDistanceFieldData : public QSharedData { public: - QDistanceFieldData() : glyph(0), width(0), height(0), nbytes(0), data(0) {} + QDistanceFieldData() : glyph(0), width(0), height(0), nbytes(0), data(nullptr) {} QDistanceFieldData(const QDistanceFieldData &other); ~QDistanceFieldData(); diff --git a/src/gui/text/qfont.cpp b/src/gui/text/qfont.cpp index a51e98ce85..d54fa22990 100644 --- a/src/gui/text/qfont.cpp +++ b/src/gui/text/qfont.cpp @@ -3164,7 +3164,104 @@ void QFontCache::decreaseCache() #ifndef QT_NO_DEBUG_STREAM QDebug operator<<(QDebug stream, const QFont &font) { - return stream << "QFont(" << font.toString() << ')'; + QDebugStateSaver saver(stream); + stream.nospace().noquote(); + stream << "QFont("; + + if (stream.verbosity() == QDebug::DefaultVerbosity) { + stream << font.toString() << ")"; + return stream; + } + + QString fontDescription; + QDebug debug(&fontDescription); + debug.nospace(); + + QFontPrivate priv; + const QFont defaultFont(&priv); + + for (int property = QFont::FamilyResolved; property < QFont::AllPropertiesResolved; property <<= 1) { + const bool resolved = (font.resolve_mask & property) != 0; + if (!resolved && stream.verbosity() == QDebug::MinimumVerbosity) + continue; + + #define QFONT_DEBUG_SKIP_DEFAULT(prop) \ + if ((font.prop() == defaultFont.prop()) && stream.verbosity() == 1) \ + continue; + + QDebugStateSaver saver(debug); + + switch (property) { + case QFont::FamilyResolved: + debug << font.family(); break; + case QFont::SizeResolved: + if (font.pointSizeF() >= 0) + debug << font.pointSizeF() << "pt"; + else if (font.pixelSize() >= 0) + debug << font.pixelSize() << "px"; + else + Q_UNREACHABLE(); + break; + case QFont::StyleHintResolved: + QFONT_DEBUG_SKIP_DEFAULT(styleHint); + debug.verbosity(1) << font.styleHint(); break; + case QFont::StyleStrategyResolved: + QFONT_DEBUG_SKIP_DEFAULT(styleStrategy); + debug.verbosity(1) << font.styleStrategy(); break; + case QFont::WeightResolved: + debug.verbosity(1) << QFont::Weight(font.weight()); break; + case QFont::StyleResolved: + QFONT_DEBUG_SKIP_DEFAULT(style); + debug.verbosity(0) << font.style(); break; + case QFont::UnderlineResolved: + QFONT_DEBUG_SKIP_DEFAULT(underline); + debug << "underline=" << font.underline(); break; + case QFont::OverlineResolved: + QFONT_DEBUG_SKIP_DEFAULT(overline); + debug << "overline=" << font.overline(); break; + case QFont::StrikeOutResolved: + QFONT_DEBUG_SKIP_DEFAULT(strikeOut); + debug << "strikeOut=" << font.strikeOut(); break; + case QFont::FixedPitchResolved: + QFONT_DEBUG_SKIP_DEFAULT(fixedPitch); + debug << "fixedPitch=" << font.fixedPitch(); break; + case QFont::StretchResolved: + QFONT_DEBUG_SKIP_DEFAULT(stretch); + debug.verbosity(0) << QFont::Stretch(font.stretch()); break; + case QFont::KerningResolved: + QFONT_DEBUG_SKIP_DEFAULT(kerning); + debug << "kerning=" << font.kerning(); break; + case QFont::CapitalizationResolved: + QFONT_DEBUG_SKIP_DEFAULT(capitalization); + debug.verbosity(0) << font.capitalization(); break; + case QFont::LetterSpacingResolved: + QFONT_DEBUG_SKIP_DEFAULT(letterSpacing); + debug << "letterSpacing=" << font.letterSpacing(); + debug.verbosity(0) << " (" << font.letterSpacingType() << ")"; + break; + case QFont::HintingPreferenceResolved: + QFONT_DEBUG_SKIP_DEFAULT(hintingPreference); + debug.verbosity(0) << font.hintingPreference(); break; + case QFont::StyleNameResolved: + QFONT_DEBUG_SKIP_DEFAULT(styleName); + debug << "styleName=" << font.styleName(); break; + default: + continue; + }; + + #undef QFONT_DEBUG_SKIP_DEFAULT + + debug << ", "; + } + + if (stream.verbosity() > QDebug::MinimumVerbosity) + debug.verbosity(0) << "resolveMask=" << QFlags<QFont::ResolveProperties>(font.resolve_mask); + else + fontDescription.chop(2); // Last ', ' + + stream << fontDescription << ')'; + + return stream; } #endif diff --git a/src/gui/text/qfont.h b/src/gui/text/qfont.h index e86f06353a..35ef798275 100644 --- a/src/gui/text/qfont.h +++ b/src/gui/text/qfont.h @@ -147,6 +147,7 @@ public: Q_ENUM(SpacingType) enum ResolveProperties { + NoPropertiesResolved = 0x0000, FamilyResolved = 0x0001, SizeResolved = 0x0002, StyleHintResolved = 0x0004, @@ -167,6 +168,7 @@ public: FamiliesResolved = 0x20000, AllPropertiesResolved = 0x3ffff }; + Q_ENUM(ResolveProperties) QFont(); QFont(const QString &family, int pointSize = -1, int weight = -1, bool italic = false); @@ -335,6 +337,10 @@ private: friend Q_GUI_EXPORT QDataStream &operator>>(QDataStream &, QFont &); #endif +#ifndef QT_NO_DEBUG_STREAM + friend Q_GUI_EXPORT QDebug operator<<(QDebug, const QFont &); +#endif + QExplicitlySharedDataPointer<QFontPrivate> d; uint resolve_mask; }; diff --git a/src/gui/text/qfont_p.h b/src/gui/text/qfont_p.h index e86ec31e47..6156faa788 100644 --- a/src/gui/text/qfont_p.h +++ b/src/gui/text/qfont_p.h @@ -266,7 +266,7 @@ public: // QFontEngine cache struct Engine { - Engine() : data(0), timestamp(0), hits(0) { } + Engine() : data(nullptr), timestamp(0), hits(0) { } Engine(QFontEngine *d) : data(d), timestamp(0), hits(0) { } QFontEngine *data; diff --git a/src/gui/text/qfontengine_p.h b/src/gui/text/qfontengine_p.h index 708c79c2ae..05c6746185 100644 --- a/src/gui/text/qfontengine_p.h +++ b/src/gui/text/qfontengine_p.h @@ -194,7 +194,7 @@ public: virtual QImage *lockedAlphaMapForGlyph(glyph_t glyph, QFixed subPixelPosition, GlyphFormat neededFormat, const QTransform &t = QTransform(), - QPoint *offset = 0); + QPoint *offset = nullptr); virtual void unlockAlphaMapForGlyph(); virtual bool hasInternalCaching() const { return false; } @@ -224,7 +224,7 @@ public: virtual qreal minLeftBearing() const; virtual qreal minRightBearing() const; - virtual void getGlyphBearings(glyph_t glyph, qreal *leftBearing = 0, qreal *rightBearing = 0); + virtual void getGlyphBearings(glyph_t glyph, qreal *leftBearing = nullptr, qreal *rightBearing = nullptr); inline bool canRender(uint ucs4) const { return glyphIndex(ucs4) != 0; } virtual bool canRender(const QChar *str, int len) const; @@ -234,7 +234,7 @@ public: virtual int glyphCount() const; virtual int glyphMargin(GlyphFormat format) { return format == Format_A32 ? 2 : 0; } - virtual QFontEngine *cloneWithSize(qreal /*pixelSize*/) const { return 0; } + virtual QFontEngine *cloneWithSize(qreal /*pixelSize*/) const { return nullptr; } virtual Qt::HANDLE handle() const; @@ -458,7 +458,7 @@ public: virtual void recalcAdvances(QGlyphLayout *, ShaperFlags) const override; virtual void doKerning(QGlyphLayout *, ShaperFlags) const override; virtual void addOutlineToPath(qreal, qreal, const QGlyphLayout &, QPainterPath *, QTextItem::RenderFlags flags) override; - virtual void getGlyphBearings(glyph_t glyph, qreal *leftBearing = 0, qreal *rightBearing = 0) override; + virtual void getGlyphBearings(glyph_t glyph, qreal *leftBearing = nullptr, qreal *rightBearing = nullptr) override; virtual QFixed ascent() const override; virtual QFixed capHeight() const override; diff --git a/src/gui/text/qfragmentmap_p.h b/src/gui/text/qfragmentmap_p.h index 35f60ac961..1d781352f8 100644 --- a/src/gui/text/qfragmentmap_p.h +++ b/src/gui/text/qfragmentmap_p.h @@ -216,7 +216,7 @@ private: template <class Fragment> QFragmentMapData<Fragment>::QFragmentMapData() - : fragments(0) + : fragments(nullptr) { init(); } diff --git a/src/gui/text/qglyphrun_p.h b/src/gui/text/qglyphrun_p.h index 5b6bdad648..465c3c7000 100644 --- a/src/gui/text/qglyphrun_p.h +++ b/src/gui/text/qglyphrun_p.h @@ -65,7 +65,7 @@ class QGlyphRunPrivate: public QSharedData { public: QGlyphRunPrivate() - : flags(0) + : flags(nullptr) , glyphIndexData(glyphIndexes.constData()) , glyphIndexDataSize(0) , glyphPositionData(glyphPositions.constData()) diff --git a/src/gui/text/qrawfont_p.h b/src/gui/text/qrawfont_p.h index 0fc8739bfb..dced165475 100644 --- a/src/gui/text/qrawfont_p.h +++ b/src/gui/text/qrawfont_p.h @@ -67,9 +67,9 @@ class Q_GUI_EXPORT QRawFontPrivate { public: QRawFontPrivate() - : fontEngine(0) + : fontEngine(nullptr) , hintingPreference(QFont::PreferDefaultHinting) - , thread(0) + , thread(nullptr) {} QRawFontPrivate(const QRawFontPrivate &other) @@ -78,9 +78,9 @@ public: , thread(other.thread) { #ifndef QT_NO_DEBUG - Q_ASSERT(fontEngine == 0 || thread == QThread::currentThread()); + Q_ASSERT(fontEngine == nullptr || thread == QThread::currentThread()); #endif - if (fontEngine != 0) + if (fontEngine != nullptr) fontEngine->ref.ref(); } @@ -94,37 +94,37 @@ public: inline void cleanUp() { - setFontEngine(0); + setFontEngine(nullptr); hintingPreference = QFont::PreferDefaultHinting; } inline bool isValid() const { #ifndef QT_NO_DEBUG - Q_ASSERT(fontEngine == 0 || thread == QThread::currentThread()); + Q_ASSERT(fontEngine == nullptr || thread == QThread::currentThread()); #endif - return fontEngine != 0; + return fontEngine != nullptr; } inline void setFontEngine(QFontEngine *engine) { #ifndef QT_NO_DEBUG - Q_ASSERT(fontEngine == 0 || thread == QThread::currentThread()); + Q_ASSERT(fontEngine == nullptr || thread == QThread::currentThread()); #endif if (fontEngine == engine) return; - if (fontEngine != 0) { + if (fontEngine != nullptr) { if (!fontEngine->ref.deref()) delete fontEngine; #ifndef QT_NO_DEBUG - thread = 0; + thread = nullptr; #endif } fontEngine = engine; - if (fontEngine != 0) { + if (fontEngine != nullptr) { fontEngine->ref.ref(); #ifndef QT_NO_DEBUG thread = QThread::currentThread(); diff --git a/src/gui/text/qstatictext_p.h b/src/gui/text/qstatictext_p.h index 4ec09297c5..8d6792216d 100644 --- a/src/gui/text/qstatictext_p.h +++ b/src/gui/text/qstatictext_p.h @@ -80,7 +80,7 @@ class Q_GUI_EXPORT QStaticTextItem public: QStaticTextItem() : useBackendOptimizations(false), userDataNeedsUpdate(0), usesRawFont(0), - m_fontEngine(0), m_userData(0) {} + m_fontEngine(nullptr), m_userData(nullptr) {} void setUserData(QStaticTextUserData *newUserData) { diff --git a/src/gui/text/qsyntaxhighlighter.cpp b/src/gui/text/qsyntaxhighlighter.cpp index 102a776ed3..cf584f6980 100644 --- a/src/gui/text/qsyntaxhighlighter.cpp +++ b/src/gui/text/qsyntaxhighlighter.cpp @@ -45,6 +45,7 @@ #include <private/qtextdocument_p.h> #include <qtextlayout.h> #include <qpointer.h> +#include <qscopedvaluerollback.h> #include <qtextobject.h> #include <qtextcursor.h> #include <qdebug.h> @@ -68,14 +69,14 @@ public: void reformatBlocks(int from, int charsRemoved, int charsAdded); void reformatBlock(const QTextBlock &block); - inline void rehighlight(QTextCursor &cursor, QTextCursor::MoveOperation operation) { - inReformatBlocks = true; + inline void rehighlight(QTextCursor &cursor, QTextCursor::MoveOperation operation) + { + QScopedValueRollback<bool> bg(inReformatBlocks, true); cursor.beginEditBlock(); int from = cursor.position(); cursor.movePosition(operation); reformatBlocks(from, 0, cursor.position() - from); cursor.endEditBlock(); - inReformatBlocks = false; } inline void _q_delayedRehighlight() { diff --git a/src/gui/text/qtextdocument_p.cpp b/src/gui/text/qtextdocument_p.cpp index c0a0c1a177..0e3c8d0e83 100644 --- a/src/gui/text/qtextdocument_p.cpp +++ b/src/gui/text/qtextdocument_p.cpp @@ -40,6 +40,7 @@ #include <private/qtools_p.h> #include <qdebug.h> +#include <qscopedvaluerollback.h> #include "qtextdocument_p.h" #include "qtextdocument.h" #include <qtextformat.h> @@ -274,9 +275,10 @@ void QTextDocumentPrivate::clear() rtFrame = 0; init(); cursors = oldCursors; - inContentsChange = true; - emit q->contentsChange(0, len, 0); - inContentsChange = false; + { + QScopedValueRollback<bool> bg(inContentsChange, true); + emit q->contentsChange(0, len, 0); + } if (lout) lout->documentChanged(0, len, 0); } QT_CATCH(...) { @@ -309,9 +311,10 @@ void QTextDocumentPrivate::setLayout(QAbstractTextDocumentLayout *layout) it->free(); emit q->documentLayoutChanged(); - inContentsChange = true; - emit q->contentsChange(0, 0, length()); - inContentsChange = false; + { + QScopedValueRollback<bool> bg(inContentsChange, true); + emit q->contentsChange(0, 0, length()); + } if (lout) lout->documentChanged(0, 0, length()); } @@ -1213,9 +1216,8 @@ void QTextDocumentPrivate::finishEdit() if (lout && docChangeFrom >= 0) { if (!inContentsChange) { - inContentsChange = true; + QScopedValueRollback<bool> bg(inContentsChange, true); emit q->contentsChange(docChangeFrom, docChangeOldLength, docChangeLength); - inContentsChange = false; } lout->documentChanged(docChangeFrom, docChangeOldLength, docChangeLength); } diff --git a/src/gui/text/qtextdocument_p.h b/src/gui/text/qtextdocument_p.h index cad9131fbf..a8e17bfc08 100644 --- a/src/gui/text/qtextdocument_p.h +++ b/src/gui/text/qtextdocument_p.h @@ -101,10 +101,10 @@ class QTextBlockData : public QFragment<3> { public: inline void initialize() - { layout = 0; userData = 0; userState = -1; revision = 0; hidden = 0; } + { layout = nullptr; userData = nullptr; userState = -1; revision = 0; hidden = 0; } void invalidate() const; inline void free() - { delete layout; layout = 0; delete userData; userData = 0; } + { delete layout; layout = nullptr; delete userData; userData = nullptr; } mutable int format; // ##### probably store a QTextEngine * here! @@ -339,6 +339,7 @@ private: int lastBlockCount; public: + bool inContentsChange; QTextOption defaultTextOption; Qt::CursorMoveStyle defaultCursorMoveStyle; #ifndef QT_NO_CSSPARSER @@ -346,7 +347,6 @@ public: #endif int maximumBlockCount; uint needsEnsureMaximumBlockCount : 1; - uint inContentsChange : 1; uint blockCursorAdjustment : 1; QSizeF pageSize; QString title; diff --git a/src/gui/text/qtextdocumentfragment_p.h b/src/gui/text/qtextdocumentfragment_p.h index de01a02fbb..67b0c2c600 100644 --- a/src/gui/text/qtextdocumentfragment_p.h +++ b/src/gui/text/qtextdocumentfragment_p.h @@ -125,7 +125,7 @@ public: QTextHtmlImporter(QTextDocument *_doc, const QString &html, ImportMode mode, - const QTextDocument *resourceProvider = 0); + const QTextDocument *resourceProvider = nullptr); void import(); @@ -163,7 +163,7 @@ private: #endif struct TableCellIterator { - inline TableCellIterator(QTextTable *t = 0) : table(t), row(0), column(0) {} + inline TableCellIterator(QTextTable *t = nullptr) : table(t), row(0), column(0) {} inline TableCellIterator &operator++() { if (atEnd()) @@ -182,7 +182,7 @@ private: return *this; } - inline bool atEnd() const { return table == 0 || row >= table->rows(); } + inline bool atEnd() const { return table == nullptr || row >= table->rows(); } QTextTableCell cell() const { return table->cellAt(row, column); } diff --git a/src/gui/text/qtextengine_p.h b/src/gui/text/qtextengine_p.h index e9187ea605..fb2e812183 100644 --- a/src/gui/text/qtextengine_p.h +++ b/src/gui/text/qtextengine_p.h @@ -304,8 +304,8 @@ class QTextItemInt : public QTextItem { public: inline QTextItemInt() - : justified(false), underlineStyle(QTextCharFormat::NoUnderline), num_chars(0), chars(0), - logClusters(0), f(0), fontEngine(0) + : justified(false), underlineStyle(QTextCharFormat::NoUnderline), num_chars(0), chars(nullptr), + logClusters(nullptr), f(nullptr), fontEngine(nullptr) {} QTextItemInt(const QScriptItem &si, QFont *font, const QTextCharFormat &format = QTextCharFormat()); QTextItemInt(const QGlyphLayout &g, QFont *font, const QChar *chars, int numChars, QFontEngine *fe, @@ -484,7 +484,7 @@ public: return end - si->position; } - QFontEngine *fontEngine(const QScriptItem &si, QFixed *ascent = 0, QFixed *descent = 0, QFixed *leading = 0) const; + QFontEngine *fontEngine(const QScriptItem &si, QFixed *ascent = nullptr, QFixed *descent = nullptr, QFixed *leading = nullptr) const; QFont font(const QScriptItem &si) const; inline QFont font() const { return fnt; } @@ -530,7 +530,7 @@ public: inline QTextFormatCollection *formatCollection() const { if (block.docHandle()) return block.docHandle()->formatCollection(); - return specialData ? specialData->formatCollection.data() : 0; + return specialData ? specialData->formatCollection.data() : nullptr; } QTextCharFormat format(const QScriptItem *si) const; inline QAbstractTextDocumentLayout *docLayout() const { @@ -553,8 +553,8 @@ private: mutable int prevPosition; mutable int prevLength; inline void reset() { - prevFontEngine = 0; - prevScaledFontEngine = 0; + prevFontEngine = nullptr; + prevScaledFontEngine = nullptr; prevScript = -1; prevPosition = -1; prevLength = -1; @@ -684,7 +684,7 @@ Q_DECLARE_TYPEINFO(QTextEngine::ItemDecoration, Q_MOVABLE_TYPE); struct QTextLineItemIterator { QTextLineItemIterator(QTextEngine *eng, int lineNum, const QPointF &pos = QPointF(), - const QTextLayout::FormatRange *_selection = 0); + const QTextLayout::FormatRange *_selection = nullptr); inline bool atEnd() const { return logicalItem >= nItems - 1; } inline bool atBeginning() const { return logicalItem <= 0; } diff --git a/src/gui/text/qtextimagehandler_p.h b/src/gui/text/qtextimagehandler_p.h index 339ef0af4f..fafd394ad3 100644 --- a/src/gui/text/qtextimagehandler_p.h +++ b/src/gui/text/qtextimagehandler_p.h @@ -65,7 +65,7 @@ class Q_GUI_EXPORT QTextImageHandler : public QObject, Q_OBJECT Q_INTERFACES(QTextObjectInterface) public: - explicit QTextImageHandler(QObject *parent = 0); + explicit QTextImageHandler(QObject *parent = nullptr); virtual QSizeF intrinsicSize(QTextDocument *doc, int posInDocument, const QTextFormat &format) override; virtual void drawObject(QPainter *p, const QRectF &rect, QTextDocument *doc, int posInDocument, const QTextFormat &format) override; diff --git a/src/gui/text/qtextobject_p.h b/src/gui/text/qtextobject_p.h index 81ab023cc3..87c83868da 100644 --- a/src/gui/text/qtextobject_p.h +++ b/src/gui/text/qtextobject_p.h @@ -93,7 +93,7 @@ class QTextFramePrivate : public QTextObjectPrivate Q_DECLARE_PUBLIC(QTextFrame) public: QTextFramePrivate(QTextDocument *doc) - : QTextObjectPrivate(doc), fragment_start(0), fragment_end(0), parentFrame(0), layoutData(0) + : QTextObjectPrivate(doc), fragment_start(0), fragment_end(0), parentFrame(nullptr), layoutData(nullptr) { } virtual void fragmentAdded(QChar type, uint fragment); diff --git a/src/gui/text/qtexttable_p.h b/src/gui/text/qtexttable_p.h index c969e1d5bc..5c05611009 100644 --- a/src/gui/text/qtexttable_p.h +++ b/src/gui/text/qtexttable_p.h @@ -61,7 +61,7 @@ class QTextTablePrivate : public QTextFramePrivate { Q_DECLARE_PUBLIC(QTextTable) public: - QTextTablePrivate(QTextDocument *document) : QTextFramePrivate(document), grid(0), nRows(0), nCols(0), dirty(true), blockFragmentUpdates(false) {} + QTextTablePrivate(QTextDocument *document) : QTextFramePrivate(document), grid(nullptr), nRows(0), nCols(0), dirty(true), blockFragmentUpdates(false) {} ~QTextTablePrivate(); static QTextTable *createTable(QTextDocumentPrivate *, int pos, int rows, int cols, const QTextTableFormat &tableFormat); diff --git a/src/gui/util/qgridlayoutengine_p.h b/src/gui/util/qgridlayoutengine_p.h index 5f0cc5da73..5f0e84edb1 100644 --- a/src/gui/util/qgridlayoutengine_p.h +++ b/src/gui/util/qgridlayoutengine_p.h @@ -180,7 +180,7 @@ public: t = &q_minimumAscent; break; default: - t = 0; + t = nullptr; break; } return *t; @@ -205,7 +205,7 @@ public: t = &q_minimumAscent; break; default: - t = 0; + t = nullptr; break; } return *t; @@ -276,7 +276,7 @@ class Q_GUI_EXPORT QGridLayoutItem { public: QGridLayoutItem(int row, int column, int rowSpan = 1, int columnSpan = 1, - Qt::Alignment alignment = 0); + Qt::Alignment alignment = nullptr); virtual ~QGridLayoutItem() {} inline int firstRow() const { return q_firstRows[Ver]; } @@ -339,7 +339,7 @@ private: class Q_GUI_EXPORT QGridLayoutEngine { public: - QGridLayoutEngine(Qt::Alignment defaultAlignment = Qt::Alignment(0), bool snapToPixelGrid = false); + QGridLayoutEngine(Qt::Alignment defaultAlignment = Qt::Alignment(nullptr), bool snapToPixelGrid = false); inline ~QGridLayoutEngine() { qDeleteAll(q_items); } int rowCount(Qt::Orientation orientation) const; diff --git a/src/gui/util/qvalidator.h b/src/gui/util/qvalidator.h index cc7cbcb559..f0e72e3814 100644 --- a/src/gui/util/qvalidator.h +++ b/src/gui/util/qvalidator.h @@ -69,6 +69,7 @@ public: Intermediate, Acceptable }; + Q_ENUM(State) void setLocale(const QLocale &locale); QLocale locale() const; diff --git a/src/gui/vulkan/qvulkanwindow_p.h b/src/gui/vulkan/qvulkanwindow_p.h index c6a772bc31..fb374a5564 100644 --- a/src/gui/vulkan/qvulkanwindow_p.h +++ b/src/gui/vulkan/qvulkanwindow_p.h @@ -97,7 +97,7 @@ public: int physDevIndex = 0; QVector<VkPhysicalDevice> physDevs; QVector<VkPhysicalDeviceProperties> physDevProps; - QVulkanWindow::Flags flags = 0; + QVulkanWindow::Flags flags = nullptr; QByteArrayList requestedDevExtensions; QHash<VkPhysicalDevice, QVulkanInfoVector<QVulkanExtension> > supportedDevExtensions; QVector<VkFormat> requestedColorFormats; diff --git a/src/network/access/qftp_p.h b/src/network/access/qftp_p.h index 0516c3d1f9..91d78d1351 100644 --- a/src/network/access/qftp_p.h +++ b/src/network/access/qftp_p.h @@ -67,7 +67,7 @@ class Q_AUTOTEST_EXPORT QFtp : public QObject Q_OBJECT public: - explicit QFtp(QObject *parent = 0); + explicit QFtp(QObject *parent = nullptr); virtual ~QFtp(); enum State { @@ -118,7 +118,7 @@ public: int setTransferMode(TransferMode mode); int list(const QString &dir = QString()); int cd(const QString &dir); - int get(const QString &file, QIODevice *dev=0, TransferType type = Binary); + int get(const QString &file, QIODevice *dev=nullptr, TransferType type = Binary); int put(const QByteArray &data, const QString &file, TransferType type = Binary); int put(QIODevice *dev, const QString &file, TransferType type = Binary); int remove(const QString &file); diff --git a/src/network/access/qhttpmultipart_p.h b/src/network/access/qhttpmultipart_p.h index 363e0b346c..ead1eadf3b 100644 --- a/src/network/access/qhttpmultipart_p.h +++ b/src/network/access/qhttpmultipart_p.h @@ -64,7 +64,7 @@ QT_BEGIN_NAMESPACE class QHttpPartPrivate: public QSharedData, public QNetworkHeadersPrivate { public: - inline QHttpPartPrivate() : bodyDevice(0), headerCreated(false), readPointer(0) + inline QHttpPartPrivate() : bodyDevice(nullptr), headerCreated(false), readPointer(0) { } ~QHttpPartPrivate() diff --git a/src/network/access/qhttpnetworkconnection.cpp b/src/network/access/qhttpnetworkconnection.cpp index 681d84fee8..ee1e3cfb8f 100644 --- a/src/network/access/qhttpnetworkconnection.cpp +++ b/src/network/access/qhttpnetworkconnection.cpp @@ -398,11 +398,12 @@ void QHttpNetworkConnectionPrivate::copyCredentials(int fromChannel, QAuthentica { Q_ASSERT(auth); - // NTLM is a multi phase authentication. Copying credentials between authenticators would mess things up. + // NTLM and Negotiate do multi-phase authentication. + // Copying credentialsbetween authenticators would mess things up. if (fromChannel >= 0) { - if (!isProxy && channels[fromChannel].authMethod == QAuthenticatorPrivate::Ntlm) - return; - if (isProxy && channels[fromChannel].proxyAuthMethod == QAuthenticatorPrivate::Ntlm) + const QHttpNetworkConnectionChannel &channel = channels[fromChannel]; + const QAuthenticatorPrivate::Method method = isProxy ? channel.proxyAuthMethod : channel.authMethod; + if (method == QAuthenticatorPrivate::Ntlm || method == QAuthenticatorPrivate::Negotiate) return; } @@ -592,7 +593,7 @@ void QHttpNetworkConnectionPrivate::createAuthorization(QAbstractSocket *socket, if ((channels[i].authMethod != QAuthenticatorPrivate::Ntlm && request.headerField("Authorization").isEmpty()) || channels[i].lastStatus == 401) { QAuthenticatorPrivate *priv = QAuthenticatorPrivate::getPrivate(channels[i].authenticator); if (priv && priv->method != QAuthenticatorPrivate::None) { - QByteArray response = priv->calculateResponse(request.methodName(), request.uri(false)); + QByteArray response = priv->calculateResponse(request.methodName(), request.uri(false), request.url().host()); request.setHeaderField("Authorization", response); channels[i].authenticationCredentialsSent = true; } @@ -604,7 +605,7 @@ void QHttpNetworkConnectionPrivate::createAuthorization(QAbstractSocket *socket, if (!(channels[i].proxyAuthMethod == QAuthenticatorPrivate::Ntlm && channels[i].lastStatus != 407)) { QAuthenticatorPrivate *priv = QAuthenticatorPrivate::getPrivate(channels[i].proxyAuthenticator); if (priv && priv->method != QAuthenticatorPrivate::None) { - QByteArray response = priv->calculateResponse(request.methodName(), request.uri(false)); + QByteArray response = priv->calculateResponse(request.methodName(), request.uri(false), networkProxy.hostName()); request.setHeaderField("Proxy-Authorization", response); channels[i].proxyCredentialsSent = true; } diff --git a/src/network/access/qhttpnetworkconnection_p.h b/src/network/access/qhttpnetworkconnection_p.h index 2bd727e0af..2f3c334248 100644 --- a/src/network/access/qhttpnetworkconnection_p.h +++ b/src/network/access/qhttpnetworkconnection_p.h @@ -101,10 +101,10 @@ public: #ifndef QT_NO_BEARERMANAGEMENT explicit QHttpNetworkConnection(const QString &hostName, quint16 port = 80, bool encrypt = false, ConnectionType connectionType = ConnectionTypeHTTP, - QObject *parent = 0, QSharedPointer<QNetworkSession> networkSession + QObject *parent = nullptr, QSharedPointer<QNetworkSession> networkSession = QSharedPointer<QNetworkSession>()); QHttpNetworkConnection(quint16 channelCount, const QString &hostName, quint16 port = 80, - bool encrypt = false, QObject *parent = 0, + bool encrypt = false, QObject *parent = nullptr, QSharedPointer<QNetworkSession> networkSession = QSharedPointer<QNetworkSession>(), ConnectionType connectionType = ConnectionTypeHTTP); #else diff --git a/src/network/access/qhttpnetworkreply.cpp b/src/network/access/qhttpnetworkreply.cpp index c9c3172304..a8b635c45a 100644 --- a/src/network/access/qhttpnetworkreply.cpp +++ b/src/network/access/qhttpnetworkreply.cpp @@ -444,6 +444,9 @@ QAuthenticatorPrivate::Method QHttpNetworkReplyPrivate::authenticationMethod(boo } else if (method < QAuthenticatorPrivate::DigestMd5 && line.startsWith("digest")) { method = QAuthenticatorPrivate::DigestMd5; + } else if (method < QAuthenticatorPrivate::Negotiate + && line.startsWith("negotiate")) { + method = QAuthenticatorPrivate::Negotiate; } } return method; diff --git a/src/network/access/qhttpnetworkreply_p.h b/src/network/access/qhttpnetworkreply_p.h index 863e21ea3e..12cfe359aa 100644 --- a/src/network/access/qhttpnetworkreply_p.h +++ b/src/network/access/qhttpnetworkreply_p.h @@ -89,7 +89,7 @@ class Q_AUTOTEST_EXPORT QHttpNetworkReply : public QObject, public QHttpNetworkH Q_OBJECT public: - explicit QHttpNetworkReply(const QUrl &url = QUrl(), QObject *parent = 0); + explicit QHttpNetworkReply(const QUrl &url = QUrl(), QObject *parent = nullptr); virtual ~QHttpNetworkReply(); QUrl url() const override; diff --git a/src/network/access/qhttpthreaddelegate_p.h b/src/network/access/qhttpthreaddelegate_p.h index 019a8b8b74..6184b39b30 100644 --- a/src/network/access/qhttpthreaddelegate_p.h +++ b/src/network/access/qhttpthreaddelegate_p.h @@ -82,7 +82,7 @@ class QHttpThreadDelegate : public QObject { Q_OBJECT public: - explicit QHttpThreadDelegate(QObject *parent = 0); + explicit QHttpThreadDelegate(QObject *parent = nullptr); ~QHttpThreadDelegate(); @@ -207,7 +207,7 @@ public: : QNonContiguousByteDevice(), wantDataPending(false), m_amount(0), - m_data(0), + m_data(nullptr), m_atEnd(aE), m_size(s), m_pos(0) @@ -240,12 +240,12 @@ public: // Do nothing, we already sent a wantData signal and wait for results len = 0; } - return 0; + return nullptr; } bool advanceReadPointer(qint64 a) override { - if (m_data == 0) + if (m_data == nullptr) return false; m_amount -= a; @@ -269,7 +269,7 @@ public: bool reset() override { m_amount = 0; - m_data = 0; + m_data = nullptr; m_dataArray.clear(); if (wantDataPending) { diff --git a/src/network/access/qnetworkaccessauthenticationmanager_p.h b/src/network/access/qnetworkaccessauthenticationmanager_p.h index 548675728f..31111ca2a5 100644 --- a/src/network/access/qnetworkaccessauthenticationmanager_p.h +++ b/src/network/access/qnetworkaccessauthenticationmanager_p.h @@ -90,12 +90,12 @@ public: void cacheCredentials(const QUrl &url, const QAuthenticator *auth); QNetworkAuthenticationCredential fetchCachedCredentials(const QUrl &url, - const QAuthenticator *auth = 0); + const QAuthenticator *auth = nullptr); #ifndef QT_NO_NETWORKPROXY void cacheProxyCredentials(const QNetworkProxy &proxy, const QAuthenticator *auth); QNetworkAuthenticationCredential fetchCachedProxyCredentials(const QNetworkProxy &proxy, - const QAuthenticator *auth = 0); + const QAuthenticator *auth = nullptr); #endif void clearCache(); diff --git a/src/network/access/qnetworkdiskcache_p.h b/src/network/access/qnetworkdiskcache_p.h index f7988e7dda..c797e63830 100644 --- a/src/network/access/qnetworkdiskcache_p.h +++ b/src/network/access/qnetworkdiskcache_p.h @@ -67,7 +67,7 @@ class QFile; class QCacheItem { public: - QCacheItem() : file(0) + QCacheItem() : file(nullptr) { } ~QCacheItem() @@ -85,7 +85,7 @@ public: metaData = QNetworkCacheMetaData(); data.close(); delete file; - file = 0; + file = nullptr; } void writeHeader(QFile *device) const; void writeCompressedData(QFile *device) const; diff --git a/src/network/access/qnetworkreplyimpl_p.h b/src/network/access/qnetworkreplyimpl_p.h index f4e8284ab6..4881e84e9c 100644 --- a/src/network/access/qnetworkreplyimpl_p.h +++ b/src/network/access/qnetworkreplyimpl_p.h @@ -74,7 +74,7 @@ class QNetworkReplyImpl: public QNetworkReply { Q_OBJECT public: - QNetworkReplyImpl(QObject *parent = 0); + QNetworkReplyImpl(QObject *parent = nullptr); ~QNetworkReplyImpl(); virtual void abort() override; diff --git a/src/network/bearer/qbearerengine_p.h b/src/network/bearer/qbearerengine_p.h index 5fc2578a78..a5a020a857 100644 --- a/src/network/bearer/qbearerengine_p.h +++ b/src/network/bearer/qbearerengine_p.h @@ -77,7 +77,7 @@ class Q_NETWORK_EXPORT QBearerEngine : public QObject friend class QNetworkConfigurationManagerPrivate; public: - explicit QBearerEngine(QObject *parent = 0); + explicit QBearerEngine(QObject *parent = nullptr); virtual ~QBearerEngine(); virtual bool hasIdentifier(const QString &id) = 0; diff --git a/src/network/bearer/qbearerplugin_p.h b/src/network/bearer/qbearerplugin_p.h index 0cdde3c06c..ac787d0541 100644 --- a/src/network/bearer/qbearerplugin_p.h +++ b/src/network/bearer/qbearerplugin_p.h @@ -68,7 +68,7 @@ class Q_NETWORK_EXPORT QBearerEnginePlugin : public QObject { Q_OBJECT public: - explicit QBearerEnginePlugin(QObject *parent = 0); + explicit QBearerEnginePlugin(QObject *parent = nullptr); virtual ~QBearerEnginePlugin(); virtual QBearerEngine *create(const QString &key) const = 0; diff --git a/src/network/configure.json b/src/network/configure.json index 07d46b790e..56805da7b2 100644 --- a/src/network/configure.json +++ b/src/network/configure.json @@ -199,6 +199,15 @@ ] }, "use": "openssl" + }, + "gssapi": { + "label": "KRB5 GSSAPI support", + "type": "compile", + "test": { + "include": [ "gssapi/gssapi.h" ], + "main": ["gss_ctx_id_t ctx;"], + "qmake": "LIBS += -lgssapi_krb5" + } } }, @@ -261,7 +270,7 @@ "disable": "input.securetransport == 'no' || input.ssl == 'no'", "condition": "config.darwin && (input.openssl == '' || input.openssl == 'no')", "output": [ - "privateFeature", + "publicFeature", { "type": "define", "name": "QT_SECURETRANSPORT" } ] }, @@ -283,7 +292,7 @@ "label": "DTLS", "purpose": "Provides a DTLS implementation", "section": "Networking", - "condition": "features.openssl && tests.dtls", + "condition": "features.openssl && features.udpsocket && tests.dtls", "output": [ "publicFeature" ] }, "ocsp": { @@ -374,6 +383,20 @@ "purpose": "Provides API for DNS lookups.", "section": "Networking", "output": [ "publicFeature" ] + }, + "gssapi": { + "label": "GSSAPI", + "purpose": "Enable SPNEGO authentication through GSSAPI", + "section": "Networking", + "condition": "!config.win32 && tests.gssapi", + "output": [ "publicFeature", "feature" ] + }, + "sspi": { + "label": "SSPI", + "purpose": "Enable NTLM/SPNEGO authentication through SSPI", + "section": "Networking", + "condition": "config.win32 && !config.winrt", + "output": [ "publicFeature", "feature" ] } }, @@ -433,7 +456,8 @@ For example: "dtls", "ocsp", "sctp", - "system-proxies" + "system-proxies", + "gssapi" ] } ] diff --git a/src/network/kernel/kernel.pri b/src/network/kernel/kernel.pri index 11b80d59d5..f7269e5070 100644 --- a/src/network/kernel/kernel.pri +++ b/src/network/kernel/kernel.pri @@ -68,6 +68,8 @@ mac { !uikit: LIBS_PRIVATE += -framework CoreServices -framework SystemConfiguration } +qtConfig(gssapi): LIBS_PRIVATE += -lgssapi_krb5 + uikit:HEADERS += kernel/qnetworkinterface_uikit_p.h osx:SOURCES += kernel/qnetworkproxy_mac.cpp else:win32:!winrt: SOURCES += kernel/qnetworkproxy_win.cpp diff --git a/src/network/kernel/qauthenticator.cpp b/src/network/kernel/qauthenticator.cpp index 47ce9ab0c6..3ca8806c2b 100644 --- a/src/network/kernel/qauthenticator.cpp +++ b/src/network/kernel/qauthenticator.cpp @@ -54,20 +54,29 @@ #include <qmutex.h> #include <private/qmutexpool_p.h> #include <rpc.h> -#ifndef Q_OS_WINRT +#endif + +#if QT_CONFIG(sspi) // SSPI #define SECURITY_WIN32 1 #include <security.h> -#endif +#elif QT_CONFIG(gssapi) // GSSAPI +#include <gssapi/gssapi.h> #endif QT_BEGIN_NAMESPACE static QByteArray qNtlmPhase1(); static QByteArray qNtlmPhase3(QAuthenticatorPrivate *ctx, const QByteArray& phase2data); -#if defined(Q_OS_WIN) && !defined(Q_OS_WINRT) -static QByteArray qNtlmPhase1_SSPI(QAuthenticatorPrivate *ctx); -static QByteArray qNtlmPhase3_SSPI(QAuthenticatorPrivate *ctx, const QByteArray& phase2data); -#endif +#if QT_CONFIG(sspi) // SSPI +static QByteArray qSspiStartup(QAuthenticatorPrivate *ctx, QAuthenticatorPrivate::Method method, + const QString& host); +static QByteArray qSspiContinue(QAuthenticatorPrivate *ctx, QAuthenticatorPrivate::Method method, + const QString& host, const QByteArray& challenge = QByteArray()); +#elif QT_CONFIG(gssapi) // GSSAPI +static QByteArray qGssapiStartup(QAuthenticatorPrivate *ctx, const QString& host); +static QByteArray qGssapiContinue(QAuthenticatorPrivate *ctx, + const QByteArray& challenge = QByteArray()); +#endif // gssapi /*! \class QAuthenticator @@ -90,6 +99,7 @@ static QByteArray qNtlmPhase3_SSPI(QAuthenticatorPrivate *ctx, const QByteArray& \li Basic \li NTLM version 2 \li Digest-MD5 + \li SPNEGO/Negotiate \endlist \target qauthenticator-options @@ -133,6 +143,10 @@ static QByteArray qNtlmPhase3_SSPI(QAuthenticatorPrivate *ctx, const QByteArray& The Digest-MD5 authentication mechanism supports no outgoing options. + \section2 SPNEGO/Negotiate + + This authentication mechanism currently supports no incoming or outgoing options. + \sa QSslSocket */ @@ -187,7 +201,7 @@ QAuthenticator &QAuthenticator::operator=(const QAuthenticator &other) d->options = other.d->options; } else if (d->phase == QAuthenticatorPrivate::Start) { delete d; - d = 0; + d = nullptr; } return *this; } @@ -339,21 +353,25 @@ bool QAuthenticator::isNull() const return !d; } -#if defined(Q_OS_WIN) && !defined(Q_OS_WINRT) -class QNtlmWindowsHandles +#if QT_CONFIG(sspi) // SSPI +class QSSPIWindowsHandles { public: CredHandle credHandle; CtxtHandle ctxHandle; }; -#endif +#elif QT_CONFIG(gssapi) // GSSAPI +class QGssApiHandles +{ +public: + gss_ctx_id_t gssCtx = nullptr; + gss_name_t targetName; +}; +#endif // gssapi QAuthenticatorPrivate::QAuthenticatorPrivate() : method(None) - #if defined(Q_OS_WIN) && !defined(Q_OS_WINRT) - , ntlmWindowsHandles(0) - #endif , hasFailed(false) , phase(Start) , nonceCount(0) @@ -363,13 +381,7 @@ QAuthenticatorPrivate::QAuthenticatorPrivate() nonceCount = 0; } -QAuthenticatorPrivate::~QAuthenticatorPrivate() -{ -#if defined(Q_OS_WIN) && !defined(Q_OS_WINRT) - if (ntlmWindowsHandles) - delete ntlmWindowsHandles; -#endif -} +QAuthenticatorPrivate::~QAuthenticatorPrivate() = default; void QAuthenticatorPrivate::updateCredentials() { @@ -424,6 +436,9 @@ void QAuthenticatorPrivate::parseHttpResponse(const QList<QPair<QByteArray, QByt } else if (method < DigestMd5 && str.startsWith("digest")) { method = DigestMd5; headerVal = current.second.mid(7); + } else if (method < Negotiate && str.startsWith("negotiate")) { + method = Negotiate; + headerVal = current.second.mid(10); } } @@ -439,6 +454,7 @@ void QAuthenticatorPrivate::parseHttpResponse(const QList<QPair<QByteArray, QByt phase = Done; break; case Ntlm: + case Negotiate: // work is done in calculateResponse() break; case DigestMd5: { @@ -456,33 +472,36 @@ void QAuthenticatorPrivate::parseHttpResponse(const QList<QPair<QByteArray, QByt } } -QByteArray QAuthenticatorPrivate::calculateResponse(const QByteArray &requestMethod, const QByteArray &path) +QByteArray QAuthenticatorPrivate::calculateResponse(const QByteArray &requestMethod, const QByteArray &path, const QString& host) { +#if !QT_CONFIG(sspi) && !QT_CONFIG(gssapi) + Q_UNUSED(host); +#endif QByteArray response; - const char *methodString = 0; + const char* methodString = nullptr; switch(method) { case QAuthenticatorPrivate::None: methodString = ""; phase = Done; break; case QAuthenticatorPrivate::Basic: - methodString = "Basic "; + methodString = "Basic"; response = user.toLatin1() + ':' + password.toLatin1(); response = response.toBase64(); phase = Done; break; case QAuthenticatorPrivate::DigestMd5: - methodString = "Digest "; + methodString = "Digest"; response = digestMd5Response(challenge, requestMethod, path); phase = Done; break; case QAuthenticatorPrivate::Ntlm: - methodString = "NTLM "; + methodString = "NTLM"; if (challenge.isEmpty()) { -#if defined(Q_OS_WIN) && !defined(Q_OS_WINRT) +#if QT_CONFIG(sspi) // SSPI QByteArray phase1Token; if (user.isEmpty()) // Only pull from system if no user was specified in authenticator - phase1Token = qNtlmPhase1_SSPI(this); + phase1Token = qSspiStartup(this, method, host); if (!phase1Token.isEmpty()) { response = phase1Token.toBase64(); phase = Phase2; @@ -496,10 +515,10 @@ QByteArray QAuthenticatorPrivate::calculateResponse(const QByteArray &requestMet phase = Phase2; } } else { -#if defined(Q_OS_WIN) && !defined(Q_OS_WINRT) +#if QT_CONFIG(sspi) // SSPI QByteArray phase3Token; - if (ntlmWindowsHandles) - phase3Token = qNtlmPhase3_SSPI(this, QByteArray::fromBase64(challenge)); + if (sspiWindowsHandles) + phase3Token = qSspiContinue(this, method, host, QByteArray::fromBase64(challenge)); if (!phase3Token.isEmpty()) { response = phase3Token.toBase64(); phase = Done; @@ -512,8 +531,39 @@ QByteArray QAuthenticatorPrivate::calculateResponse(const QByteArray &requestMet } break; + case QAuthenticatorPrivate::Negotiate: + methodString = "Negotiate"; + if (challenge.isEmpty()) { + QByteArray phase1Token; +#if QT_CONFIG(sspi) // SSPI + phase1Token = qSspiStartup(this, method, host); +#elif QT_CONFIG(gssapi) // GSSAPI + phase1Token = qGssapiStartup(this, host); +#endif + + if (!phase1Token.isEmpty()) { + response = phase1Token.toBase64(); + phase = Phase2; + } else { + phase = Done; + } + } else { + QByteArray phase3Token; +#if QT_CONFIG(sspi) // SSPI + phase3Token = qSspiContinue(this, method, host, QByteArray::fromBase64(challenge)); +#elif QT_CONFIG(gssapi) // GSSAPI + phase3Token = qGssapiContinue(this, QByteArray::fromBase64(challenge)); +#endif + if (!phase3Token.isEmpty()) { + response = phase3Token.toBase64(); + phase = Done; + } + } + + break; } - return QByteArray(methodString) + response; + + return QByteArray::fromRawData(methodString, qstrlen(methodString)) + ' ' + response; } @@ -699,9 +749,10 @@ QByteArray QAuthenticatorPrivate::digestMd5Response(const QByteArray &challenge, return credentials; } -// ---------------------------- Digest Md5 code ---------------------------------------- +// ---------------------------- End of Digest Md5 code --------------------------------- +// ---------------------------- NTLM code ---------------------------------------------- /* * NTLM message flags. @@ -1419,156 +1470,237 @@ static QByteArray qNtlmPhase3(QAuthenticatorPrivate *ctx, const QByteArray& phas return rc; } -#if defined(Q_OS_WIN) && !defined(Q_OS_WINRT) +// ---------------------------- End of NTLM code --------------------------------------- + +#if QT_CONFIG(sspi) // SSPI +// ---------------------------- SSPI code ---------------------------------------------- // See http://davenport.sourceforge.net/ntlm.html // and libcurl http_ntlm.c // Handle of secur32.dll -static HMODULE securityDLLHandle = NULL; +static HMODULE securityDLLHandle = nullptr; // Pointer to SSPI dispatch table -static PSecurityFunctionTable pSecurityFunctionTable = NULL; - +static PSecurityFunctionTable pSecurityFunctionTable = nullptr; -static bool q_NTLM_SSPI_library_load() +static bool q_SSPI_library_load() { static QBasicMutex mutex; QMutexLocker l(&mutex); // Initialize security interface - if (pSecurityFunctionTable == NULL) { + if (pSecurityFunctionTable == nullptr) { securityDLLHandle = LoadLibrary(L"secur32.dll"); - if (securityDLLHandle != NULL) { + if (securityDLLHandle != nullptr) { INIT_SECURITY_INTERFACE pInitSecurityInterface = reinterpret_cast<INIT_SECURITY_INTERFACE>( reinterpret_cast<QFunctionPointer>(GetProcAddress(securityDLLHandle, "InitSecurityInterfaceW"))); - if (pInitSecurityInterface != NULL) + if (pInitSecurityInterface != nullptr) pSecurityFunctionTable = pInitSecurityInterface(); } } - if (pSecurityFunctionTable == NULL) + if (pSecurityFunctionTable == nullptr) return false; return true; } -// Phase 1: -static QByteArray qNtlmPhase1_SSPI(QAuthenticatorPrivate *ctx) +static QByteArray qSspiStartup(QAuthenticatorPrivate *ctx, QAuthenticatorPrivate::Method method, + const QString& host) { - QByteArray result; + if (!q_SSPI_library_load()) + return QByteArray(); + + TimeStamp expiry; // For Windows 9x compatibility of SSPI calls - if (!q_NTLM_SSPI_library_load()) - return result; + if (!ctx->sspiWindowsHandles) + ctx->sspiWindowsHandles.reset(new QSSPIWindowsHandles); + memset(&ctx->sspiWindowsHandles->credHandle, 0, sizeof(CredHandle)); - // 1. The client obtains a representation of the credential set - // for the user via the SSPI AcquireCredentialsHandle function. - if (!ctx->ntlmWindowsHandles) - ctx->ntlmWindowsHandles = new QNtlmWindowsHandles; - memset(&ctx->ntlmWindowsHandles->credHandle, 0, sizeof(CredHandle)); - TimeStamp tsDummy; + // Acquire our credentials handle SECURITY_STATUS secStatus = pSecurityFunctionTable->AcquireCredentialsHandle( - NULL, (SEC_WCHAR*)L"NTLM", SECPKG_CRED_OUTBOUND, NULL, NULL, - NULL, NULL, &ctx->ntlmWindowsHandles->credHandle, &tsDummy); + nullptr, + (SEC_WCHAR*)(method == QAuthenticatorPrivate::Negotiate ? L"Negotiate" : L"NTLM"), + SECPKG_CRED_OUTBOUND, nullptr, nullptr, nullptr, nullptr, + &ctx->sspiWindowsHandles->credHandle, &expiry + ); if (secStatus != SEC_E_OK) { - delete ctx->ntlmWindowsHandles; - ctx->ntlmWindowsHandles = 0; - return result; + ctx->sspiWindowsHandles.reset(nullptr); + return QByteArray(); } - // 2. The client calls the SSPI InitializeSecurityContext function - // to obtain an authentication request token (in our case, a Type 1 message). - // The client sends this token to the server. - SecBufferDesc desc; - SecBuffer buf; - desc.ulVersion = SECBUFFER_VERSION; - desc.cBuffers = 1; - desc.pBuffers = &buf; - buf.cbBuffer = 0; - buf.BufferType = SECBUFFER_TOKEN; - buf.pvBuffer = NULL; - ULONG attrs; - - secStatus = pSecurityFunctionTable->InitializeSecurityContext(&ctx->ntlmWindowsHandles->credHandle, NULL, - const_cast<SEC_WCHAR*>(L"") /* host */, - ISC_REQ_ALLOCATE_MEMORY, - 0, SECURITY_NETWORK_DREP, - NULL, 0, - &ctx->ntlmWindowsHandles->ctxHandle, &desc, - &attrs, &tsDummy); - if (secStatus == SEC_I_COMPLETE_AND_CONTINUE || - secStatus == SEC_I_CONTINUE_NEEDED) { - pSecurityFunctionTable->CompleteAuthToken(&ctx->ntlmWindowsHandles->ctxHandle, &desc); - } else if (secStatus != SEC_E_OK) { - if ((const char*)buf.pvBuffer) - pSecurityFunctionTable->FreeContextBuffer(buf.pvBuffer); - pSecurityFunctionTable->FreeCredentialsHandle(&ctx->ntlmWindowsHandles->credHandle); - delete ctx->ntlmWindowsHandles; - ctx->ntlmWindowsHandles = 0; - return result; + return qSspiContinue(ctx, method, host); +} + +static QByteArray qSspiContinue(QAuthenticatorPrivate *ctx, QAuthenticatorPrivate::Method method, + const QString &host, const QByteArray &challenge) +{ + QByteArray result; + SecBuffer challengeBuf; + SecBuffer responseBuf; + SecBufferDesc challengeDesc; + SecBufferDesc responseDesc; + unsigned long attrs; + TimeStamp expiry; // For Windows 9x compatibility of SSPI calls + + if (!challenge.isEmpty()) + { + // Setup the challenge "input" security buffer + challengeDesc.ulVersion = SECBUFFER_VERSION; + challengeDesc.cBuffers = 1; + challengeDesc.pBuffers = &challengeBuf; + challengeBuf.BufferType = SECBUFFER_TOKEN; + challengeBuf.pvBuffer = (PVOID)(challenge.data()); + challengeBuf.cbBuffer = challenge.length(); } - result = QByteArray((const char*)buf.pvBuffer, buf.cbBuffer); - pSecurityFunctionTable->FreeContextBuffer(buf.pvBuffer); + // Setup the response "output" security buffer + responseDesc.ulVersion = SECBUFFER_VERSION; + responseDesc.cBuffers = 1; + responseDesc.pBuffers = &responseBuf; + responseBuf.BufferType = SECBUFFER_TOKEN; + responseBuf.pvBuffer = nullptr; + responseBuf.cbBuffer = 0; + + // Calculate target (SPN for Negotiate, empty for NTLM) + std::wstring targetNameW = (method == QAuthenticatorPrivate::Negotiate + ? QLatin1String("HTTP/") + host : QString()).toStdWString(); + + // Generate our challenge-response message + SECURITY_STATUS secStatus = pSecurityFunctionTable->InitializeSecurityContext( + &ctx->sspiWindowsHandles->credHandle, + !challenge.isEmpty() ? &ctx->sspiWindowsHandles->ctxHandle : nullptr, + const_cast<wchar_t*>(targetNameW.data()), + ISC_REQ_ALLOCATE_MEMORY, + 0, SECURITY_NATIVE_DREP, + !challenge.isEmpty() ? &challengeDesc : nullptr, + 0, &ctx->sspiWindowsHandles->ctxHandle, + &responseDesc, &attrs, + &expiry + ); + + if (secStatus == SEC_I_COMPLETE_NEEDED || secStatus == SEC_I_COMPLETE_AND_CONTINUE) { + secStatus = pSecurityFunctionTable->CompleteAuthToken(&ctx->sspiWindowsHandles->ctxHandle, + &responseDesc); + } + + if (secStatus != SEC_I_COMPLETE_AND_CONTINUE && secStatus != SEC_I_CONTINUE_NEEDED) { + pSecurityFunctionTable->FreeCredentialsHandle(&ctx->sspiWindowsHandles->credHandle); + pSecurityFunctionTable->DeleteSecurityContext(&ctx->sspiWindowsHandles->ctxHandle); + ctx->sspiWindowsHandles.reset(nullptr); + } + + result = QByteArray((const char*)responseBuf.pvBuffer, responseBuf.cbBuffer); + pSecurityFunctionTable->FreeContextBuffer(responseBuf.pvBuffer); + return result; } -// Phase 2: -// 3. The server receives the token from the client, and uses it as input to the -// AcceptSecurityContext SSPI function. This creates a local security context on -// the server to represent the client, and yields an authentication response token -// (the Type 2 message), which is sent to the client. +// ---------------------------- End of SSPI code --------------------------------------- + +#elif QT_CONFIG(gssapi) // GSSAPI + +// ---------------------------- GSSAPI code ---------------------------------------------- +// See postgres src/interfaces/libpq/fe-auth.c + +// Fetch all errors of a specific type +static void q_GSSAPI_error_int(const char *message, OM_uint32 stat, int type) +{ + OM_uint32 minStat, msgCtx = 0; + gss_buffer_desc msg; + + do { + gss_display_status(&minStat, stat, type, GSS_C_NO_OID, &msgCtx, &msg); + qDebug() << message << ": " << reinterpret_cast<const char*>(msg.value); + gss_release_buffer(&minStat, &msg); + } while (msgCtx); +} -// Phase 3: -static QByteArray qNtlmPhase3_SSPI(QAuthenticatorPrivate *ctx, const QByteArray& phase2data) +// GSSAPI errors contain two parts; extract both +static void q_GSSAPI_error(const char *message, OM_uint32 majStat, OM_uint32 minStat) { - // 4. The client receives the response token from the server and calls - // InitializeSecurityContext again, passing the server's token as input. - // This provides us with another authentication request token (the Type 3 message). - // The return value indicates that the security context was successfully initialized; - // the token is sent to the server. + // Fetch major error codes + q_GSSAPI_error_int(message, majStat, GSS_C_GSS_CODE); + // Add the minor codes as well + q_GSSAPI_error_int(message, minStat, GSS_C_MECH_CODE); +} + +// Send initial GSS authentication token +static QByteArray qGssapiStartup(QAuthenticatorPrivate *ctx, const QString &host) +{ + OM_uint32 majStat, minStat; + + if (!ctx->gssApiHandles) + ctx->gssApiHandles.reset(new QGssApiHandles); + + // Convert target name to internal form + QByteArray serviceName = QStringLiteral("HTTPS@%1").arg(host).toLocal8Bit(); + gss_buffer_desc nameDesc = {static_cast<std::size_t>(serviceName.size()), serviceName.data()}; + + majStat = gss_import_name(&minStat, &nameDesc, + GSS_C_NT_HOSTBASED_SERVICE, &ctx->gssApiHandles->targetName); + + if (majStat != GSS_S_COMPLETE) { + q_GSSAPI_error("gss_import_name error", majStat, minStat); + ctx->gssApiHandles.reset(nullptr); + return QByteArray(); + } + + // Call qGssapiContinue with GSS_C_NO_CONTEXT to get initial packet + ctx->gssApiHandles->gssCtx = GSS_C_NO_CONTEXT; + return qGssapiContinue(ctx); +} + +// Continue GSS authentication with next token as needed +static QByteArray qGssapiContinue(QAuthenticatorPrivate *ctx, const QByteArray& challenge) +{ + OM_uint32 majStat, minStat, ignored; QByteArray result; + gss_buffer_desc inBuf = {0, nullptr}; // GSS input token + gss_buffer_desc outBuf; // GSS output token - if (pSecurityFunctionTable == NULL) - return result; - - SecBuffer type_2, type_3; - SecBufferDesc type_2_desc, type_3_desc; - ULONG attrs; - TimeStamp tsDummy; // For Windows 9x compatibility of SPPI calls - - type_2_desc.ulVersion = type_3_desc.ulVersion = SECBUFFER_VERSION; - type_2_desc.cBuffers = type_3_desc.cBuffers = 1; - type_2_desc.pBuffers = &type_2; - type_3_desc.pBuffers = &type_3; - - type_2.BufferType = SECBUFFER_TOKEN; - type_2.pvBuffer = (PVOID)phase2data.data(); - type_2.cbBuffer = phase2data.length(); - type_3.BufferType = SECBUFFER_TOKEN; - type_3.pvBuffer = 0; - type_3.cbBuffer = 0; - - SECURITY_STATUS secStatus = pSecurityFunctionTable->InitializeSecurityContext(&ctx->ntlmWindowsHandles->credHandle, - &ctx->ntlmWindowsHandles->ctxHandle, - const_cast<SEC_WCHAR*>(L"") /* host */, - ISC_REQ_ALLOCATE_MEMORY, - 0, SECURITY_NETWORK_DREP, &type_2_desc, - 0, &ctx->ntlmWindowsHandles->ctxHandle, &type_3_desc, - &attrs, &tsDummy); - - if (secStatus == SEC_E_OK && ((const char*)type_3.pvBuffer)) { - result = QByteArray((const char*)type_3.pvBuffer, type_3.cbBuffer); - pSecurityFunctionTable->FreeContextBuffer(type_3.pvBuffer); + if (!challenge.isEmpty()) { + inBuf.value = const_cast<char*>(challenge.data()); + inBuf.length = challenge.length(); } - pSecurityFunctionTable->FreeCredentialsHandle(&ctx->ntlmWindowsHandles->credHandle); - pSecurityFunctionTable->DeleteSecurityContext(&ctx->ntlmWindowsHandles->ctxHandle); - delete ctx->ntlmWindowsHandles; - ctx->ntlmWindowsHandles = 0; + majStat = gss_init_sec_context(&minStat, + GSS_C_NO_CREDENTIAL, + &ctx->gssApiHandles->gssCtx, + ctx->gssApiHandles->targetName, + GSS_C_NO_OID, + GSS_C_MUTUAL_FLAG, + 0, + GSS_C_NO_CHANNEL_BINDINGS, + challenge.isEmpty() ? GSS_C_NO_BUFFER : &inBuf, + nullptr, + &outBuf, + nullptr, + nullptr); + + if (outBuf.length != 0) + result = QByteArray(reinterpret_cast<const char*>(outBuf.value), outBuf.length); + gss_release_buffer(&ignored, &outBuf); + + if (majStat != GSS_S_COMPLETE && majStat != GSS_S_CONTINUE_NEEDED) { + q_GSSAPI_error("gss_init_sec_context error", majStat, minStat); + gss_release_name(&ignored, &ctx->gssApiHandles->targetName); + if (ctx->gssApiHandles->gssCtx) + gss_delete_sec_context(&ignored, &ctx->gssApiHandles->gssCtx, GSS_C_NO_BUFFER); + ctx->gssApiHandles.reset(nullptr); + } + + if (majStat == GSS_S_COMPLETE) { + gss_release_name(&ignored, &ctx->gssApiHandles->targetName); + ctx->gssApiHandles.reset(nullptr); + } return result; } -#endif // Q_OS_WIN && !Q_OS_WINRT + +// ---------------------------- End of GSSAPI code ---------------------------------------------- + +#endif // gssapi QT_END_NAMESPACE diff --git a/src/network/kernel/qauthenticator_p.h b/src/network/kernel/qauthenticator_p.h index 265cb7afe2..e201d22650 100644 --- a/src/network/kernel/qauthenticator_p.h +++ b/src/network/kernel/qauthenticator_p.h @@ -54,6 +54,7 @@ #include <QtNetwork/private/qtnetworkglobal_p.h> #include <qhash.h> #include <qbytearray.h> +#include <qscopedpointer.h> #include <qstring.h> #include <qauthenticator.h> #include <qvariant.h> @@ -61,14 +62,16 @@ QT_BEGIN_NAMESPACE class QHttpResponseHeader; -#ifdef Q_OS_WIN -class QNtlmWindowsHandles; +#if QT_CONFIG(sspi) // SSPI +class QSSPIWindowsHandles; +#elif QT_CONFIG(gssapi) // GSSAPI +class QGssApiHandles; #endif class Q_AUTOTEST_EXPORT QAuthenticatorPrivate { public: - enum Method { None, Basic, Ntlm, DigestMd5 }; + enum Method { None, Basic, Ntlm, DigestMd5, Negotiate }; QAuthenticatorPrivate(); ~QAuthenticatorPrivate(); @@ -79,8 +82,10 @@ public: Method method; QString realm; QByteArray challenge; -#ifdef Q_OS_WIN - QNtlmWindowsHandles *ntlmWindowsHandles; +#if QT_CONFIG(sspi) // SSPI + QScopedPointer<QSSPIWindowsHandles> sspiWindowsHandles; +#elif QT_CONFIG(gssapi) // GSSAPI + QScopedPointer<QGssApiHandles> gssApiHandles; #endif bool hasFailed; //credentials have been tried but rejected by server. @@ -100,7 +105,7 @@ public: QString workstation; QString userDomain; - QByteArray calculateResponse(const QByteArray &method, const QByteArray &path); + QByteArray calculateResponse(const QByteArray &method, const QByteArray &path, const QString& host); inline static QAuthenticatorPrivate *getPrivate(QAuthenticator &auth) { return auth.d; } inline static const QAuthenticatorPrivate *getPrivate(const QAuthenticator &auth) { return auth.d; } diff --git a/src/network/kernel/qdnslookup_p.h b/src/network/kernel/qdnslookup_p.h index 2dc98e527a..8c3c2ed3e1 100644 --- a/src/network/kernel/qdnslookup_p.h +++ b/src/network/kernel/qdnslookup_p.h @@ -95,7 +95,7 @@ public: QDnsLookupPrivate() : isFinished(false) , type(QDnsLookup::A) - , runnable(0) + , runnable(nullptr) { } void _q_lookupFinished(const QDnsLookupReply &reply); diff --git a/src/network/kernel/qhostinfo_p.h b/src/network/kernel/qhostinfo_p.h index 8cce302166..da02163ddf 100644 --- a/src/network/kernel/qhostinfo_p.h +++ b/src/network/kernel/qhostinfo_p.h @@ -101,7 +101,7 @@ public Q_SLOTS: { if (slotObj) { QHostInfo copy = info; - void *args[2] = { 0, reinterpret_cast<void *>(©) }; + void *args[2] = { nullptr, reinterpret_cast<void *>(©) }; slotObj->call(const_cast<QObject*>(receiver.data()), args); slotObj->destroyIfLastRef(); } else { diff --git a/src/network/kernel/qnetworkinterface_p.h b/src/network/kernel/qnetworkinterface_p.h index 87a46b75fa..44e27a7e34 100644 --- a/src/network/kernel/qnetworkinterface_p.h +++ b/src/network/kernel/qnetworkinterface_p.h @@ -82,7 +82,7 @@ public: class QNetworkInterfacePrivate: public QSharedData { public: - QNetworkInterfacePrivate() : index(0), flags(0) + QNetworkInterfacePrivate() : index(0), flags(nullptr) { } ~QNetworkInterfacePrivate() { } diff --git a/src/network/kernel/qnetworkinterface_unix_p.h b/src/network/kernel/qnetworkinterface_unix_p.h index c085194e3c..553af5a303 100644 --- a/src/network/kernel/qnetworkinterface_unix_p.h +++ b/src/network/kernel/qnetworkinterface_unix_p.h @@ -80,7 +80,7 @@ QT_BEGIN_NAMESPACE static QNetworkInterface::InterfaceFlags convertFlags(uint rawFlags) { - QNetworkInterface::InterfaceFlags flags = 0; + QNetworkInterface::InterfaceFlags flags = nullptr; flags |= (rawFlags & IFF_UP) ? QNetworkInterface::IsUp : QNetworkInterface::InterfaceFlag(0); flags |= (rawFlags & IFF_RUNNING) ? QNetworkInterface::IsRunning : QNetworkInterface::InterfaceFlag(0); flags |= (rawFlags & IFF_BROADCAST) ? QNetworkInterface::CanBroadcast : QNetworkInterface::InterfaceFlag(0); diff --git a/src/network/socket/qabstractsocketengine_p.h b/src/network/socket/qabstractsocketengine_p.h index 8eebb06a4d..112e7032d6 100644 --- a/src/network/socket/qabstractsocketengine_p.h +++ b/src/network/socket/qabstractsocketengine_p.h @@ -88,7 +88,7 @@ public: static QAbstractSocketEngine *createSocketEngine(QAbstractSocket::SocketType socketType, const QNetworkProxy &, QObject *parent); static QAbstractSocketEngine *createSocketEngine(qintptr socketDescriptor, QObject *parent); - QAbstractSocketEngine(QObject *parent = 0); + QAbstractSocketEngine(QObject *parent = nullptr); enum SocketOption { NonBlockingSocketOption, @@ -155,7 +155,7 @@ public: virtual qint64 pendingDatagramSize() const = 0; #endif // QT_NO_UDPSOCKET - virtual qint64 readDatagram(char *data, qint64 maxlen, QIpPacketHeader *header = 0, + virtual qint64 readDatagram(char *data, qint64 maxlen, QIpPacketHeader *header = nullptr, PacketHeaderOptions = WantNone) = 0; virtual qint64 writeDatagram(const char *data, qint64 len, const QIpPacketHeader &header) = 0; virtual qint64 bytesToWrite() const = 0; @@ -163,11 +163,11 @@ public: virtual int option(SocketOption option) const = 0; virtual bool setOption(SocketOption option, int value) = 0; - virtual bool waitForRead(int msecs = 30000, bool *timedOut = 0) = 0; - virtual bool waitForWrite(int msecs = 30000, bool *timedOut = 0) = 0; + virtual bool waitForRead(int msecs = 30000, bool *timedOut = nullptr) = 0; + virtual bool waitForWrite(int msecs = 30000, bool *timedOut = nullptr) = 0; virtual bool waitForReadOrWrite(bool *readyToRead, bool *readyToWrite, bool checkRead, bool checkWrite, - int msecs = 30000, bool *timedOut = 0) = 0; + int msecs = 30000, bool *timedOut = nullptr) = 0; QAbstractSocket::SocketError error() const; QString errorString() const; @@ -202,7 +202,7 @@ public Q_SLOTS: public: void setReceiver(QAbstractSocketEngineReceiver *receiver); protected: - QAbstractSocketEngine(QAbstractSocketEnginePrivate &dd, QObject* parent = 0); + QAbstractSocketEngine(QAbstractSocketEnginePrivate &dd, QObject* parent = nullptr); void setError(QAbstractSocket::SocketError error, const QString &errorString) const; void setState(QAbstractSocket::SocketState state); diff --git a/src/network/socket/qhttpsocketengine.cpp b/src/network/socket/qhttpsocketengine.cpp index 49ea17f9f8..6cae29193d 100644 --- a/src/network/socket/qhttpsocketengine.cpp +++ b/src/network/socket/qhttpsocketengine.cpp @@ -524,7 +524,7 @@ void QHttpSocketEngine::slotSocketConnected() //qDebug() << "slotSocketConnected: priv=" << priv << (priv ? (int)priv->method : -1); if (priv && priv->method != QAuthenticatorPrivate::None) { d->credentialsSent = true; - data += "Proxy-Authorization: " + priv->calculateResponse(method, path); + data += "Proxy-Authorization: " + priv->calculateResponse(method, path, d->proxy.hostName()); data += "\r\n"; } data += "\r\n"; diff --git a/src/network/socket/qhttpsocketengine_p.h b/src/network/socket/qhttpsocketengine_p.h index bbcc09eee9..0c2c450c81 100644 --- a/src/network/socket/qhttpsocketengine_p.h +++ b/src/network/socket/qhttpsocketengine_p.h @@ -79,7 +79,7 @@ public: ReadResponseContent, ReadResponseHeader }; - QHttpSocketEngine(QObject *parent = 0); + QHttpSocketEngine(QObject *parent = nullptr); ~QHttpSocketEngine(); bool initialize(QAbstractSocket::SocketType type, QAbstractSocket::NetworkLayerProtocol protocol = QAbstractSocket::IPv4Protocol) override; @@ -126,11 +126,11 @@ public: int option(SocketOption option) const override; bool setOption(SocketOption option, int value) override; - bool waitForRead(int msecs = 30000, bool *timedOut = 0) override; - bool waitForWrite(int msecs = 30000, bool *timedOut = 0) override; + bool waitForRead(int msecs = 30000, bool *timedOut = nullptr) override; + bool waitForWrite(int msecs = 30000, bool *timedOut = nullptr) override; bool waitForReadOrWrite(bool *readyToRead, bool *readyToWrite, bool checkRead, bool checkWrite, - int msecs = 30000, bool *timedOut = 0) override; + int msecs = 30000, bool *timedOut = nullptr) override; bool isReadNotificationEnabled() const override; void setReadNotificationEnabled(bool enable) override; diff --git a/src/network/socket/qlocalserver_p.h b/src/network/socket/qlocalserver_p.h index 2c073908cb..92616e59ce 100644 --- a/src/network/socket/qlocalserver_p.h +++ b/src/network/socket/qlocalserver_p.h @@ -78,7 +78,7 @@ class QLocalServerPrivate : public QObjectPrivate public: QLocalServerPrivate() : #if !defined(QT_LOCALSOCKET_TCP) && !defined(Q_OS_WIN) - listenSocket(-1), socketNotifier(0), + listenSocket(-1), socketNotifier(nullptr), #endif maxPendingConnections(30), error(QAbstractSocket::UnknownSocketError), socketOptions(QLocalServer::NoOptions) diff --git a/src/network/socket/qnativesocketengine_p.h b/src/network/socket/qnativesocketengine_p.h index 2292566265..e5f0701d14 100644 --- a/src/network/socket/qnativesocketengine_p.h +++ b/src/network/socket/qnativesocketengine_p.h @@ -125,7 +125,7 @@ class Q_AUTOTEST_EXPORT QNativeSocketEngine : public QAbstractSocketEngine { Q_OBJECT public: - QNativeSocketEngine(QObject *parent = 0); + QNativeSocketEngine(QObject *parent = nullptr); ~QNativeSocketEngine(); bool initialize(QAbstractSocket::SocketType type, QAbstractSocket::NetworkLayerProtocol protocol = QAbstractSocket::IPv4Protocol) override; @@ -161,7 +161,7 @@ public: qint64 pendingDatagramSize() const override; #endif // QT_NO_UDPSOCKET - qint64 readDatagram(char *data, qint64 maxlen, QIpPacketHeader * = 0, + qint64 readDatagram(char *data, qint64 maxlen, QIpPacketHeader * = nullptr, PacketHeaderOptions = WantNone) override; qint64 writeDatagram(const char *data, qint64 len, const QIpPacketHeader &) override; qint64 bytesToWrite() const override; @@ -177,11 +177,11 @@ public: int option(SocketOption option) const override; bool setOption(SocketOption option, int value) override; - bool waitForRead(int msecs = 30000, bool *timedOut = 0) override; - bool waitForWrite(int msecs = 30000, bool *timedOut = 0) override; + bool waitForRead(int msecs = 30000, bool *timedOut = nullptr) override; + bool waitForWrite(int msecs = 30000, bool *timedOut = nullptr) override; bool waitForReadOrWrite(bool *readyToRead, bool *readyToWrite, bool checkRead, bool checkWrite, - int msecs = 30000, bool *timedOut = 0) override; + int msecs = 30000, bool *timedOut = nullptr) override; bool isReadNotificationEnabled() const override; void setReadNotificationEnabled(bool enable) override; diff --git a/src/network/socket/qsocks5socketengine_p.h b/src/network/socket/qsocks5socketengine_p.h index ef9d771753..c256987e2d 100644 --- a/src/network/socket/qsocks5socketengine_p.h +++ b/src/network/socket/qsocks5socketengine_p.h @@ -65,7 +65,7 @@ class Q_AUTOTEST_EXPORT QSocks5SocketEngine : public QAbstractSocketEngine { Q_OBJECT public: - QSocks5SocketEngine(QObject *parent = 0); + QSocks5SocketEngine(QObject *parent = nullptr); ~QSocks5SocketEngine(); bool initialize(QAbstractSocket::SocketType type, QAbstractSocket::NetworkLayerProtocol protocol = QAbstractSocket::IPv4Protocol) override; @@ -104,7 +104,7 @@ public: qint64 pendingDatagramSize() const override; #endif // QT_NO_UDPSOCKET - qint64 readDatagram(char *data, qint64 maxlen, QIpPacketHeader * = 0, + qint64 readDatagram(char *data, qint64 maxlen, QIpPacketHeader * = nullptr, PacketHeaderOptions = WantNone) override; qint64 writeDatagram(const char *data, qint64 len, const QIpPacketHeader &) override; qint64 bytesToWrite() const override; @@ -112,11 +112,11 @@ public: int option(SocketOption option) const override; bool setOption(SocketOption option, int value) override; - bool waitForRead(int msecs = 30000, bool *timedOut = 0) override; - bool waitForWrite(int msecs = 30000, bool *timedOut = 0) override; + bool waitForRead(int msecs = 30000, bool *timedOut = nullptr) override; + bool waitForWrite(int msecs = 30000, bool *timedOut = nullptr) override; bool waitForReadOrWrite(bool *readyToRead, bool *readyToWrite, bool checkRead, bool checkWrite, - int msecs = 30000, bool *timedOut = 0) override; + int msecs = 30000, bool *timedOut = nullptr) override; bool isReadNotificationEnabled() const override; void setReadNotificationEnabled(bool enable) override; diff --git a/src/network/ssl/qasn1element_p.h b/src/network/ssl/qasn1element_p.h index 22948e3ca5..020b5aa1af 100644 --- a/src/network/ssl/qasn1element_p.h +++ b/src/network/ssl/qasn1element_p.h @@ -156,10 +156,10 @@ public: static QAsn1Element fromVector(const QVector<QAsn1Element> &items); static QAsn1Element fromObjectId(const QByteArray &id); - bool toBool(bool *ok = 0) const; + bool toBool(bool *ok = nullptr) const; QDateTime toDateTime() const; QMultiMap<QByteArray, QString> toInfo() const; - qint64 toInteger(bool *ok = 0) const; + qint64 toInteger(bool *ok = nullptr) const; QVector<QAsn1Element> toVector() const; QByteArray toObjectId() const; QByteArray toObjectName() const; diff --git a/src/network/ssl/qsslcertificate_p.h b/src/network/ssl/qsslcertificate_p.h index 4b331d4c4e..234cd45ceb 100644 --- a/src/network/ssl/qsslcertificate_p.h +++ b/src/network/ssl/qsslcertificate_p.h @@ -87,7 +87,7 @@ class QSslCertificatePrivate { public: QSslCertificatePrivate() - : null(true), x509(0) + : null(true), x509(nullptr) { #ifndef QT_NO_SSL QSslSocketPrivate::ensureInitialized(); diff --git a/src/network/ssl/qsslcontext_openssl11.cpp b/src/network/ssl/qsslcontext_openssl11.cpp index 21a5c779f7..db023b7331 100644 --- a/src/network/ssl/qsslcontext_openssl11.cpp +++ b/src/network/ssl/qsslcontext_openssl11.cpp @@ -193,7 +193,6 @@ init_context: minVersion = TLS1_2_VERSION; maxVersion = 0; break; -#if QT_CONFIG(dtls) case QSsl::DtlsV1_0: minVersion = DTLS1_VERSION; maxVersion = DTLS1_VERSION; @@ -210,7 +209,6 @@ init_context: minVersion = DTLS1_2_VERSION; maxVersion = DTLS_MAX_VERSION; break; -#endif // dtls case QSsl::TlsV1_3OrLater: #ifdef TLS1_3_VERSION minVersion = TLS1_3_VERSION; diff --git a/src/network/ssl/qsslcontext_openssl_p.h b/src/network/ssl/qsslcontext_openssl_p.h index 48beebf134..1fa27279c7 100644 --- a/src/network/ssl/qsslcontext_openssl_p.h +++ b/src/network/ssl/qsslcontext_openssl_p.h @@ -89,7 +89,7 @@ public: #if OPENSSL_VERSION_NUMBER >= 0x1000100fL && !defined(OPENSSL_NO_NEXTPROTONEG) // must be public because we want to use it from an OpenSSL callback struct NPNContext { - NPNContext() : data(0), + NPNContext() : data(nullptr), len(0), status(QSslConfiguration::NextProtocolNegotiationNone) { } diff --git a/src/network/ssl/qsslkey_mac.cpp b/src/network/ssl/qsslkey_mac.cpp index d460cbfdab..814fe1c4bc 100644 --- a/src/network/ssl/qsslkey_mac.cpp +++ b/src/network/ssl/qsslkey_mac.cpp @@ -42,7 +42,9 @@ #include <CommonCrypto/CommonCrypto.h> -QT_USE_NAMESPACE +#include <cstddef> + +QT_BEGIN_NAMESPACE static QByteArray wrapCCCrypt(CCOperation ccOp, QSslKeyPrivate::Cipher cipher, @@ -64,17 +66,23 @@ static QByteArray wrapCCCrypt(CCOperation ccOp, blockSize = kCCBlockSizeRC2; ccAlgorithm = kCCAlgorithmRC2; break; - }; + case QSslKeyPrivate::Aes128Cbc: + case QSslKeyPrivate::Aes192Cbc: + case QSslKeyPrivate::Aes256Cbc: + blockSize = kCCBlockSizeAES128; + ccAlgorithm = kCCAlgorithmAES; + break; + } size_t plainLength = 0; QByteArray plain(data.size() + blockSize, 0); CCCryptorStatus status = CCCrypt( ccOp, ccAlgorithm, kCCOptionPKCS7Padding, - key.constData(), key.size(), + key.constData(), std::size_t(key.size()), iv.constData(), - data.constData(), data.size(), - plain.data(), plain.size(), &plainLength); + data.constData(), std::size_t(data.size()), + plain.data(), std::size_t(plain.size()), &plainLength); if (status == kCCSuccess) - return plain.left(plainLength); + return plain.left(int(plainLength)); return QByteArray(); } @@ -87,3 +95,5 @@ QByteArray QSslKeyPrivate::encrypt(Cipher cipher, const QByteArray &data, const { return wrapCCCrypt(kCCEncrypt, cipher, data, key, iv); } + +QT_END_NAMESPACE diff --git a/src/network/ssl/qsslkey_openssl.cpp b/src/network/ssl/qsslkey_openssl.cpp index 99c1a39c73..888058df22 100644 --- a/src/network/ssl/qsslkey_openssl.cpp +++ b/src/network/ssl/qsslkey_openssl.cpp @@ -333,6 +333,15 @@ static QByteArray doCrypt(QSslKeyPrivate::Cipher cipher, const QByteArray &data, type = q_EVP_rc2_cbc(); #endif break; + case QSslKeyPrivate::Aes128Cbc: + type = q_EVP_aes_128_cbc(); + break; + case QSslKeyPrivate::Aes192Cbc: + type = q_EVP_aes_192_cbc(); + break; + case QSslKeyPrivate::Aes256Cbc: + type = q_EVP_aes_256_cbc(); + break; } if (type == nullptr) diff --git a/src/network/ssl/qsslkey_p.h b/src/network/ssl/qsslkey_p.h index 06403b5479..dd1a31b0e5 100644 --- a/src/network/ssl/qsslkey_p.h +++ b/src/network/ssl/qsslkey_p.h @@ -68,7 +68,7 @@ class QSslKeyPrivate public: inline QSslKeyPrivate() : algorithm(QSsl::Opaque) - , opaque(0) + , opaque(nullptr) { clear(false); } @@ -105,7 +105,10 @@ public: enum Cipher { DesCbc, DesEde3Cbc, - Rc2Cbc + Rc2Cbc, + Aes128Cbc, + Aes192Cbc, + Aes256Cbc }; Q_AUTOTEST_EXPORT static QByteArray decrypt(Cipher cipher, const QByteArray &data, const QByteArray &key, const QByteArray &iv); diff --git a/src/network/ssl/qsslkey_qt.cpp b/src/network/ssl/qsslkey_qt.cpp index 5ebd8ac3bd..2662418a05 100644 --- a/src/network/ssl/qsslkey_qt.cpp +++ b/src/network/ssl/qsslkey_qt.cpp @@ -124,6 +124,37 @@ static int numberOfBits(const QByteArray &modulus) return bits; } +static QByteArray deriveAesKey(QSslKeyPrivate::Cipher cipher, const QByteArray &passPhrase, const QByteArray &iv) +{ + // This is somewhat simplified and shortened version of what OpenSSL does. + // See, for example, EVP_BytesToKey for the "algorithm" itself and elsewhere + // in their code for what they pass as arguments to EVP_BytesToKey when + // deriving encryption keys (when reading/writing pems files with encrypted + // keys). + + Q_ASSERT(iv.size() >= 8); + + QCryptographicHash hash(QCryptographicHash::Md5); + + QByteArray data(passPhrase); + data.append(iv.data(), 8); // AKA PKCS5_SALT_LEN in OpenSSL. + + hash.addData(data); + + if (cipher == QSslKeyPrivate::Aes128Cbc) + return hash.result(); + + QByteArray key(hash.result()); + hash.reset(); + hash.addData(key); + hash.addData(data); + + if (cipher == QSslKeyPrivate::Aes192Cbc) + return key.append(hash.result().constData(), 8); + + return key.append(hash.result()); +} + static QByteArray deriveKey(QSslKeyPrivate::Cipher cipher, const QByteArray &passPhrase, const QByteArray &iv) { QByteArray key; @@ -145,6 +176,10 @@ static QByteArray deriveKey(QSslKeyPrivate::Cipher cipher, const QByteArray &pas case QSslKeyPrivate::Rc2Cbc: key = hash.result(); break; + case QSslKeyPrivate::Aes128Cbc: + case QSslKeyPrivate::Aes192Cbc: + case QSslKeyPrivate::Aes256Cbc: + return deriveAesKey(cipher, passPhrase, iv); } return key; } @@ -378,6 +413,12 @@ void QSslKeyPrivate::decodePem(const QByteArray &pem, const QByteArray &passPhra cipher = DesEde3Cbc; } else if (dekInfo.first() == "RC2-CBC") { cipher = Rc2Cbc; + } else if (dekInfo.first() == "AES-128-CBC") { + cipher = Aes128Cbc; + } else if (dekInfo.first() == "AES-192-CBC") { + cipher = Aes192Cbc; + } else if (dekInfo.first() == "AES-256-CBC") { + cipher = Aes256Cbc; } else { clear(deepClear); return; @@ -554,6 +595,10 @@ static EncryptionData readPbes2(const QVector<QAsn1Element> &element, const QByt return {}; break; } // @todo(?): case (RC5 , AES) + case QSslKeyPrivate::Cipher::Aes128Cbc: + case QSslKeyPrivate::Cipher::Aes192Cbc: + case QSslKeyPrivate::Cipher::Aes256Cbc: + Q_UNREACHABLE(); } if (Q_LIKELY(keyDerivationAlgorithm == PKCS5_PBKDF2_ENCRYPTION_OID)) { diff --git a/src/network/ssl/qsslkey_schannel.cpp b/src/network/ssl/qsslkey_schannel.cpp index 5694068860..1e21d123f4 100644 --- a/src/network/ssl/qsslkey_schannel.cpp +++ b/src/network/ssl/qsslkey_schannel.cpp @@ -57,6 +57,10 @@ const wchar_t *getName(QSslKeyPrivate::Cipher cipher) return BCRYPT_3DES_ALGORITHM; case QSslKeyPrivate::Cipher::Rc2Cbc: return BCRYPT_RC2_ALGORITHM; + case QSslKeyPrivate::Cipher::Aes128Cbc: + case QSslKeyPrivate::Cipher::Aes192Cbc: + case QSslKeyPrivate::Cipher::Aes256Cbc: + return BCRYPT_AES_ALGORITHM; } Q_UNREACHABLE(); } diff --git a/src/network/ssl/qsslkey_winrt.cpp b/src/network/ssl/qsslkey_winrt.cpp index f2ed813965..69eaaa387f 100644 --- a/src/network/ssl/qsslkey_winrt.cpp +++ b/src/network/ssl/qsslkey_winrt.cpp @@ -83,6 +83,15 @@ struct SslKeyGlobal hr = keyProviderFactory->OpenAlgorithm(HString::MakeReference(L"RC2_CBC").Get(), &keyProviders[QSslKeyPrivate::Rc2Cbc]); Q_ASSERT_SUCCEEDED(hr); + hr = keyProviderFactory->OpenAlgorithm(HString::MakeReference(L"AES_CBC").Get(), + &keyProviders[QSslKeyPrivate::Aes128Cbc]); + Q_ASSERT_SUCCEEDED(hr); + hr = keyProviderFactory->OpenAlgorithm(HString::MakeReference(L"AES_CBC").Get(), + &keyProviders[QSslKeyPrivate::Aes192Cbc]); + Q_ASSERT_SUCCEEDED(hr); + hr = keyProviderFactory->OpenAlgorithm(HString::MakeReference(L"AES_CBC").Get(), + &keyProviders[QSslKeyPrivate::Aes256Cbc]); + Q_ASSERT_SUCCEEDED(hr); hr = GetActivationFactory(HString::MakeReference(RuntimeClass_Windows_Security_Cryptography_CryptographicBuffer).Get(), &bufferFactory); diff --git a/src/network/ssl/qsslsocket.cpp b/src/network/ssl/qsslsocket.cpp index e164217e4e..4e6caf3edd 100644 --- a/src/network/ssl/qsslsocket.cpp +++ b/src/network/ssl/qsslsocket.cpp @@ -1209,12 +1209,21 @@ void QSslSocket::setPrivateKey(const QSslKey &key) void QSslSocket::setPrivateKey(const QString &fileName, QSsl::KeyAlgorithm algorithm, QSsl::EncodingFormat format, const QByteArray &passPhrase) { - Q_D(QSslSocket); QFile file(fileName); - if (file.open(QIODevice::ReadOnly)) { - d->configuration.privateKey = QSslKey(file.readAll(), algorithm, - format, QSsl::PrivateKey, passPhrase); + if (!file.open(QIODevice::ReadOnly)) { + qCWarning(lcSsl, "QSslSocket::setPrivateKey: Couldn't open file for reading"); + return; + } + + QSslKey key(file.readAll(), algorithm, format, QSsl::PrivateKey, passPhrase); + if (key.isNull()) { + qCWarning(lcSsl, "QSslSocket::setPrivateKey: " + "The specified file does not contain a valid key"); + return; } + + Q_D(QSslSocket); + d->configuration.privateKey = key; } /*! diff --git a/src/network/ssl/qsslsocket_openssl.cpp b/src/network/ssl/qsslsocket_openssl.cpp index c48cd42360..6a8269b521 100644 --- a/src/network/ssl/qsslsocket_openssl.cpp +++ b/src/network/ssl/qsslsocket_openssl.cpp @@ -476,7 +476,8 @@ bool QSslSocketBackendPrivate::initSslContext() { Q_Q(QSslSocket); - // If no external context was set (e.g. bei QHttpNetworkConnection) we will create a default context + // If no external context was set (e.g. by QHttpNetworkConnection) we will + // create a default context if (!sslContextPointer) { // create a deep copy of our configuration QSslConfigurationPrivate *configurationCopy = new QSslConfigurationPrivate(configuration); diff --git a/src/network/ssl/qsslsocket_openssl11_symbols_p.h b/src/network/ssl/qsslsocket_openssl11_symbols_p.h index a44d00a830..9d0a14360d 100644 --- a/src/network/ssl/qsslsocket_openssl11_symbols_p.h +++ b/src/network/ssl/qsslsocket_openssl11_symbols_p.h @@ -82,6 +82,7 @@ Q_AUTOTEST_EXPORT const BIO_METHOD *q_BIO_s_mem(); int q_DSA_bits(DSA *a); int q_EVP_CIPHER_CTX_reset(EVP_CIPHER_CTX *c); +Q_AUTOTEST_EXPORT int q_EVP_PKEY_up_ref(EVP_PKEY *a); int q_EVP_PKEY_base_id(EVP_PKEY *a); int q_RSA_bits(RSA *a); Q_AUTOTEST_EXPORT int q_OPENSSL_sk_num(OPENSSL_STACK *a); diff --git a/src/network/ssl/qsslsocket_openssl_symbols.cpp b/src/network/ssl/qsslsocket_openssl_symbols.cpp index aa1dc681e0..e04d45c10c 100644 --- a/src/network/ssl/qsslsocket_openssl_symbols.cpp +++ b/src/network/ssl/qsslsocket_openssl_symbols.cpp @@ -150,6 +150,7 @@ DEFINEFUNC(BIO *, BIO_new, const BIO_METHOD *a, a, return nullptr, return) DEFINEFUNC(const BIO_METHOD *, BIO_s_mem, void, DUMMYARG, return nullptr, return) DEFINEFUNC2(int, BN_is_word, BIGNUM *a, a, BN_ULONG w, w, return 0, return) DEFINEFUNC(int, EVP_CIPHER_CTX_reset, EVP_CIPHER_CTX *c, c, return 0, return) +DEFINEFUNC(int, EVP_PKEY_up_ref, EVP_PKEY *a, a, return 0, return) DEFINEFUNC(int, EVP_PKEY_base_id, EVP_PKEY *a, a, return NID_undef, return) DEFINEFUNC(int, RSA_bits, RSA *a, a, return 0, return) DEFINEFUNC(int, DSA_bits, DSA *a, a, return 0, return) @@ -358,6 +359,11 @@ DEFINEFUNC(const EVP_CIPHER *, EVP_des_ede3_cbc, DUMMYARG, DUMMYARG, return null #ifndef OPENSSL_NO_RC2 DEFINEFUNC(const EVP_CIPHER *, EVP_rc2_cbc, DUMMYARG, DUMMYARG, return nullptr, return) #endif +#ifndef OPENSSL_NO_AES +DEFINEFUNC(const EVP_CIPHER *, EVP_aes_128_cbc, DUMMYARG, DUMMYARG, return nullptr, return) +DEFINEFUNC(const EVP_CIPHER *, EVP_aes_192_cbc, DUMMYARG, DUMMYARG, return nullptr, return) +DEFINEFUNC(const EVP_CIPHER *, EVP_aes_256_cbc, DUMMYARG, DUMMYARG, return nullptr, return) +#endif DEFINEFUNC(const EVP_MD *, EVP_sha1, DUMMYARG, DUMMYARG, return nullptr, return) DEFINEFUNC3(int, EVP_PKEY_assign, EVP_PKEY *a, a, int b, b, char *c, c, return -1, return) DEFINEFUNC2(int, EVP_PKEY_set1_RSA, EVP_PKEY *a, a, RSA *b, b, return -1, return) @@ -366,6 +372,7 @@ DEFINEFUNC2(int, EVP_PKEY_set1_DH, EVP_PKEY *a, a, DH *b, b, return -1, return) #ifndef OPENSSL_NO_EC DEFINEFUNC2(int, EVP_PKEY_set1_EC_KEY, EVP_PKEY *a, a, EC_KEY *b, b, return -1, return) #endif +DEFINEFUNC2(int, EVP_PKEY_cmp, const EVP_PKEY *a, a, const EVP_PKEY *b, b, return -1, return) DEFINEFUNC(void, EVP_PKEY_free, EVP_PKEY *a, a, return, DUMMYARG) DEFINEFUNC(DSA *, EVP_PKEY_get1_DSA, EVP_PKEY *a, a, return nullptr, return) DEFINEFUNC(RSA *, EVP_PKEY_get1_RSA, EVP_PKEY *a, a, return nullptr, return) @@ -955,6 +962,7 @@ bool q_resolveOpenSslSymbols() RESOLVEFUNC(OPENSSL_init_crypto) RESOLVEFUNC(ASN1_STRING_get0_data) RESOLVEFUNC(EVP_CIPHER_CTX_reset) + RESOLVEFUNC(EVP_PKEY_up_ref) RESOLVEFUNC(EVP_PKEY_base_id) RESOLVEFUNC(RSA_bits) RESOLVEFUNC(OPENSSL_sk_new_null) @@ -1176,6 +1184,11 @@ bool q_resolveOpenSslSymbols() #ifndef OPENSSL_NO_RC2 RESOLVEFUNC(EVP_rc2_cbc) #endif +#ifndef OPENSSL_NO_AES + RESOLVEFUNC(EVP_aes_128_cbc) + RESOLVEFUNC(EVP_aes_192_cbc) + RESOLVEFUNC(EVP_aes_256_cbc) +#endif RESOLVEFUNC(EVP_sha1) RESOLVEFUNC(EVP_PKEY_assign) RESOLVEFUNC(EVP_PKEY_set1_RSA) @@ -1184,6 +1197,7 @@ bool q_resolveOpenSslSymbols() #ifndef OPENSSL_NO_EC RESOLVEFUNC(EVP_PKEY_set1_EC_KEY) #endif + RESOLVEFUNC(EVP_PKEY_cmp) RESOLVEFUNC(EVP_PKEY_free) RESOLVEFUNC(EVP_PKEY_get1_DSA) RESOLVEFUNC(EVP_PKEY_get1_RSA) diff --git a/src/network/ssl/qsslsocket_openssl_symbols_p.h b/src/network/ssl/qsslsocket_openssl_symbols_p.h index e09820b2f2..fcf96dbd47 100644 --- a/src/network/ssl/qsslsocket_openssl_symbols_p.h +++ b/src/network/ssl/qsslsocket_openssl_symbols_p.h @@ -281,14 +281,20 @@ const EVP_CIPHER *q_EVP_des_ede3_cbc(); #ifndef OPENSSL_NO_RC2 const EVP_CIPHER *q_EVP_rc2_cbc(); #endif +#ifndef OPENSSL_NO_AES +const EVP_CIPHER *q_EVP_aes_128_cbc(); +const EVP_CIPHER *q_EVP_aes_192_cbc(); +const EVP_CIPHER *q_EVP_aes_256_cbc(); +#endif Q_AUTOTEST_EXPORT const EVP_MD *q_EVP_sha1(); int q_EVP_PKEY_assign(EVP_PKEY *a, int b, char *c); Q_AUTOTEST_EXPORT int q_EVP_PKEY_set1_RSA(EVP_PKEY *a, RSA *b); -int q_EVP_PKEY_set1_DSA(EVP_PKEY *a, DSA *b); -int q_EVP_PKEY_set1_DH(EVP_PKEY *a, DH *b); +Q_AUTOTEST_EXPORT int q_EVP_PKEY_set1_DSA(EVP_PKEY *a, DSA *b); +Q_AUTOTEST_EXPORT int q_EVP_PKEY_set1_DH(EVP_PKEY *a, DH *b); #ifndef OPENSSL_NO_EC -int q_EVP_PKEY_set1_EC_KEY(EVP_PKEY *a, EC_KEY *b); +Q_AUTOTEST_EXPORT int q_EVP_PKEY_set1_EC_KEY(EVP_PKEY *a, EC_KEY *b); #endif +Q_AUTOTEST_EXPORT int q_EVP_PKEY_cmp(const EVP_PKEY *a, const EVP_PKEY *b); Q_AUTOTEST_EXPORT void q_EVP_PKEY_free(EVP_PKEY *a); RSA *q_EVP_PKEY_get1_RSA(EVP_PKEY *a); DSA *q_EVP_PKEY_get1_DSA(EVP_PKEY *a); diff --git a/src/opengl/gl2paintengineex/qglengineshadermanager_p.h b/src/opengl/gl2paintengineex/qglengineshadermanager_p.h index ec472da2e8..d23b3ad550 100644 --- a/src/opengl/gl2paintengineex/qglengineshadermanager_p.h +++ b/src/opengl/gl2paintengineex/qglengineshadermanager_p.h @@ -372,7 +372,7 @@ private: class QGLEngineShaderProg { public: - QGLEngineShaderProg() : program(0) {} + QGLEngineShaderProg() : program(nullptr) {} ~QGLEngineShaderProg() { if (program) diff --git a/src/opengl/gl2paintengineex/qpaintengineex_opengl2_p.h b/src/opengl/gl2paintengineex/qpaintengineex_opengl2_p.h index abf5b8ea48..762aac2f65 100644 --- a/src/opengl/gl2paintengineex/qpaintengineex_opengl2_p.h +++ b/src/opengl/gl2paintengineex/qpaintengineex_opengl2_p.h @@ -175,9 +175,9 @@ public: QGL2PaintEngineExPrivate(QGL2PaintEngineEx *q_ptr) : q(q_ptr), - shaderManager(0), + shaderManager(nullptr), width(0), height(0), - ctx(0), + ctx(nullptr), useSystemClip(true), elementIndicesVBOId(0), opacityArray(0), diff --git a/src/opengl/gl2paintengineex/qtextureglyphcache_gl_p.h b/src/opengl/gl2paintengineex/qtextureglyphcache_gl_p.h index e76216ef5d..7c12ce8998 100644 --- a/src/opengl/gl2paintengineex/qtextureglyphcache_gl_p.h +++ b/src/opengl/gl2paintengineex/qtextureglyphcache_gl_p.h @@ -139,7 +139,7 @@ public: inline void setPaintEnginePrivate(QGL2PaintEngineExPrivate *p) { pex = p; } - inline const QOpenGLContextGroup *contextGroup() const { return m_textureResource ? m_textureResource->group() : 0; } + inline const QOpenGLContextGroup *contextGroup() const { return m_textureResource ? m_textureResource->group() : nullptr; } inline int serialNumber() const { return m_serialNumber; } diff --git a/src/opengl/qgl_p.h b/src/opengl/qgl_p.h index ed364283cc..4e52c0f5e9 100644 --- a/src/opengl/qgl_p.h +++ b/src/opengl/qgl_p.h @@ -203,7 +203,7 @@ const QGLContext *qt_gl_transfer_context(const QGLContext *); class QGLTemporaryContextPrivate; class QGLTemporaryContext { public: - explicit QGLTemporaryContext(bool directRendering = true, QWidget *parent = 0); + explicit QGLTemporaryContext(bool directRendering = true, QWidget *parent = nullptr); ~QGLTemporaryContext(); private: @@ -302,7 +302,7 @@ class Q_OPENGL_EXPORT QGLShareContextScope { public: QGLShareContextScope(const QGLContext *ctx) - : m_oldContext(0) + : m_oldContext(nullptr) { QGLContext *currentContext = const_cast<QGLContext *>(QGLContext::currentContext()); if (currentContext != ctx && !QGLContext::areSharing(ctx, currentContext)) { @@ -367,7 +367,7 @@ Q_SIGNALS: class QGLTexture { public: - explicit QGLTexture(QGLContext *ctx = 0, GLuint tx_id = 0, GLenum tx_target = GL_TEXTURE_2D, + explicit QGLTexture(QGLContext *ctx = nullptr, GLuint tx_id = 0, GLenum tx_target = GL_TEXTURE_2D, QGLContext::BindOptions opt = QGLContext::DefaultBindOption) : context(ctx), id(tx_id), @@ -378,7 +378,7 @@ public: ~QGLTexture() { if (options & QGLContext::MemoryManagedBindOption) { Q_ASSERT(context); - QPlatformPixmap *boundPixmap = 0; + QPlatformPixmap *boundPixmap = nullptr; context->d_ptr->texture_destroyer->emitFreeTexture(context, boundPixmap, id); } } @@ -392,9 +392,9 @@ public: bool canBindCompressedTexture (const char *buf, int len, const char *format, bool *hasAlpha); QSize bindCompressedTexture - (const QString& fileName, const char *format = 0); + (const QString& fileName, const char *format = nullptr); QSize bindCompressedTexture - (const char *buf, int len, const char *format = 0); + (const char *buf, int len, const char *format = nullptr); QSize bindCompressedTextureDDS(const char *buf, int len); QSize bindCompressedTexturePVR(const char *buf, int len); }; diff --git a/src/opengl/qglframebufferobject_p.h b/src/opengl/qglframebufferobject_p.h index bf5e21cf0b..9d536527c3 100644 --- a/src/opengl/qglframebufferobject_p.h +++ b/src/opengl/qglframebufferobject_p.h @@ -124,9 +124,9 @@ private: class QGLFramebufferObjectPrivate { public: - QGLFramebufferObjectPrivate() : fbo_guard(0), texture_guard(0), depth_buffer_guard(0) - , stencil_buffer_guard(0), color_buffer_guard(0) - , valid(false), engine(0) {} + QGLFramebufferObjectPrivate() : fbo_guard(nullptr), texture_guard(nullptr), depth_buffer_guard(nullptr) + , stencil_buffer_guard(nullptr), color_buffer_guard(nullptr) + , valid(false), engine(nullptr) {} ~QGLFramebufferObjectPrivate() {} void init(QGLFramebufferObject *q, const QSize& sz, diff --git a/src/opengl/qglpixelbuffer_p.h b/src/opengl/qglpixelbuffer_p.h index 9125fcfb4b..2729ade2b6 100644 --- a/src/opengl/qglpixelbuffer_p.h +++ b/src/opengl/qglpixelbuffer_p.h @@ -77,7 +77,7 @@ private: class QGLPixelBufferPrivate { Q_DECLARE_PUBLIC(QGLPixelBuffer) public: - QGLPixelBufferPrivate(QGLPixelBuffer *q) : q_ptr(q), invalid(true), qctx(0), widget(0), fbo(0), blit_fbo(0), pbuf(0), ctx(0) + QGLPixelBufferPrivate(QGLPixelBuffer *q) : q_ptr(q), invalid(true), qctx(nullptr), widget(nullptr), fbo(nullptr), blit_fbo(nullptr), pbuf(nullptr), ctx(nullptr) { } bool init(const QSize &size, const QGLFormat &f, QGLWidget *shareWidget); diff --git a/src/opengl/qgraphicsshadereffect_p.h b/src/opengl/qgraphicsshadereffect_p.h index 1a32f24d70..218caa2936 100644 --- a/src/opengl/qgraphicsshadereffect_p.h +++ b/src/opengl/qgraphicsshadereffect_p.h @@ -67,7 +67,7 @@ class Q_OPENGL_EXPORT QGraphicsShaderEffect : public QGraphicsEffect { Q_OBJECT public: - QGraphicsShaderEffect(QObject *parent = 0); + QGraphicsShaderEffect(QObject *parent = nullptr); virtual ~QGraphicsShaderEffect(); QByteArray pixelShaderFragment() const; diff --git a/src/platformheaders/nativecontexts/qeglnativecontext.h b/src/platformheaders/nativecontexts/qeglnativecontext.h index d4a0e998da..5af2b304fe 100644 --- a/src/platformheaders/nativecontexts/qeglnativecontext.h +++ b/src/platformheaders/nativecontexts/qeglnativecontext.h @@ -54,8 +54,8 @@ typedef int EGLDisplay; struct QEGLNativeContext { QEGLNativeContext() - : m_context(0), - m_display(0) + : m_context(nullptr), + m_display(nullptr) { } QEGLNativeContext(EGLContext ctx, EGLDisplay dpy) diff --git a/src/platformsupport/devicediscovery/qdevicediscovery_p.h b/src/platformsupport/devicediscovery/qdevicediscovery_p.h index b1ce14b5c3..f1f50e9708 100644 --- a/src/platformsupport/devicediscovery/qdevicediscovery_p.h +++ b/src/platformsupport/devicediscovery/qdevicediscovery_p.h @@ -86,7 +86,7 @@ public: Q_ENUM(QDeviceType) Q_DECLARE_FLAGS(QDeviceTypes, QDeviceType) - static QDeviceDiscovery *create(QDeviceTypes type, QObject *parent = 0); + static QDeviceDiscovery *create(QDeviceTypes type, QObject *parent = nullptr); virtual QStringList scanConnectedDevices() = 0; diff --git a/src/platformsupport/devicediscovery/qdevicediscovery_udev_p.h b/src/platformsupport/devicediscovery/qdevicediscovery_udev_p.h index 28618d0b21..82b475776d 100644 --- a/src/platformsupport/devicediscovery/qdevicediscovery_udev_p.h +++ b/src/platformsupport/devicediscovery/qdevicediscovery_udev_p.h @@ -61,7 +61,7 @@ class QDeviceDiscoveryUDev : public QDeviceDiscovery Q_OBJECT public: - QDeviceDiscoveryUDev(QDeviceTypes types, struct udev *udev, QObject *parent = 0); + QDeviceDiscoveryUDev(QDeviceTypes types, struct udev *udev, QObject *parent = nullptr); ~QDeviceDiscoveryUDev(); QStringList scanConnectedDevices() override; diff --git a/src/platformsupport/eglconvenience/qeglpbuffer_p.h b/src/platformsupport/eglconvenience/qeglpbuffer_p.h index 0285e067a6..8ad2eb7248 100644 --- a/src/platformsupport/eglconvenience/qeglpbuffer_p.h +++ b/src/platformsupport/eglconvenience/qeglpbuffer_p.h @@ -60,7 +60,7 @@ class QEGLPbuffer : public QPlatformOffscreenSurface { public: QEGLPbuffer(EGLDisplay display, const QSurfaceFormat &format, QOffscreenSurface *offscreenSurface, - QEGLPlatformContext::Flags flags = 0); + QEGLPlatformContext::Flags flags = nullptr); ~QEGLPbuffer(); QSurfaceFormat format() const override { return m_format; } diff --git a/src/platformsupport/eglconvenience/qeglplatformcontext_p.h b/src/platformsupport/eglconvenience/qeglplatformcontext_p.h index d6cbbe4131..ed77c57df5 100644 --- a/src/platformsupport/eglconvenience/qeglplatformcontext_p.h +++ b/src/platformsupport/eglconvenience/qeglplatformcontext_p.h @@ -68,8 +68,8 @@ public: Q_DECLARE_FLAGS(Flags, Flag) QEGLPlatformContext(const QSurfaceFormat &format, QPlatformOpenGLContext *share, EGLDisplay display, - EGLConfig *config = 0, const QVariant &nativeHandle = QVariant(), - Flags flags = 0); + EGLConfig *config = nullptr, const QVariant &nativeHandle = QVariant(), + Flags flags = nullptr); ~QEGLPlatformContext(); void initialize() override; diff --git a/src/platformsupport/eglconvenience/qeglstreamconvenience_p.h b/src/platformsupport/eglconvenience/qeglstreamconvenience_p.h index c3d3070210..31a79dbc6c 100644 --- a/src/platformsupport/eglconvenience/qeglstreamconvenience_p.h +++ b/src/platformsupport/eglconvenience/qeglstreamconvenience_p.h @@ -131,6 +131,12 @@ typedef EGLBoolean (EGLAPIENTRYP PFNEGLSTREAMCONSUMERRELEASEKHRPROC) (EGLDisplay typedef EGLBoolean (EGLAPIENTRYP PFNEGLSTREAMCONSUMEROUTPUTEXTPROC) (EGLDisplay dpy, EGLStreamKHR stream, EGLOutputLayerEXT layer); #endif +#ifndef EGL_EXT_stream_acquire_mode +#define EGL_EXT_stream_acquire_mode 1 +#define EGL_CONSUMER_AUTO_ACQUIRE_EXT 0x332B +#define EGL_RESOURCE_BUSY_EXT 0x3353 +#endif + #ifndef EGL_EXT_platform_device #define EGL_PLATFORM_DEVICE_EXT 0x313F #endif @@ -156,6 +162,11 @@ typedef EGLBoolean (EGLAPIENTRYP PFNEGLSTREAMCONSUMERACQUIREATTRIBNVPROC) (EGLDi typedef EGLBoolean (EGLAPIENTRYP PFNEGLSTREAMCONSUMERRELEASEATTRIBNVPROC) (EGLDisplay dpy, EGLStreamKHR stream, const EGLAttrib *attrib_list); #endif +#ifndef EGL_NV_output_drm_flip_event +#define EGL_NV_output_drm_flip_event 1 +#define EGL_DRM_FLIP_EVENT_DATA_NV 0x333E +#endif + QT_BEGIN_NAMESPACE class QEGLStreamConvenience diff --git a/src/platformsupport/eventdispatchers/qeventdispatcher_glib_p.h b/src/platformsupport/eventdispatchers/qeventdispatcher_glib_p.h index 085a1c52f3..b9254d3071 100644 --- a/src/platformsupport/eventdispatchers/qeventdispatcher_glib_p.h +++ b/src/platformsupport/eventdispatchers/qeventdispatcher_glib_p.h @@ -64,7 +64,7 @@ class QPAEventDispatcherGlib : public QEventDispatcherGlib Q_DECLARE_PRIVATE(QPAEventDispatcherGlib) public: - explicit QPAEventDispatcherGlib(QObject *parent = 0); + explicit QPAEventDispatcherGlib(QObject *parent = nullptr); ~QPAEventDispatcherGlib(); bool processEvents(QEventLoop::ProcessEventsFlags flags) override; @@ -77,7 +77,7 @@ class QPAEventDispatcherGlibPrivate : public QEventDispatcherGlibPrivate { Q_DECLARE_PUBLIC(QPAEventDispatcherGlib) public: - QPAEventDispatcherGlibPrivate(GMainContext *context = 0); + QPAEventDispatcherGlibPrivate(GMainContext *context = nullptr); GUserEventSource *userEventSource; }; diff --git a/src/platformsupport/eventdispatchers/qunixeventdispatcher_qpa_p.h b/src/platformsupport/eventdispatchers/qunixeventdispatcher_qpa_p.h index 7f775b73ee..8157b8793d 100644 --- a/src/platformsupport/eventdispatchers/qunixeventdispatcher_qpa_p.h +++ b/src/platformsupport/eventdispatchers/qunixeventdispatcher_qpa_p.h @@ -61,7 +61,7 @@ class QUnixEventDispatcherQPA : public QEventDispatcherUNIX Q_OBJECT public: - explicit QUnixEventDispatcherQPA(QObject *parent = 0); + explicit QUnixEventDispatcherQPA(QObject *parent = nullptr); ~QUnixEventDispatcherQPA(); bool processEvents(QEventLoop::ProcessEventsFlags flags); diff --git a/src/platformsupport/fbconvenience/qfbvthandler_p.h b/src/platformsupport/fbconvenience/qfbvthandler_p.h index 17d07317b2..d565ec3632 100644 --- a/src/platformsupport/fbconvenience/qfbvthandler_p.h +++ b/src/platformsupport/fbconvenience/qfbvthandler_p.h @@ -63,7 +63,7 @@ class QFbVtHandler : public QObject Q_OBJECT public: - QFbVtHandler(QObject *parent = 0); + QFbVtHandler(QObject *parent = nullptr); ~QFbVtHandler(); signals: diff --git a/src/platformsupport/fontdatabases/freetype/qfontengine_ft.cpp b/src/platformsupport/fontdatabases/freetype/qfontengine_ft.cpp index 381db1ed12..40db7dbac7 100644 --- a/src/platformsupport/fontdatabases/freetype/qfontengine_ft.cpp +++ b/src/platformsupport/fontdatabases/freetype/qfontengine_ft.cpp @@ -121,13 +121,12 @@ class QtFreetypeData { public: QtFreetypeData() - : library(0), hasPatentFreeLcdRendering(false) + : library(0) { } ~QtFreetypeData(); FT_Library library; QHash<QFontEngine::FaceId, QFreetypeFace *> faces; - bool hasPatentFreeLcdRendering; }; QtFreetypeData::~QtFreetypeData() @@ -153,11 +152,6 @@ QtFreetypeData *qt_getFreetypeData() FT_Bool no_darkening = false; FT_Property_Set(freetypeData->library, "cff", "no-stem-darkening", &no_darkening); #endif - // FreeType has since 2.8.1 a patent free alternative to LCD-filtering. - FT_Int amajor, aminor = 0, apatch = 0; - FT_Library_Version(freetypeData->library, &amajor, &aminor, &apatch); - if (QT_VERSION_CHECK(amajor, aminor, apatch) >= QT_VERSION_CHECK(2, 8, 1)) - freetypeData->hasPatentFreeLcdRendering = true; } return freetypeData; } @@ -561,26 +555,7 @@ QFontEngineFT::Glyph::~Glyph() delete [] data; } -struct LcdFilterDummy -{ - static inline void filterPixel(uchar &, uchar &, uchar &) - {} -}; - -struct LcdFilterLegacy -{ - static inline void filterPixel(uchar &red, uchar &green, uchar &blue) - { - uint r = red, g = green, b = blue; - // intra-pixel filter used by the legacy filter (adopted from _ft_lcd_filter_legacy) - red = (r * uint(65538 * 9/13) + g * uint(65538 * 1/6) + b * uint(65538 * 1/13)) / 65536; - green = (r * uint(65538 * 3/13) + g * uint(65538 * 4/6) + b * uint(65538 * 3/13)) / 65536; - blue = (r * uint(65538 * 1/13) + g * uint(65538 * 1/6) + b * uint(65538 * 9/13)) / 65536; - } -}; - -template <typename LcdFilter> -static void convertRGBToARGB_helper(const uchar *src, uint *dst, int width, int height, int src_pitch, bool bgr) +static inline void convertRGBToARGB(const uchar *src, uint *dst, int width, int height, int src_pitch, bool bgr) { const int offs = bgr ? -1 : 1; const int w = width * 3; @@ -590,7 +565,6 @@ static void convertRGBToARGB_helper(const uchar *src, uint *dst, int width, int uchar red = src[x + 1 - offs]; uchar green = src[x + 1]; uchar blue = src[x + 1 + offs]; - LcdFilter::filterPixel(red, green, blue); *dd++ = (0xFFU << 24) | (red << 16) | (green << 8) | blue; } dst += width; @@ -598,16 +572,7 @@ static void convertRGBToARGB_helper(const uchar *src, uint *dst, int width, int } } -static inline void convertRGBToARGB(const uchar *src, uint *dst, int width, int height, int src_pitch, bool bgr, bool legacyFilter) -{ - if (!legacyFilter) - convertRGBToARGB_helper<LcdFilterDummy>(src, dst, width, height, src_pitch, bgr); - else - convertRGBToARGB_helper<LcdFilterLegacy>(src, dst, width, height, src_pitch, bgr); -} - -template <typename LcdFilter> -static void convertRGBToARGB_V_helper(const uchar *src, uint *dst, int width, int height, int src_pitch, bool bgr) +static inline void convertRGBToARGB_V(const uchar *src, uint *dst, int width, int height, int src_pitch, bool bgr) { const int offs = bgr ? -src_pitch : src_pitch; while (height--) { @@ -615,54 +580,12 @@ static void convertRGBToARGB_V_helper(const uchar *src, uint *dst, int width, in uchar red = src[x + src_pitch - offs]; uchar green = src[x + src_pitch]; uchar blue = src[x + src_pitch + offs]; - LcdFilter::filterPixel(red, green, blue); *dst++ = (0XFFU << 24) | (red << 16) | (green << 8) | blue; } src += 3*src_pitch; } } -static inline void convertRGBToARGB_V(const uchar *src, uint *dst, int width, int height, int src_pitch, bool bgr, bool legacyFilter) -{ - if (!legacyFilter) - convertRGBToARGB_V_helper<LcdFilterDummy>(src, dst, width, height, src_pitch, bgr); - else - convertRGBToARGB_V_helper<LcdFilterLegacy>(src, dst, width, height, src_pitch, bgr); -} - -static inline void convertGRAYToARGB(const uchar *src, uint *dst, int width, int height, int src_pitch) -{ - while (height--) { - const uchar *p = src; - const uchar * const e = p + width; - while (p < e) { - uchar gray = *p++; - *dst++ = (0xFFU << 24) | (gray << 16) | (gray << 8) | gray; - } - src += src_pitch; - } -} - -static void convoluteBitmap(const uchar *src, uchar *dst, int width, int height, int pitch) -{ - // convolute the bitmap with a triangle filter to get rid of color fringes - // If we take account for a gamma value of 2, we end up with - // weights of 1, 4, 9, 4, 1. We use an approximation of 1, 3, 8, 3, 1 here, - // as this nicely sums up to 16 :) - int h = height; - while (h--) { - dst[0] = dst[1] = 0; - // - for (int x = 2; x < width - 2; ++x) { - uint sum = src[x-2] + 3*src[x-1] + 8*src[x] + 3*src[x+1] + src[x+2]; - dst[x] = (uchar) (sum >> 4); - } - dst[width - 2] = dst[width - 1] = 0; - src += pitch; - dst += pitch; - } -} - static QFontEngine::SubpixelAntialiasingType subpixelAntialiasingTypeHint() { static int type = -1; @@ -1153,196 +1076,97 @@ QFontEngineFT::Glyph *QFontEngineFT::loadGlyph(QGlyphSet *set, uint glyph, int glyph_buffer_size = 0; QScopedArrayPointer<uchar> glyph_buffer; - bool useFreetypeRenderGlyph = false; - if (slot->format == FT_GLYPH_FORMAT_OUTLINE && (hsubpixel || vfactor != 1)) { - err = FT_Library_SetLcdFilter(slot->library, (FT_LcdFilter)lcdFilterType); - // We use FT_Render_Glyph if freetype has support for lcd-filtering - // or is version 2.8.1 or higher and can do without. - if (err == FT_Err_Ok || qt_getFreetypeData()->hasPatentFreeLcdRendering) - useFreetypeRenderGlyph = true; + FT_Render_Mode renderMode = (default_hint_style == HintLight) ? FT_RENDER_MODE_LIGHT : FT_RENDER_MODE_NORMAL; + switch (format) { + case Format_Mono: + renderMode = FT_RENDER_MODE_MONO; + break; + case Format_A32: + Q_ASSERT(hsubpixel || vfactor != 1); + renderMode = hsubpixel ? FT_RENDER_MODE_LCD : FT_RENDER_MODE_LCD_V; + break; + case Format_A8: + case Format_ARGB: + break; + default: + Q_UNREACHABLE(); } - if (useFreetypeRenderGlyph) { - err = FT_Render_Glyph(slot, hsubpixel ? FT_RENDER_MODE_LCD : FT_RENDER_MODE_LCD_V); - - if (err != FT_Err_Ok) - qWarning("render glyph failed err=%x face=%p, glyph=%d", err, face, glyph); - - FT_Library_SetLcdFilter(slot->library, FT_LCD_FILTER_NONE); + FT_Library_SetLcdFilter(slot->library, (FT_LcdFilter)lcdFilterType); - info.height = slot->bitmap.rows / vfactor; - info.width = hsubpixel ? slot->bitmap.width / 3 : slot->bitmap.width; - info.x = slot->bitmap_left; - info.y = slot->bitmap_top; + err = FT_Render_Glyph(slot, renderMode); + if (err != FT_Err_Ok) + qWarning("render glyph failed err=%x face=%p, glyph=%d", err, face, glyph); - glyph_buffer_size = info.width * info.height * 4; - glyph_buffer.reset(new uchar[glyph_buffer_size]); + FT_Library_SetLcdFilter(slot->library, FT_LCD_FILTER_NONE); - if (hsubpixel) - convertRGBToARGB(slot->bitmap.buffer, (uint *)glyph_buffer.data(), info.width, info.height, slot->bitmap.pitch, subpixelType != Subpixel_RGB, false); - else if (vfactor != 1) - convertRGBToARGB_V(slot->bitmap.buffer, (uint *)glyph_buffer.data(), info.width, info.height, slot->bitmap.pitch, subpixelType != Subpixel_VRGB, false); - } else { - int left = slot->metrics.horiBearingX; - int right = slot->metrics.horiBearingX + slot->metrics.width; - int top = slot->metrics.horiBearingY; - int bottom = slot->metrics.horiBearingY - slot->metrics.height; - if (transform && slot->format != FT_GLYPH_FORMAT_BITMAP) - transformBoundingBox(&left, &top, &right, &bottom, &matrix); - left = FLOOR(left); - right = CEIL(right); - bottom = FLOOR(bottom); - top = CEIL(top); - - int hpixels = TRUNC(right - left); - // subpixel position requires one more pixel - if (subPixelPosition > 0 && format != Format_Mono) - hpixels++; - - if (hsubpixel) - hpixels = hpixels*3 + 8; - info.width = hpixels; - info.height = TRUNC(top - bottom); - info.x = TRUNC(left); - info.y = TRUNC(top); - if (hsubpixel) { - info.width /= 3; - info.x -= 1; - } - - // If any of the metrics are too large to fit, don't cache them - if (areMetricsTooLarge(info)) - return 0; + info.height = slot->bitmap.rows; + info.width = slot->bitmap.width; + info.x = slot->bitmap_left; + info.y = slot->bitmap_top; + if (slot->bitmap.pixel_mode == FT_PIXEL_MODE_LCD) + info.width = info.width / 3; + if (slot->bitmap.pixel_mode == FT_PIXEL_MODE_LCD_V) + info.height = info.height / vfactor; int pitch = (format == Format_Mono ? ((info.width + 31) & ~31) >> 3 : (format == Format_A8 ? (info.width + 3) & ~3 : info.width * 4)); - if (glyph_buffer_size < pitch * info.height) { - glyph_buffer_size = pitch * info.height; - glyph_buffer.reset(new uchar[glyph_buffer_size]); - memset(glyph_buffer.data(), 0, glyph_buffer_size); - } - if (slot->format == FT_GLYPH_FORMAT_OUTLINE) { - FT_Bitmap bitmap; - bitmap.rows = info.height*vfactor; - bitmap.width = hpixels; - bitmap.pitch = format == Format_Mono ? (((info.width + 31) & ~31) >> 3) : ((bitmap.width + 3) & ~3); - int bitmap_buffer_size = bitmap.rows * bitmap.pitch; - if (!hsubpixel && vfactor == 1 && format != Format_A32) { - Q_ASSERT(glyph_buffer_size <= bitmap_buffer_size); - bitmap.buffer = glyph_buffer.data(); - } else { - bitmap.buffer = new uchar[bitmap_buffer_size]; - memset(bitmap.buffer, 0, bitmap_buffer_size); - } - bitmap.pixel_mode = format == Format_Mono ? FT_PIXEL_MODE_MONO : FT_PIXEL_MODE_GRAY; - FT_Matrix matrix; - matrix.xx = (hsubpixel ? 3 : 1) << 16; - matrix.yy = vfactor << 16; - matrix.yx = matrix.xy = 0; - - FT_Outline_Transform(&slot->outline, &matrix); - FT_Outline_Translate (&slot->outline, (hsubpixel ? -3*left +(4<<6) : -left), -bottom*vfactor); - FT_Outline_Get_Bitmap(slot->library, &slot->outline, &bitmap); - if (hsubpixel) { - Q_ASSERT (bitmap.pixel_mode == FT_PIXEL_MODE_GRAY); - Q_ASSERT(antialias); - uchar *convoluted = new uchar[bitmap_buffer_size]; - bool useLegacyLcdFilter = false; - useLegacyLcdFilter = (lcdFilterType == FT_LCD_FILTER_LEGACY); - uchar *buffer = bitmap.buffer; - if (!useLegacyLcdFilter) { - convoluteBitmap(bitmap.buffer, convoluted, bitmap.width, info.height, bitmap.pitch); - buffer = convoluted; - } - convertRGBToARGB(buffer + 1, (uint *)glyph_buffer.data(), info.width, info.height, bitmap.pitch, subpixelType != Subpixel_RGB, useLegacyLcdFilter); - delete [] convoluted; - } else if (vfactor != 1) { - convertRGBToARGB_V(bitmap.buffer, (uint *)glyph_buffer.data(), info.width, info.height, bitmap.pitch, subpixelType != Subpixel_VRGB, true); - } else if (format == Format_A32 && bitmap.pixel_mode == FT_PIXEL_MODE_GRAY) { - convertGRAYToARGB(bitmap.buffer, (uint *)glyph_buffer.data(), info.width, info.height, bitmap.pitch); - } + glyph_buffer_size = info.height * pitch; + glyph_buffer.reset(new uchar[glyph_buffer_size]); - if (bitmap.buffer != glyph_buffer.data()) - delete [] bitmap.buffer; - } else if (slot->format == FT_GLYPH_FORMAT_BITMAP) { -#if ((FREETYPE_MAJOR*10000 + FREETYPE_MINOR*100) >= 20500) - Q_ASSERT(slot->bitmap.pixel_mode == FT_PIXEL_MODE_MONO || slot->bitmap.pixel_mode == FT_PIXEL_MODE_BGRA); -#else - Q_ASSERT(slot->bitmap.pixel_mode == FT_PIXEL_MODE_MONO); -#endif + if (slot->bitmap.pixel_mode == FT_PIXEL_MODE_MONO) { + Q_ASSERT(format == Format_Mono); uchar *src = slot->bitmap.buffer; uchar *dst = glyph_buffer.data(); int h = slot->bitmap.rows; - if (format == Format_Mono) { - int bytes = ((info.width + 7) & ~7) >> 3; - while (h--) { - memcpy (dst, src, bytes); - dst += pitch; - src += slot->bitmap.pitch; - } - } else if (slot->bitmap.pixel_mode == FT_PIXEL_MODE_MONO) { - if (hsubpixel) { - while (h--) { - uint *dd = (uint *)dst; - *dd++ = 0; - for (int x = 0; x < static_cast<int>(slot->bitmap.width); x++) { - uint a = ((src[x >> 3] & (0x80 >> (x & 7))) ? 0xffffff : 0x000000); - *dd++ = a; - } - *dd++ = 0; - dst += pitch; - src += slot->bitmap.pitch; - } - } else if (vfactor != 1) { - while (h--) { - uint *dd = (uint *)dst; - for (int x = 0; x < static_cast<int>(slot->bitmap.width); x++) { - uint a = ((src[x >> 3] & (0x80 >> (x & 7))) ? 0xffffff : 0x000000); - *dd++ = a; - } - dst += pitch; - src += slot->bitmap.pitch; - } - } else { - while (h--) { - for (int x = 0; x < static_cast<int>(slot->bitmap.width); x++) { - unsigned char a = ((src[x >> 3] & (0x80 >> (x & 7))) ? 0xff : 0x00); - dst[x] = a; - } - dst += pitch; - src += slot->bitmap.pitch; - } - } + + int bytes = ((info.width + 7) & ~7) >> 3; + while (h--) { + memcpy (dst, src, bytes); + dst += pitch; + src += slot->bitmap.pitch; } -#if ((FREETYPE_MAJOR*10000 + FREETYPE_MINOR*100) >= 20500) - else if (slot->bitmap.pixel_mode == FT_PIXEL_MODE_BGRA) - { - while (h--) { + } else if (slot->bitmap.pixel_mode == 7 /*FT_PIXEL_MODE_BGRA*/) { + Q_ASSERT(format == Format_ARGB); + uchar *src = slot->bitmap.buffer; + uchar *dst = glyph_buffer.data(); + int h = slot->bitmap.rows; + while (h--) { #if Q_BYTE_ORDER == Q_BIG_ENDIAN - const quint32 *srcPixel = (const quint32 *)src; - quint32 *dstPixel = (quint32 *)dst; - for (int x = 0; x < static_cast<int>(slot->bitmap.width); x++, srcPixel++, dstPixel++) { - const quint32 pixel = *srcPixel; - *dstPixel = qbswap(pixel); - } + const quint32 *srcPixel = (const quint32 *)src; + quint32 *dstPixel = (quint32 *)dst; + for (int x = 0; x < static_cast<int>(slot->bitmap.width); x++, srcPixel++, dstPixel++) { + const quint32 pixel = *srcPixel; + *dstPixel = qbswap(pixel); + } #else - memcpy(dst, src, slot->bitmap.width * 4); + memcpy(dst, src, slot->bitmap.width * 4); #endif - dst += slot->bitmap.pitch; - src += slot->bitmap.pitch; - } - info.width = info.linearAdvance = info.xOff = slot->bitmap.width; - info.height = slot->bitmap.rows; - info.x = slot->bitmap_left; - info.y = slot->bitmap_top; + dst += slot->bitmap.pitch; + src += slot->bitmap.pitch; } -#endif + info.linearAdvance = info.xOff = slot->bitmap.width; + } else if (slot->bitmap.pixel_mode == FT_PIXEL_MODE_GRAY) { + Q_ASSERT(format == Format_A8); + uchar *src = slot->bitmap.buffer; + uchar *dst = glyph_buffer.data(); + int h = slot->bitmap.rows; + int bytes = info.width; + while (h--) { + memcpy (dst, src, bytes); + dst += pitch; + src += slot->bitmap.pitch; + } + } else if (slot->bitmap.pixel_mode == FT_PIXEL_MODE_LCD) { + Q_ASSERT(format == Format_A32); + convertRGBToARGB(slot->bitmap.buffer, (uint *)glyph_buffer.data(), info.width, info.height, slot->bitmap.pitch, subpixelType != Subpixel_RGB); + } else if (slot->bitmap.pixel_mode == FT_PIXEL_MODE_LCD_V) { + Q_ASSERT(format == Format_A32); + convertRGBToARGB_V(slot->bitmap.buffer, (uint *)glyph_buffer.data(), info.width, info.height, slot->bitmap.pitch, subpixelType != Subpixel_VRGB); } else { - qWarning("QFontEngine: Glyph neither outline nor bitmap format=%d", slot->format); + qWarning("QFontEngine: Glyph rendered in unknown pixel_mode=%d", slot->bitmap.pixel_mode); return 0; } - } - if (!g) { g = new Glyph; diff --git a/src/platformsupport/fontdatabases/freetype/qfontengine_ft_p.h b/src/platformsupport/fontdatabases/freetype/qfontengine_ft_p.h index d498b0ac8b..2d1d5e6572 100644 --- a/src/platformsupport/fontdatabases/freetype/qfontengine_ft_p.h +++ b/src/platformsupport/fontdatabases/freetype/qfontengine_ft_p.h @@ -268,7 +268,7 @@ private: inline bool isScalableBitmap() const { return freetype->isScalableBitmap(); } inline Glyph *loadGlyph(uint glyph, QFixed subPixelPosition, GlyphFormat format = Format_None, bool fetchMetricsOnly = false, bool disableOutlineDrawing = false) const - { return loadGlyph(cacheEnabled ? &defaultGlyphSet : 0, glyph, subPixelPosition, format, fetchMetricsOnly, disableOutlineDrawing); } + { return loadGlyph(cacheEnabled ? &defaultGlyphSet : nullptr, glyph, subPixelPosition, format, fetchMetricsOnly, disableOutlineDrawing); } Glyph *loadGlyph(QGlyphSet *set, uint glyph, QFixed subPixelPosition, GlyphFormat = Format_None, bool fetchMetricsOnly = false, bool disableOutlineDrawing = false) const; Glyph *loadGlyphFor(glyph_t g, QFixed subPixelPosition, GlyphFormat format, const QTransform &t, bool fetchBoundingBox = false, bool disableOutlineDrawing = false); diff --git a/src/platformsupport/input/evdevkeyboard/qevdevkeyboardmanager_p.h b/src/platformsupport/input/evdevkeyboard/qevdevkeyboardmanager_p.h index 326e438a7c..01b7e9fc0e 100644 --- a/src/platformsupport/input/evdevkeyboard/qevdevkeyboardmanager_p.h +++ b/src/platformsupport/input/evdevkeyboard/qevdevkeyboardmanager_p.h @@ -64,7 +64,7 @@ QT_BEGIN_NAMESPACE class QEvdevKeyboardManager : public QObject { public: - QEvdevKeyboardManager(const QString &key, const QString &specification, QObject *parent = 0); + QEvdevKeyboardManager(const QString &key, const QString &specification, QObject *parent = nullptr); ~QEvdevKeyboardManager(); void loadKeymap(const QString &file); diff --git a/src/platformsupport/input/evdevmouse/qevdevmousemanager_p.h b/src/platformsupport/input/evdevmouse/qevdevmousemanager_p.h index 13a8e3dec5..c63ca29a71 100644 --- a/src/platformsupport/input/evdevmouse/qevdevmousemanager_p.h +++ b/src/platformsupport/input/evdevmouse/qevdevmousemanager_p.h @@ -65,7 +65,7 @@ class QDeviceDiscovery; class QEvdevMouseManager : public QObject { public: - QEvdevMouseManager(const QString &key, const QString &specification, QObject *parent = 0); + QEvdevMouseManager(const QString &key, const QString &specification, QObject *parent = nullptr); ~QEvdevMouseManager(); void handleMouseEvent(int x, int y, bool abs, Qt::MouseButtons buttons, diff --git a/src/platformsupport/input/evdevtablet/qevdevtablethandler_p.h b/src/platformsupport/input/evdevtablet/qevdevtablethandler_p.h index 66e821117a..b83bb21258 100644 --- a/src/platformsupport/input/evdevtablet/qevdevtablethandler_p.h +++ b/src/platformsupport/input/evdevtablet/qevdevtablethandler_p.h @@ -64,7 +64,7 @@ class QEvdevTabletData; class QEvdevTabletHandler : public QObject { public: - explicit QEvdevTabletHandler(const QString &device, const QString &spec = QString(), QObject *parent = 0); + explicit QEvdevTabletHandler(const QString &device, const QString &spec = QString(), QObject *parent = nullptr); ~QEvdevTabletHandler(); qint64 deviceId() const; @@ -83,7 +83,7 @@ private: class QEvdevTabletHandlerThread : public QDaemonThread { public: - explicit QEvdevTabletHandlerThread(const QString &device, const QString &spec, QObject *parent = 0); + explicit QEvdevTabletHandlerThread(const QString &device, const QString &spec, QObject *parent = nullptr); ~QEvdevTabletHandlerThread(); void run() override; QEvdevTabletHandler *handler() { return m_handler; } diff --git a/src/platformsupport/input/evdevtablet/qevdevtabletmanager_p.h b/src/platformsupport/input/evdevtablet/qevdevtabletmanager_p.h index cde91c55aa..b598156e52 100644 --- a/src/platformsupport/input/evdevtablet/qevdevtabletmanager_p.h +++ b/src/platformsupport/input/evdevtablet/qevdevtabletmanager_p.h @@ -63,7 +63,7 @@ class QEvdevTabletHandlerThread; class QEvdevTabletManager : public QObject { public: - QEvdevTabletManager(const QString &key, const QString &spec, QObject *parent = 0); + QEvdevTabletManager(const QString &key, const QString &spec, QObject *parent = nullptr); ~QEvdevTabletManager(); void addDevice(const QString &deviceNode); diff --git a/src/platformsupport/input/evdevtouch/qevdevtouchmanager_p.h b/src/platformsupport/input/evdevtouch/qevdevtouchmanager_p.h index e524c516f1..b9b772fb3a 100644 --- a/src/platformsupport/input/evdevtouch/qevdevtouchmanager_p.h +++ b/src/platformsupport/input/evdevtouch/qevdevtouchmanager_p.h @@ -63,7 +63,7 @@ class QEvdevTouchScreenHandlerThread; class QEvdevTouchManager : public QObject { public: - QEvdevTouchManager(const QString &key, const QString &spec, QObject *parent = 0); + QEvdevTouchManager(const QString &key, const QString &spec, QObject *parent = nullptr); ~QEvdevTouchManager(); void addDevice(const QString &deviceNode); diff --git a/src/platformsupport/input/libinput/qlibinputtouch_p.h b/src/platformsupport/input/libinput/qlibinputtouch_p.h index 6f88001d19..51304e6a21 100644 --- a/src/platformsupport/input/libinput/qlibinputtouch_p.h +++ b/src/platformsupport/input/libinput/qlibinputtouch_p.h @@ -73,7 +73,7 @@ public: private: struct DeviceState { - DeviceState() : m_touchDevice(0) { } + DeviceState() : m_touchDevice(nullptr) { } QWindowSystemInterface::TouchPoint *point(int32_t slot); QList<QWindowSystemInterface::TouchPoint> m_points; QTouchDevice *m_touchDevice; diff --git a/src/platformsupport/input/tslib/qtslib.cpp b/src/platformsupport/input/tslib/qtslib.cpp index 84a468f60c..f8fdc151ec 100644 --- a/src/platformsupport/input/tslib/qtslib.cpp +++ b/src/platformsupport/input/tslib/qtslib.cpp @@ -57,7 +57,7 @@ QTsLibMouseHandler::QTsLibMouseHandler(const QString &key, const QString &specification, QObject *parent) : QObject(parent), - m_notify(0), m_x(0), m_y(0), m_pressed(0), m_rawMode(false) + m_rawMode(!key.compare(QLatin1String("TslibRaw"), Qt::CaseInsensitive)) { qCDebug(qLcTsLib) << "Initializing tslib plugin" << key << specification; setObjectName(QLatin1String("TSLib Mouse Handler")); @@ -79,8 +79,6 @@ QTsLibMouseHandler::QTsLibMouseHandler(const QString &key, if (ts_config(m_dev)) qErrnoWarning(errno, "ts_config() failed"); - m_rawMode = !key.compare(QLatin1String("TslibRaw"), Qt::CaseInsensitive); - int fd = ts_fd(m_dev); if (fd >= 0) { qCDebug(qLcTsLib) << "tslib device is" << device; diff --git a/src/platformsupport/input/tslib/qtslib_p.h b/src/platformsupport/input/tslib/qtslib_p.h index 0c08fb6a3d..ffd60cd0e3 100644 --- a/src/platformsupport/input/tslib/qtslib_p.h +++ b/src/platformsupport/input/tslib/qtslib_p.h @@ -71,11 +71,12 @@ private slots: void readMouseData(); private: - QSocketNotifier * m_notify; + QSocketNotifier * m_notify = nullptr; tsdev *m_dev; - int m_x, m_y; - bool m_pressed; - bool m_rawMode; + int m_x = 0; + int m_y = 0; + bool m_pressed = false; + const bool m_rawMode; }; QT_END_NAMESPACE diff --git a/src/platformsupport/kmsconvenience/qkmsdevice.cpp b/src/platformsupport/kmsconvenience/qkmsdevice.cpp index ef81f6162d..4b27522976 100644 --- a/src/platformsupport/kmsconvenience/qkmsdevice.cpp +++ b/src/platformsupport/kmsconvenience/qkmsdevice.cpp @@ -777,9 +777,7 @@ void QKmsDevice::discoverPlanes() for (int i = 0; i < countFormats; ++i) { uint32_t f = drmplane->formats[i]; plane.supportedFormats.append(f); - QString s; - s.sprintf("%c%c%c%c ", f, f >> 8, f >> 16, f >> 24); - formatStr += s; + formatStr += QString::asprintf("%c%c%c%c ", f, f >> 8, f >> 16, f >> 24); } qCDebug(qLcKmsDebug, "plane %d: id = %u countFormats = %d possibleCrtcs = 0x%x supported formats = %s", diff --git a/src/platformsupport/linuxaccessibility/atspiadaptor_p.h b/src/platformsupport/linuxaccessibility/atspiadaptor_p.h index b5704f53ad..0b624389a3 100644 --- a/src/platformsupport/linuxaccessibility/atspiadaptor_p.h +++ b/src/platformsupport/linuxaccessibility/atspiadaptor_p.h @@ -76,7 +76,7 @@ class AtSpiAdaptor :public QDBusVirtualObject Q_OBJECT public: - explicit AtSpiAdaptor(DBusConnection *connection, QObject *parent = 0); + explicit AtSpiAdaptor(DBusConnection *connection, QObject *parent = nullptr); ~AtSpiAdaptor(); void registerApplication(); diff --git a/src/platformsupport/linuxaccessibility/cache_p.h b/src/platformsupport/linuxaccessibility/cache_p.h index e8529b779b..cc55acc6f8 100644 --- a/src/platformsupport/linuxaccessibility/cache_p.h +++ b/src/platformsupport/linuxaccessibility/cache_p.h @@ -65,7 +65,7 @@ class QSpiDBusCache : public QObject Q_OBJECT public: - explicit QSpiDBusCache(QDBusConnection c, QObject* parent = 0); + explicit QSpiDBusCache(QDBusConnection c, QObject* parent = nullptr); void emitAddAccessible(const QSpiAccessibleCacheItem& item); void emitRemoveAccessible(const QSpiObjectReference& item); diff --git a/src/platformsupport/linuxaccessibility/dbusconnection_p.h b/src/platformsupport/linuxaccessibility/dbusconnection_p.h index 4030fabc22..860c18ca05 100644 --- a/src/platformsupport/linuxaccessibility/dbusconnection_p.h +++ b/src/platformsupport/linuxaccessibility/dbusconnection_p.h @@ -65,7 +65,7 @@ class DBusConnection : public QObject Q_OBJECT public: - DBusConnection(QObject *parent = 0); + DBusConnection(QObject *parent = nullptr); QDBusConnection connection() const; bool isEnabled() const { return m_enabled; } diff --git a/src/platformsupport/themes/genericunix/dbusmenu/qdbusmenuconnection_p.h b/src/platformsupport/themes/genericunix/dbusmenu/qdbusmenuconnection_p.h index c7c3f4bc5b..565af6c947 100644 --- a/src/platformsupport/themes/genericunix/dbusmenu/qdbusmenuconnection_p.h +++ b/src/platformsupport/themes/genericunix/dbusmenu/qdbusmenuconnection_p.h @@ -67,7 +67,7 @@ class QDBusMenuConnection : public QObject Q_OBJECT public: - QDBusMenuConnection(QObject *parent = 0, const QString &serviceName = QString()); + QDBusMenuConnection(QObject *parent = nullptr, const QString &serviceName = QString()); QDBusConnection connection() const { return m_connection; } QDBusServiceWatcher *dbusWatcher() const { return m_dbusWatcher; } bool isStatusNotifierHostRegistered() const { return m_statusNotifierHostRegistered; } diff --git a/src/platformsupport/themes/genericunix/dbustray/qxdgnotificationproxy_p.h b/src/platformsupport/themes/genericunix/dbustray/qxdgnotificationproxy_p.h index 352b4aa5d6..ab99ea65dd 100644 --- a/src/platformsupport/themes/genericunix/dbustray/qxdgnotificationproxy_p.h +++ b/src/platformsupport/themes/genericunix/dbustray/qxdgnotificationproxy_p.h @@ -88,7 +88,7 @@ public: public: QXdgNotificationInterface(const QString &service, const QString &path, - const QDBusConnection &connection, QObject *parent = 0); + const QDBusConnection &connection, QObject *parent = nullptr); ~QXdgNotificationInterface(); diff --git a/src/platformsupport/themes/genericunix/qgenericunixthemes.cpp b/src/platformsupport/themes/genericunix/qgenericunixthemes.cpp index 1003812767..7b3f9b624a 100644 --- a/src/platformsupport/themes/genericunix/qgenericunixthemes.cpp +++ b/src/platformsupport/themes/genericunix/qgenericunixthemes.cpp @@ -172,15 +172,9 @@ QStringList QGenericUnixTheme::xdgIconThemePaths() if (homeIconDir.isDir()) paths.prepend(homeIconDir.absoluteFilePath()); - QString xdgDirString = QFile::decodeName(qgetenv("XDG_DATA_DIRS")); - if (xdgDirString.isEmpty()) - xdgDirString = QLatin1String("/usr/local/share/:/usr/share/"); - const auto xdgDirs = xdgDirString.splitRef(QLatin1Char(':')); - for (const QStringRef &xdgDir : xdgDirs) { - const QFileInfo xdgIconsDir(xdgDir + QLatin1String("/icons")); - if (xdgIconsDir.isDir()) - paths.append(xdgIconsDir.absoluteFilePath()); - } + paths.append(QStandardPaths::locateAll(QStandardPaths::GenericDataLocation, + QStringLiteral("icons"), + QStandardPaths::LocateDirectory)); return paths; } diff --git a/src/platformsupport/themes/genericunix/qgenericunixthemes_p.h b/src/platformsupport/themes/genericunix/qgenericunixthemes_p.h index a5963b79ea..c0da9d8370 100644 --- a/src/platformsupport/themes/genericunix/qgenericunixthemes_p.h +++ b/src/platformsupport/themes/genericunix/qgenericunixthemes_p.h @@ -109,7 +109,7 @@ public: QVariant themeHint(ThemeHint hint) const override; QIcon fileIcon(const QFileInfo &fileInfo, - QPlatformTheme::IconOptions iconOptions = 0) const override; + QPlatformTheme::IconOptions iconOptions = nullptr) const override; const QPalette *palette(Palette type = SystemPalette) const override; @@ -134,7 +134,7 @@ public: QGnomeTheme(); QVariant themeHint(ThemeHint hint) const override; QIcon fileIcon(const QFileInfo &fileInfo, - QPlatformTheme::IconOptions = 0) const override; + QPlatformTheme::IconOptions = nullptr) const override; const QFont *font(Font type) const override; QString standardButtonText(int button) const override; diff --git a/src/plugins/bearer/connman/qconnmanengine.h b/src/plugins/bearer/connman/qconnmanengine.h index c9ff17f801..ef80d38fa2 100644 --- a/src/plugins/bearer/connman/qconnmanengine.h +++ b/src/plugins/bearer/connman/qconnmanengine.h @@ -68,7 +68,7 @@ class QConnmanEngine : public QBearerEngineImpl Q_OBJECT public: - QConnmanEngine(QObject *parent = 0); + QConnmanEngine(QObject *parent = nullptr); ~QConnmanEngine(); bool connmanAvailable() const; diff --git a/src/plugins/bearer/connman/qconnmanservice_linux_p.h b/src/plugins/bearer/connman/qconnmanservice_linux_p.h index d2804ebca6..790325f9a1 100644 --- a/src/plugins/bearer/connman/qconnmanservice_linux_p.h +++ b/src/plugins/bearer/connman/qconnmanservice_linux_p.h @@ -105,7 +105,7 @@ class QConnmanManagerInterface : public QDBusAbstractInterface public: - QConnmanManagerInterface( QObject *parent = 0); + QConnmanManagerInterface( QObject *parent = nullptr); ~QConnmanManagerInterface(); QDBusObjectPath path() const; @@ -155,7 +155,7 @@ class QConnmanServiceInterface : public QDBusAbstractInterface public: - explicit QConnmanServiceInterface(const QString &dbusPathName,QObject *parent = 0); + explicit QConnmanServiceInterface(const QString &dbusPathName,QObject *parent = nullptr); ~QConnmanServiceInterface(); QVariantMap getProperties(); @@ -202,7 +202,7 @@ class QConnmanTechnologyInterface : public QDBusAbstractInterface public: - explicit QConnmanTechnologyInterface(const QString &dbusPathName,QObject *parent = 0); + explicit QConnmanTechnologyInterface(const QString &dbusPathName,QObject *parent = nullptr); ~QConnmanTechnologyInterface(); QString type(); diff --git a/src/plugins/bearer/generic/qgenericengine.h b/src/plugins/bearer/generic/qgenericengine.h index 08960d66f6..79c71ca7a3 100644 --- a/src/plugins/bearer/generic/qgenericengine.h +++ b/src/plugins/bearer/generic/qgenericengine.h @@ -55,7 +55,7 @@ class QGenericEngine : public QBearerEngineImpl Q_OBJECT public: - QGenericEngine(QObject *parent = 0); + QGenericEngine(QObject *parent = nullptr); ~QGenericEngine(); QString getInterfaceFromId(const QString &id) override; diff --git a/src/plugins/bearer/linux_common/qofonoservice_linux_p.h b/src/plugins/bearer/linux_common/qofonoservice_linux_p.h index 35614a20f2..62df5d4fa7 100644 --- a/src/plugins/bearer/linux_common/qofonoservice_linux_p.h +++ b/src/plugins/bearer/linux_common/qofonoservice_linux_p.h @@ -100,7 +100,7 @@ class QOfonoManagerInterface : public QDBusAbstractInterface public: - QOfonoManagerInterface( QObject *parent = 0); + QOfonoManagerInterface( QObject *parent = nullptr); ~QOfonoManagerInterface(); QStringList getModems(); @@ -120,7 +120,7 @@ class QOfonoModemInterface : public QDBusAbstractInterface public: - explicit QOfonoModemInterface(const QString &dbusModemPathName, QObject *parent = 0); + explicit QOfonoModemInterface(const QString &dbusModemPathName, QObject *parent = nullptr); ~QOfonoModemInterface(); bool isPowered(); @@ -140,7 +140,7 @@ class QOfonoNetworkRegistrationInterface : public QDBusAbstractInterface public: - explicit QOfonoNetworkRegistrationInterface(const QString &dbusModemPathName, QObject *parent = 0); + explicit QOfonoNetworkRegistrationInterface(const QString &dbusModemPathName, QObject *parent = nullptr); ~QOfonoNetworkRegistrationInterface(); QString getTechnology(); @@ -159,7 +159,7 @@ class QOfonoDataConnectionManagerInterface : public QDBusAbstractInterface public: - explicit QOfonoDataConnectionManagerInterface(const QString &dbusPathName, QObject *parent = 0); + explicit QOfonoDataConnectionManagerInterface(const QString &dbusPathName, QObject *parent = nullptr); ~QOfonoDataConnectionManagerInterface(); QStringList contexts(); @@ -184,7 +184,7 @@ class QOfonoConnectionContextInterface : public QDBusAbstractInterface public: - explicit QOfonoConnectionContextInterface(const QString &dbusPathName, QObject *parent = 0); + explicit QOfonoConnectionContextInterface(const QString &dbusPathName, QObject *parent = nullptr); ~QOfonoConnectionContextInterface(); QVariant getProperty(const QString &); diff --git a/src/plugins/bearer/networkmanager/qnetworkmanagerengine.h b/src/plugins/bearer/networkmanager/qnetworkmanagerengine.h index 74fe24b5ab..a95c68abdf 100644 --- a/src/plugins/bearer/networkmanager/qnetworkmanagerengine.h +++ b/src/plugins/bearer/networkmanager/qnetworkmanagerengine.h @@ -69,7 +69,7 @@ class QNetworkManagerEngine : public QBearerEngineImpl Q_OBJECT public: - QNetworkManagerEngine(QObject *parent = 0); + QNetworkManagerEngine(QObject *parent = nullptr); ~QNetworkManagerEngine(); bool networkManagerAvailable() const; @@ -99,7 +99,7 @@ private Q_SLOTS: void interfacePropertiesChanged(const QMap<QString, QVariant> &properties); void activeConnectionPropertiesChanged(const QMap<QString, QVariant> &properties); - void newConnection(const QDBusObjectPath &path, QNetworkManagerSettings *settings = 0); + void newConnection(const QDBusObjectPath &path, QNetworkManagerSettings *settings = nullptr); void removeConnection(const QString &path); void updateConnection(); void activationFinished(QDBusPendingCallWatcher *watcher); diff --git a/src/plugins/bearer/networkmanager/qnetworkmanagerservice.h b/src/plugins/bearer/networkmanager/qnetworkmanagerservice.h index c879083faf..bff7a71097 100644 --- a/src/plugins/bearer/networkmanager/qnetworkmanagerservice.h +++ b/src/plugins/bearer/networkmanager/qnetworkmanagerservice.h @@ -152,7 +152,7 @@ public: NM_STATE_CONNECTED_GLOBAL = 70 } NMState; - QNetworkManagerInterface(QObject *parent = 0); + QNetworkManagerInterface(QObject *parent = nullptr); ~QNetworkManagerInterface(); QList <QDBusObjectPath> getDevices(); @@ -228,7 +228,7 @@ public: Q_DECLARE_FLAGS(ApSecurityFlags, ApSecurityFlag) - explicit QNetworkManagerInterfaceAccessPoint(const QString &dbusPathName, QObject *parent = 0); + explicit QNetworkManagerInterfaceAccessPoint(const QString &dbusPathName, QObject *parent = nullptr); ~QNetworkManagerInterfaceAccessPoint(); quint32 flags() const; @@ -259,7 +259,7 @@ class QNetworkManagerInterfaceDevice : public QDBusAbstractInterface public: - explicit QNetworkManagerInterfaceDevice(const QString &deviceObjectPath, QObject *parent = 0); + explicit QNetworkManagerInterfaceDevice(const QString &deviceObjectPath, QObject *parent = nullptr); ~QNetworkManagerInterfaceDevice(); QString udi() const; @@ -288,7 +288,7 @@ class QNetworkManagerInterfaceDeviceWired : public QDBusAbstractInterface public: explicit QNetworkManagerInterfaceDeviceWired(const QString &ifaceDevicePath, - QObject *parent = 0); + QObject *parent = nullptr); ~QNetworkManagerInterfaceDeviceWired(); QString hwAddress() const; @@ -325,7 +325,7 @@ public: }; explicit QNetworkManagerInterfaceDeviceWireless(const QString &ifaceDevicePath, - QObject *parent = 0); + QObject *parent = nullptr); ~QNetworkManagerInterfaceDeviceWireless(); QList <QDBusObjectPath> getAccessPoints(); @@ -367,7 +367,7 @@ public: Q_DECLARE_FLAGS(ModemCapabilities, ModemCapability) explicit QNetworkManagerInterfaceDeviceModem(const QString &ifaceDevicePath, - QObject *parent = 0); + QObject *parent = nullptr); ~QNetworkManagerInterfaceDeviceModem(); ModemCapabilities modemCapabilities() const; @@ -392,7 +392,7 @@ class QNetworkManagerSettings : public QDBusAbstractInterface public: - explicit QNetworkManagerSettings(const QString &settingsService, QObject *parent = 0); + explicit QNetworkManagerSettings(const QString &settingsService, QObject *parent = nullptr); ~QNetworkManagerSettings(); QList <QDBusObjectPath> listConnections(); @@ -413,7 +413,7 @@ class QNetworkManagerSettingsConnection : public QDBusAbstractInterface public: - QNetworkManagerSettingsConnection(const QString &settingsService, const QString &connectionObjectPath, QObject *parent = 0); + QNetworkManagerSettingsConnection(const QString &settingsService, const QString &connectionObjectPath, QObject *parent = nullptr); ~QNetworkManagerSettingsConnection(); QNmSettingsMap getSettings(); @@ -451,7 +451,7 @@ public: Activated = 2 }; - explicit QNetworkManagerConnectionActive(const QString &dbusPathName, QObject *parent = 0); + explicit QNetworkManagerConnectionActive(const QString &dbusPathName, QObject *parent = nullptr); ~ QNetworkManagerConnectionActive(); QDBusObjectPath connection() const; @@ -478,7 +478,7 @@ class QNetworkManagerIp4Config : public QDBusAbstractInterface Q_OBJECT public: - explicit QNetworkManagerIp4Config(const QString &dbusPathName, QObject *parent = 0); + explicit QNetworkManagerIp4Config(const QString &dbusPathName, QObject *parent = nullptr); ~QNetworkManagerIp4Config(); QStringList domains() const; @@ -489,7 +489,7 @@ class PropertiesDBusInterface : public QDBusAbstractInterface public: PropertiesDBusInterface(const QString &service, const QString &path, const QString &interface, const QDBusConnection &connection, - QObject *parent = 0) + QObject *parent = nullptr) : QDBusAbstractInterface(service, path, interface.toLatin1().data(), connection, parent) {} }; diff --git a/src/plugins/bearer/qbearerengine_impl.h b/src/plugins/bearer/qbearerengine_impl.h index 3f8a4d821d..5c003aaaf6 100644 --- a/src/plugins/bearer/qbearerengine_impl.h +++ b/src/plugins/bearer/qbearerengine_impl.h @@ -56,7 +56,7 @@ public: DisconnectionError, }; - QBearerEngineImpl(QObject *parent = 0) : QBearerEngine(parent) {} + QBearerEngineImpl(QObject *parent = nullptr) : QBearerEngine(parent) {} ~QBearerEngineImpl() {} virtual void connectToId(const QString &id) = 0; diff --git a/src/plugins/bearer/qnetworksession_impl.h b/src/plugins/bearer/qnetworksession_impl.h index d9aa6ca8fb..0f8e014900 100644 --- a/src/plugins/bearer/qnetworksession_impl.h +++ b/src/plugins/bearer/qnetworksession_impl.h @@ -66,7 +66,7 @@ class QNetworkSessionPrivateImpl : public QNetworkSessionPrivate public: QNetworkSessionPrivateImpl() - : engine(0), startTime(0), lastError(QNetworkSession::UnknownSessionError), sessionTimeout(-1), currentPolicies(QNetworkSession::NoPolicy), opened(false) + : engine(nullptr), startTime(0), lastError(QNetworkSession::UnknownSessionError), sessionTimeout(-1), currentPolicies(QNetworkSession::NoPolicy), opened(false) {} ~QNetworkSessionPrivateImpl() {} diff --git a/src/plugins/imageformats/jpeg/qjpeghandler.cpp b/src/plugins/imageformats/jpeg/qjpeghandler.cpp index 54fe857908..9d5ccc8a3d 100644 --- a/src/plugins/imageformats/jpeg/qjpeghandler.cpp +++ b/src/plugins/imageformats/jpeg/qjpeghandler.cpp @@ -40,10 +40,14 @@ #include "qjpeghandler_p.h" #include <qimage.h> +#include <qcolorspace.h> +#include <qcolortransform.h> +#include <qdebug.h> #include <qvariant.h> #include <qvector.h> #include <qbuffer.h> #include <qmath.h> +#include <private/qicc_p.h> #include <private/qsimd_p.h> #include <private/qimage_p.h> // for qt_getImageText @@ -725,6 +729,7 @@ public: QRect clipRect; QString description; QStringList readTexts; + QByteArray iccProfile; struct jpeg_decompress_struct info; struct my_jpeg_source_mgr * iod_src; @@ -887,6 +892,7 @@ bool QJpegHandlerPrivate::readJpegHeader(QIODevice *device) if (!setjmp(err.setjmp_buffer)) { jpeg_save_markers(&info, JPEG_COM, 0xFFFF); jpeg_save_markers(&info, JPEG_APP0 + 1, 0xFFFF); // Exif uses APP1 marker + jpeg_save_markers(&info, JPEG_APP0 + 2, 0xFFFF); // ICC uses APP2 marker (void) jpeg_read_header(&info, TRUE); @@ -919,6 +925,10 @@ bool QJpegHandlerPrivate::readJpegHeader(QIODevice *device) readTexts.append(value); } else if (marker->marker == JPEG_APP0 + 1) { exifData.append((const char*)marker->data, marker->data_length); + } else if (marker->marker == JPEG_APP0 + 2) { + if (marker->data_length > 128 + 4 + 14 && strcmp((const char *)marker->data, "ICC_PROFILE") == 0) { + iccProfile.append((const char*)marker->data + 14, marker->data_length - 14); + } } } @@ -954,6 +964,9 @@ bool QJpegHandlerPrivate::read(QImage *image) for (int i = 0; i < readTexts.size()-1; i+=2) image->setText(readTexts.at(i), readTexts.at(i+1)); + if (!iccProfile.isEmpty()) + image->setColorSpace(QColorSpace::fromIccProfile(iccProfile)); + state = ReadingEnd; return true; } @@ -962,7 +975,6 @@ bool QJpegHandlerPrivate::read(QImage *image) } return false; - } Q_GUI_EXPORT void QT_FASTCALL qt_convert_rgb888_to_rgb32_neon(quint32 *dst, const uchar *src, int len); diff --git a/src/plugins/platforminputcontexts/ibus/qibusinputcontextproxy.h b/src/plugins/platforminputcontexts/ibus/qibusinputcontextproxy.h index 47a40ab8c2..396a213aaa 100644 --- a/src/plugins/platforminputcontexts/ibus/qibusinputcontextproxy.h +++ b/src/plugins/platforminputcontexts/ibus/qibusinputcontextproxy.h @@ -31,7 +31,7 @@ public: { return "org.freedesktop.IBus.InputContext"; } public: - QIBusInputContextProxy(const QString &service, const QString &path, const QDBusConnection &connection, QObject *parent = 0); + QIBusInputContextProxy(const QString &service, const QString &path, const QDBusConnection &connection, QObject *parent = nullptr); ~QIBusInputContextProxy(); diff --git a/src/plugins/platforminputcontexts/ibus/qibusplatforminputcontext.h b/src/plugins/platforminputcontexts/ibus/qibusplatforminputcontext.h index d4daea2eb3..8e7b8df120 100644 --- a/src/plugins/platforminputcontexts/ibus/qibusplatforminputcontext.h +++ b/src/plugins/platforminputcontexts/ibus/qibusplatforminputcontext.h @@ -59,9 +59,9 @@ class QIBusFilterEventWatcher: public QDBusPendingCallWatcher { public: explicit QIBusFilterEventWatcher(const QDBusPendingCall &call, - QObject *parent = 0, - QWindow *window = 0, - const Qt::KeyboardModifiers modifiers = 0, + QObject *parent = nullptr, + QWindow *window = nullptr, + const Qt::KeyboardModifiers modifiers = nullptr, const QVariantList arguments = QVariantList()) : QDBusPendingCallWatcher(call, parent) , m_window(window) diff --git a/src/plugins/platforminputcontexts/ibus/qibusproxy.h b/src/plugins/platforminputcontexts/ibus/qibusproxy.h index 839e972c34..c9876deebf 100644 --- a/src/plugins/platforminputcontexts/ibus/qibusproxy.h +++ b/src/plugins/platforminputcontexts/ibus/qibusproxy.h @@ -35,7 +35,7 @@ public: { return QStringLiteral("org.freedesktop.DBus.Properties"); } public: - QIBusProxy(const QString &service, const QString &path, const QDBusConnection &connection, QObject *parent = 0); + QIBusProxy(const QString &service, const QString &path, const QDBusConnection &connection, QObject *parent = nullptr); ~QIBusProxy(); diff --git a/src/plugins/platforms/eglfs/deviceintegration/eglfs_kms_egldevice/qeglfskmsegldeviceintegration.cpp b/src/plugins/platforms/eglfs/deviceintegration/eglfs_kms_egldevice/qeglfskmsegldeviceintegration.cpp index ecdfb352ab..ef732f9832 100644 --- a/src/plugins/platforms/eglfs/deviceintegration/eglfs_kms_egldevice/qeglfskmsegldeviceintegration.cpp +++ b/src/plugins/platforms/eglfs/deviceintegration/eglfs_kms_egldevice/qeglfskmsegldeviceintegration.cpp @@ -114,14 +114,18 @@ public: : QEglFSWindow(w) , m_integration(integration) , m_egl_stream(EGL_NO_STREAM_KHR) + , m_framePending(false) { } void invalidateSurface() override; void resetSurface() override; + void flip(); + static void pageFlipHandler(int fd, unsigned int sequence, unsigned int tv_sec, unsigned int tv_usec, void *user_data); const QEglFSKmsEglDeviceIntegration *m_integration; EGLStreamKHR m_egl_stream; EGLint m_latency; + bool m_framePending; }; void QEglFSKmsEglDeviceWindow::invalidateSurface() @@ -142,6 +146,9 @@ void QEglFSKmsEglDeviceWindow::resetSurface() streamAttribs[streamAttribCount++] = EGL_STREAM_FIFO_LENGTH_KHR; streamAttribs[streamAttribCount++] = fifoLength; } + + streamAttribs[streamAttribCount++] = EGL_CONSUMER_AUTO_ACQUIRE_EXT; + streamAttribs[streamAttribCount++] = EGL_FALSE; streamAttribs[streamAttribCount++] = EGL_NONE; m_egl_stream = m_integration->m_funcs->create_stream(display, streamAttribs); @@ -239,6 +246,49 @@ void QEglFSKmsEglDeviceWindow::resetSurface() qCDebug(qLcEglfsKmsDebug, "Created stream producer surface %p", m_surface); } +void QEglFSKmsEglDeviceWindow::flip() +{ + EGLDisplay display = screen()->display(); + + EGLAttrib acquire_attribs[3] = { EGL_NONE }; + + acquire_attribs[0] = EGL_DRM_FLIP_EVENT_DATA_NV; + acquire_attribs[1] = (EGLAttrib)this; + acquire_attribs[2] = EGL_NONE; + + if (m_egl_stream != EGL_NO_STREAM_KHR) + if (!m_integration->m_funcs->acquire_stream_attrib_nv(display, m_egl_stream, acquire_attribs)) + qWarning("eglStreamConsumerAcquireAttribNV failed: eglError: %x", eglGetError()); + + m_framePending = true; + + while (m_framePending) { + drmEventContext drmEvent; + memset(&drmEvent, 0, sizeof(drmEvent)); + drmEvent.version = 3; + drmEvent.vblank_handler = nullptr; + drmEvent.page_flip_handler = pageFlipHandler; + drmHandleEvent(m_integration->m_device->fd(), &drmEvent); + } +} + +void QEglFSKmsEglDeviceWindow::pageFlipHandler(int fd, unsigned int sequence, unsigned int tv_sec, unsigned int tv_usec, void *user_data) +{ + Q_UNUSED(fd); + Q_UNUSED(sequence); + Q_UNUSED(tv_sec); + Q_UNUSED(tv_usec); + + QEglFSKmsEglDeviceWindow *window = static_cast<QEglFSKmsEglDeviceWindow*>(user_data); + window->m_framePending = false; +} + +void QEglFSKmsEglDeviceIntegration::presentBuffer(QPlatformSurface *surface) +{ + QEglFSKmsEglDeviceWindow *eglWindow = static_cast<QEglFSKmsEglDeviceWindow*>(surface); + eglWindow->flip(); +} + QEglFSWindow *QEglFSKmsEglDeviceIntegration::createWindow(QWindow *window) const { QEglFSKmsEglDeviceWindow *eglWindow = new QEglFSKmsEglDeviceWindow(window, this); diff --git a/src/plugins/platforms/eglfs/deviceintegration/eglfs_kms_egldevice/qeglfskmsegldeviceintegration.h b/src/plugins/platforms/eglfs/deviceintegration/eglfs_kms_egldevice/qeglfskmsegldeviceintegration.h index 5819d82ebf..a5697ec831 100644 --- a/src/plugins/platforms/eglfs/deviceintegration/eglfs_kms_egldevice/qeglfskmsegldeviceintegration.h +++ b/src/plugins/platforms/eglfs/deviceintegration/eglfs_kms_egldevice/qeglfskmsegldeviceintegration.h @@ -62,6 +62,8 @@ public: bool supportsPBuffers() const override; QEglFSWindow *createWindow(QWindow *window) const override; + void presentBuffer(QPlatformSurface *surface) override; + EGLDeviceEXT eglDevice() const { return m_egl_device; } protected: diff --git a/src/plugins/platforms/mirclient/mirclient.json b/src/plugins/platforms/mirclient/mirclient.json deleted file mode 100644 index c31558a2f1..0000000000 --- a/src/plugins/platforms/mirclient/mirclient.json +++ /dev/null @@ -1,3 +0,0 @@ -{ - "Keys": [ "mirclient" ] -} diff --git a/src/plugins/platforms/mirclient/mirclient.pro b/src/plugins/platforms/mirclient/mirclient.pro deleted file mode 100644 index d9eb069200..0000000000 --- a/src/plugins/platforms/mirclient/mirclient.pro +++ /dev/null @@ -1,61 +0,0 @@ -TARGET = qmirclient - -QT += \ - core-private gui-private dbus \ - theme_support-private eventdispatcher_support-private \ - fontdatabase_support-private egl_support-private - -qtHaveModule(linuxaccessibility_support-private): \ - QT += linuxaccessibility_support-private - -DEFINES += MESA_EGL_NO_X11_HEADERS -# CONFIG += c++11 # only enables C++0x -QMAKE_CXXFLAGS += -fvisibility=hidden -fvisibility-inlines-hidden -std=c++11 -Werror -Wall -QMAKE_LFLAGS += -std=c++11 -Wl,-no-undefined - -QMAKE_USE_PRIVATE += mirclient - -SOURCES = \ - qmirclientappstatecontroller.cpp \ - qmirclientbackingstore.cpp \ - qmirclientclipboard.cpp \ - qmirclientcursor.cpp \ - qmirclientdebugextension.cpp \ - qmirclientdesktopwindow.cpp \ - qmirclientglcontext.cpp \ - qmirclientinput.cpp \ - qmirclientintegration.cpp \ - qmirclientnativeinterface.cpp \ - qmirclientplatformservices.cpp \ - qmirclientplugin.cpp \ - qmirclientscreen.cpp \ - qmirclientscreenobserver.cpp \ - qmirclienttheme.cpp \ - qmirclientwindow.cpp - -HEADERS = \ - qmirclientappstatecontroller.h \ - qmirclientbackingstore.h \ - qmirclientclipboard.h \ - qmirclientcursor.h \ - qmirclientdebugextension.h \ - qmirclientdesktopwindow.h \ - qmirclientglcontext.h \ - qmirclientinput.h \ - qmirclientintegration.h \ - qmirclientlogging.h \ - qmirclientnativeinterface.h \ - qmirclientorientationchangeevent_p.h \ - qmirclientplatformservices.h \ - qmirclientplugin.h \ - qmirclientscreen.h \ - qmirclientscreenobserver.h \ - qmirclienttheme.h \ - qmirclientwindow.h - -QMAKE_USE_PRIVATE += xkbcommon - -PLUGIN_TYPE = platforms -PLUGIN_CLASS_NAME = MirServerIntegrationPlugin -!equals(TARGET, $$QT_DEFAULT_QPA_PLUGIN): PLUGIN_EXTENDS = - -load(qt_plugin) diff --git a/src/plugins/platforms/mirclient/qmirclientappstatecontroller.cpp b/src/plugins/platforms/mirclient/qmirclientappstatecontroller.cpp deleted file mode 100644 index 69fc9b7aa7..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientappstatecontroller.cpp +++ /dev/null @@ -1,102 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#include "qmirclientappstatecontroller.h" - -#include <qpa/qwindowsysteminterface.h> - -/* - * QMirClientAppStateController - updates Qt's QApplication::applicationState property. - * - * Tries to avoid active-inactive-active invocations using a timer. The rapid state - * change can confuse some applications. - */ - -QMirClientAppStateController::QMirClientAppStateController() - : m_suspended(false) - , m_lastActive(true) -{ - m_inactiveTimer.setSingleShot(true); - m_inactiveTimer.setInterval(10); - QObject::connect(&m_inactiveTimer, &QTimer::timeout, []() - { - QWindowSystemInterface::handleApplicationStateChanged(Qt::ApplicationInactive); - }); -} - -void QMirClientAppStateController::setSuspended() -{ - m_inactiveTimer.stop(); - if (!m_suspended) { - m_suspended = true; - - QWindowSystemInterface::handleApplicationStateChanged(Qt::ApplicationSuspended); - } -} - -void QMirClientAppStateController::setResumed() -{ - m_inactiveTimer.stop(); - if (m_suspended) { - m_suspended = false; - - if (m_lastActive) { - QWindowSystemInterface::handleApplicationStateChanged(Qt::ApplicationActive); - } else { - QWindowSystemInterface::handleApplicationStateChanged(Qt::ApplicationInactive); - } - } -} - -void QMirClientAppStateController::setWindowFocused(bool focused) -{ - if (m_suspended) { - return; - } - - if (focused) { - m_inactiveTimer.stop(); - QWindowSystemInterface::handleApplicationStateChanged(Qt::ApplicationActive); - } else { - m_inactiveTimer.start(); - } - - m_lastActive = focused; -} diff --git a/src/plugins/platforms/mirclient/qmirclientappstatecontroller.h b/src/plugins/platforms/mirclient/qmirclientappstatecontroller.h deleted file mode 100644 index b3aa0022d9..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientappstatecontroller.h +++ /dev/null @@ -1,62 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTAPPSTATECONTROLLER_H -#define QMIRCLIENTAPPSTATECONTROLLER_H - -#include <QTimer> - -class QMirClientAppStateController -{ -public: - QMirClientAppStateController(); - - void setSuspended(); - void setResumed(); - - void setWindowFocused(bool focused); - -private: - bool m_suspended; - bool m_lastActive; - QTimer m_inactiveTimer; -}; - -#endif // QMIRCLIENTAPPSTATECONTROLLER_H diff --git a/src/plugins/platforms/mirclient/qmirclientbackingstore.cpp b/src/plugins/platforms/mirclient/qmirclientbackingstore.cpp deleted file mode 100644 index 51363619d9..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientbackingstore.cpp +++ /dev/null @@ -1,157 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#include "qmirclientbackingstore.h" -#include "qmirclientlogging.h" -#include <QtGui/QOpenGLContext> -#include <QtGui/QOpenGLTexture> -#include <QtGui/QMatrix4x4> -#include <QtGui/qopengltextureblitter.h> -#include <QtGui/qopenglfunctions.h> - -QMirClientBackingStore::QMirClientBackingStore(QWindow* window) - : QPlatformBackingStore(window) - , mContext(new QOpenGLContext) - , mTexture(new QOpenGLTexture(QOpenGLTexture::Target2D)) - , mBlitter(new QOpenGLTextureBlitter) -{ - mContext->setFormat(window->requestedFormat()); - mContext->setScreen(window->screen()); - mContext->create(); - - window->setSurfaceType(QSurface::OpenGLSurface); -} - -QMirClientBackingStore::~QMirClientBackingStore() -{ - mContext->makeCurrent(window()); // needed as QOpenGLTexture destructor assumes current context -} - -void QMirClientBackingStore::flush(QWindow* window, const QRegion& region, const QPoint& offset) -{ - Q_UNUSED(region); - Q_UNUSED(offset); - mContext->makeCurrent(window); - glViewport(0, 0, window->width(), window->height()); - - updateTexture(); - - if (!mBlitter->isCreated()) - mBlitter->create(); - - mBlitter->bind(); - mBlitter->blit(mTexture->textureId(), QMatrix4x4(), QOpenGLTextureBlitter::OriginTopLeft); - mBlitter->release(); - - mContext->swapBuffers(window); -} - -void QMirClientBackingStore::updateTexture() -{ - if (mDirty.isNull()) - return; - - if (!mTexture->isCreated()) { - mTexture->setMinificationFilter(QOpenGLTexture::Nearest); - mTexture->setMagnificationFilter(QOpenGLTexture::Nearest); - mTexture->setWrapMode(QOpenGLTexture::ClampToEdge); - mTexture->setData(mImage, QOpenGLTexture::DontGenerateMipMaps); - mTexture->create(); - } - mTexture->bind(); - - QRegion fixed; - QRect imageRect = mImage.rect(); - - for (const QRect &rect : mDirty) { - // intersect with image rect to be sure - QRect r = imageRect & rect; - - // if the rect is wide enough it is cheaper to just extend it instead of doing an image copy - if (r.width() >= imageRect.width() / 2) { - r.setX(0); - r.setWidth(imageRect.width()); - } - - fixed |= r; - } - - for (const QRect &rect : fixed) { - // if the sub-rect is full-width we can pass the image data directly to - // OpenGL instead of copying, since there is no gap between scanlines - if (rect.width() == imageRect.width()) { - glTexSubImage2D(GL_TEXTURE_2D, 0, 0, rect.y(), rect.width(), rect.height(), GL_RGBA, GL_UNSIGNED_BYTE, - mImage.constScanLine(rect.y())); - } else { - glTexSubImage2D(GL_TEXTURE_2D, 0, rect.x(), rect.y(), rect.width(), rect.height(), GL_RGBA, GL_UNSIGNED_BYTE, - mImage.copy(rect).constBits()); - } - } - /* End of code taken from QEGLPlatformBackingStore */ - - mDirty = QRegion(); -} - - -void QMirClientBackingStore::beginPaint(const QRegion& region) -{ - mDirty |= region; -} - -void QMirClientBackingStore::resize(const QSize& size, const QRegion& /*staticContents*/) -{ - mImage = QImage(size, QImage::Format_RGBA8888); - - mContext->makeCurrent(window()); - - if (mTexture->isCreated()) - mTexture->destroy(); -} - -QPaintDevice* QMirClientBackingStore::paintDevice() -{ - return &mImage; -} - -QImage QMirClientBackingStore::toImage() const -{ - // used by QPlatformBackingStore::composeAndFlush - return mImage; -} diff --git a/src/plugins/platforms/mirclient/qmirclientbackingstore.h b/src/plugins/platforms/mirclient/qmirclientbackingstore.h deleted file mode 100644 index 7644c77df2..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientbackingstore.h +++ /dev/null @@ -1,74 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTBACKINGSTORE_H -#define QMIRCLIENTBACKINGSTORE_H - -#include <qpa/qplatformbackingstore.h> - -class QOpenGLContext; -class QOpenGLTexture; -class QOpenGLTextureBlitter; - -class QMirClientBackingStore : public QPlatformBackingStore -{ -public: - QMirClientBackingStore(QWindow* window); - virtual ~QMirClientBackingStore(); - - // QPlatformBackingStore methods. - void beginPaint(const QRegion&) override; - void flush(QWindow* window, const QRegion& region, const QPoint& offset) override; - void resize(const QSize& size, const QRegion& staticContents) override; - QPaintDevice* paintDevice() override; - QImage toImage() const override; - -protected: - void updateTexture(); - -private: - QScopedPointer<QOpenGLContext> mContext; - QScopedPointer<QOpenGLTexture> mTexture; - QScopedPointer<QOpenGLTextureBlitter> mBlitter; - QImage mImage; - QRegion mDirty; -}; - -#endif // QMIRCLIENTBACKINGSTORE_H diff --git a/src/plugins/platforms/mirclient/qmirclientclipboard.cpp b/src/plugins/platforms/mirclient/qmirclientclipboard.cpp deleted file mode 100644 index b9fc9b3b42..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientclipboard.cpp +++ /dev/null @@ -1,181 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#include "qmirclientclipboard.h" -#include "qmirclientlogging.h" -#include "qmirclientwindow.h" - -#include <QDBusPendingCallWatcher> -#include <QGuiApplication> -#include <QSignalBlocker> -#include <QtCore/QMimeData> -#include <QtCore/QStringList> - -// content-hub -#include <com/ubuntu/content/hub.h> - -// get this cumbersome nested namespace out of the way -using namespace com::ubuntu::content; - -QMirClientClipboard::QMirClientClipboard() - : mMimeData(new QMimeData) - , mContentHub(Hub::Client::instance()) -{ - connect(mContentHub, &Hub::pasteboardChanged, this, [this]() { - if (mClipboardState == QMirClientClipboard::SyncedClipboard) { - mClipboardState = QMirClientClipboard::OutdatedClipboard; - emitChanged(QClipboard::Clipboard); - } - }); - - connect(qGuiApp, &QGuiApplication::applicationStateChanged, - this, &QMirClientClipboard::onApplicationStateChanged); - - requestMimeData(); -} - -QMirClientClipboard::~QMirClientClipboard() -{ - delete mMimeData; -} - -QMimeData* QMirClientClipboard::mimeData(QClipboard::Mode mode) -{ - if (mode != QClipboard::Clipboard) - return nullptr; - - // Blocks dataChanged() signal from being emitted. Makes no sense to emit it from - // inside the data getter. - const QSignalBlocker blocker(this); - - if (mClipboardState == OutdatedClipboard) { - updateMimeData(); - } else if (mClipboardState == SyncingClipboard) { - mPasteReply->waitForFinished(); - } - - return mMimeData; -} - -void QMirClientClipboard::setMimeData(QMimeData* mimeData, QClipboard::Mode mode) -{ - QWindow *focusWindow = QGuiApplication::focusWindow(); - if (focusWindow && mode == QClipboard::Clipboard && mimeData != nullptr) { - QString surfaceId = static_cast<QMirClientWindow*>(focusWindow->handle())->persistentSurfaceId(); - - QDBusPendingCall reply = mContentHub->createPaste(surfaceId, *mimeData); - - // Don't care whether it succeeded - QDBusPendingCallWatcher *watcher = new QDBusPendingCallWatcher(reply, this); - connect(watcher, &QDBusPendingCallWatcher::finished, - watcher, &QObject::deleteLater); - - mMimeData = mimeData; - mClipboardState = SyncedClipboard; - emitChanged(QClipboard::Clipboard); - } -} - -bool QMirClientClipboard::supportsMode(QClipboard::Mode mode) const -{ - return mode == QClipboard::Clipboard; -} - -bool QMirClientClipboard::ownsMode(QClipboard::Mode mode) const -{ - Q_UNUSED(mode); - return false; -} - -void QMirClientClipboard::onApplicationStateChanged(Qt::ApplicationState state) -{ - if (state == Qt::ApplicationActive) { - // Only focused or active applications might be allowed to paste, so we probably - // missed changes in the clipboard while we were hidden, inactive or, more importantly, - // suspended. - requestMimeData(); - } -} - -void QMirClientClipboard::updateMimeData() -{ - if (qGuiApp->applicationState() != Qt::ApplicationActive) { - // Don't even bother asking as content-hub would probably ignore our request (and should). - return; - } - - delete mMimeData; - - QWindow *focusWindow = QGuiApplication::focusWindow(); - if (focusWindow) { - QString surfaceId = static_cast<QMirClientWindow*>(focusWindow->handle())->persistentSurfaceId(); - mMimeData = mContentHub->latestPaste(surfaceId); - mClipboardState = SyncedClipboard; - emitChanged(QClipboard::Clipboard); - } -} - -void QMirClientClipboard::requestMimeData() -{ - if (qGuiApp->applicationState() != Qt::ApplicationActive) { - // Don't even bother asking as content-hub would probably ignore our request (and should). - return; - } - - QWindow *focusWindow = QGuiApplication::focusWindow(); - if (!focusWindow) { - return; - } - - QString surfaceId = static_cast<QMirClientWindow*>(focusWindow->handle())->persistentSurfaceId(); - QDBusPendingCall reply = mContentHub->requestLatestPaste(surfaceId); - mClipboardState = SyncingClipboard; - - mPasteReply = new QDBusPendingCallWatcher(reply, this); - connect(mPasteReply, &QDBusPendingCallWatcher::finished, - this, [this]() { - delete mMimeData; - mMimeData = mContentHub->paste(*mPasteReply); - mClipboardState = SyncedClipboard; - mPasteReply->deleteLater(); - mPasteReply = nullptr; - emitChanged(QClipboard::Clipboard); - }); -} diff --git a/src/plugins/platforms/mirclient/qmirclientcursor.cpp b/src/plugins/platforms/mirclient/qmirclientcursor.cpp deleted file mode 100644 index 812cde95c6..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientcursor.cpp +++ /dev/null @@ -1,209 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2015-2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#include "qmirclientcursor.h" - -#include "qmirclientlogging.h" -#include "qmirclientwindow.h" - -#include <mir_toolkit/mir_client_library.h> - -Q_LOGGING_CATEGORY(mirclientCursor, "qt.qpa.mirclient.cursor", QtWarningMsg) - -QMirClientCursor::QMirClientCursor(MirConnection *connection) - : mConnection(connection) -{ - /* - * TODO: Add the missing cursors to Mir (LP: #1388987) - * Those are the ones without a mir_ prefix, which are X11 cursors - * and won't be understood by any shell other than Unity8. - */ - mShapeToCursorName[Qt::ArrowCursor] = mir_arrow_cursor_name; - mShapeToCursorName[Qt::UpArrowCursor] = "up_arrow"; - mShapeToCursorName[Qt::CrossCursor] = mir_crosshair_cursor_name; - mShapeToCursorName[Qt::WaitCursor] = mir_busy_cursor_name; - mShapeToCursorName[Qt::IBeamCursor] = mir_caret_cursor_name; - mShapeToCursorName[Qt::SizeVerCursor] = mir_vertical_resize_cursor_name; - mShapeToCursorName[Qt::SizeHorCursor] = mir_horizontal_resize_cursor_name; - mShapeToCursorName[Qt::SizeBDiagCursor] = mir_diagonal_resize_bottom_to_top_cursor_name; - mShapeToCursorName[Qt::SizeFDiagCursor] = mir_diagonal_resize_top_to_bottom_cursor_name; - mShapeToCursorName[Qt::SizeAllCursor] = mir_omnidirectional_resize_cursor_name; - mShapeToCursorName[Qt::BlankCursor] = mir_disabled_cursor_name; - mShapeToCursorName[Qt::SplitVCursor] = mir_vsplit_resize_cursor_name; - mShapeToCursorName[Qt::SplitHCursor] = mir_hsplit_resize_cursor_name; - mShapeToCursorName[Qt::PointingHandCursor] = mir_pointing_hand_cursor_name; - mShapeToCursorName[Qt::ForbiddenCursor] = "forbidden"; - mShapeToCursorName[Qt::WhatsThisCursor] = "whats_this"; - mShapeToCursorName[Qt::BusyCursor] = "left_ptr_watch"; - mShapeToCursorName[Qt::OpenHandCursor] = mir_open_hand_cursor_name; - mShapeToCursorName[Qt::ClosedHandCursor] = mir_closed_hand_cursor_name; - mShapeToCursorName[Qt::DragCopyCursor] = "dnd-copy"; - mShapeToCursorName[Qt::DragMoveCursor] = "dnd-move"; - mShapeToCursorName[Qt::DragLinkCursor] = "dnd-link"; -} - -namespace { -const char *qtCursorShapeToStr(Qt::CursorShape shape) -{ - switch (shape) { - case Qt::ArrowCursor: - return "Arrow"; - case Qt::UpArrowCursor: - return "UpArrow"; - case Qt::CrossCursor: - return "Cross"; - case Qt::WaitCursor: - return "Wait"; - case Qt::IBeamCursor: - return "IBeam"; - case Qt::SizeVerCursor: - return "SizeVer"; - case Qt::SizeHorCursor: - return "SizeHor"; - case Qt::SizeBDiagCursor: - return "SizeBDiag"; - case Qt::SizeFDiagCursor: - return "SizeFDiag"; - case Qt::SizeAllCursor: - return "SizeAll"; - case Qt::BlankCursor: - return "Blank"; - case Qt::SplitVCursor: - return "SplitV"; - case Qt::SplitHCursor: - return "SplitH"; - case Qt::PointingHandCursor: - return "PointingHand"; - case Qt::ForbiddenCursor: - return "Forbidden"; - case Qt::WhatsThisCursor: - return "WhatsThis"; - case Qt::BusyCursor: - return "Busy"; - case Qt::OpenHandCursor: - return "OpenHand"; - case Qt::ClosedHandCursor: - return "ClosedHand"; - case Qt::DragCopyCursor: - return "DragCopy"; - case Qt::DragMoveCursor: - return "DragMove"; - case Qt::DragLinkCursor: - return "DragLink"; - case Qt::BitmapCursor: - return "Bitmap"; - default: - return "???"; - } -} -} // anonymous namespace - -void QMirClientCursor::changeCursor(QCursor *windowCursor, QWindow *window) -{ - if (!window) { - return; - } - - MirSurface *surface = static_cast<QMirClientWindow*>(window->handle())->mirSurface(); - - if (!surface) { - return; - } - - - if (windowCursor) { - qCDebug(mirclientCursor, "changeCursor shape=%s, window=%p", qtCursorShapeToStr(windowCursor->shape()), window); - if (!windowCursor->pixmap().isNull()) { - configureMirCursorWithPixmapQCursor(surface, *windowCursor); - } else if (windowCursor->shape() == Qt::BitmapCursor) { - // TODO: Implement bitmap cursor support - applyDefaultCursorConfiguration(surface); - } else { - const auto &cursorName = mShapeToCursorName.value(windowCursor->shape(), QByteArray("left_ptr")); - auto cursorConfiguration = mir_cursor_configuration_from_name(cursorName.data()); - mir_surface_configure_cursor(surface, cursorConfiguration); - mir_cursor_configuration_destroy(cursorConfiguration); - } - } else { - applyDefaultCursorConfiguration(surface); - } - -} - -void QMirClientCursor::configureMirCursorWithPixmapQCursor(MirSurface *surface, QCursor &cursor) -{ - QImage image = cursor.pixmap().toImage(); - - if (image.format() != QImage::Format_ARGB32) { - image = image.convertToFormat(QImage::Format_ARGB32); - } - - MirBufferStream *bufferStream = mir_connection_create_buffer_stream_sync(mConnection, - image.width(), image.height(), mir_pixel_format_argb_8888, mir_buffer_usage_software); - - { - MirGraphicsRegion region; - mir_buffer_stream_get_graphics_region(bufferStream, ®ion); - - char *regionLine = region.vaddr; - Q_ASSERT(image.bytesPerLine() <= region.stride); - for (int i = 0; i < image.height(); ++i) { - memcpy(regionLine, image.scanLine(i), image.bytesPerLine()); - regionLine += region.stride; - } - } - - mir_buffer_stream_swap_buffers_sync(bufferStream); - - { - auto configuration = mir_cursor_configuration_from_buffer_stream(bufferStream, cursor.hotSpot().x(), cursor.hotSpot().y()); - mir_surface_configure_cursor(surface, configuration); - mir_cursor_configuration_destroy(configuration); - } - - mir_buffer_stream_release_sync(bufferStream); -} - -void QMirClientCursor::applyDefaultCursorConfiguration(MirSurface *surface) -{ - auto cursorConfiguration = mir_cursor_configuration_from_name("left_ptr"); - mir_surface_configure_cursor(surface, cursorConfiguration); - mir_cursor_configuration_destroy(cursorConfiguration); -} diff --git a/src/plugins/platforms/mirclient/qmirclientcursor.h b/src/plugins/platforms/mirclient/qmirclientcursor.h deleted file mode 100644 index c5de23b272..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientcursor.h +++ /dev/null @@ -1,64 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2015-2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTCURSOR_H -#define QMIRCLIENTCURSOR_H - -#include <qpa/qplatformcursor.h> - -#include <QMap> -#include <QByteArray> - -struct MirConnection; -struct MirSurface; - -class QMirClientCursor : public QPlatformCursor -{ -public: - QMirClientCursor(MirConnection *connection); - void changeCursor(QCursor *windowCursor, QWindow *window) override; -private: - void configureMirCursorWithPixmapQCursor(MirSurface *surface, QCursor &cursor); - void applyDefaultCursorConfiguration(MirSurface *surface); - QMap<int, QByteArray> mShapeToCursorName; - MirConnection *mConnection; -}; - -#endif // QMIRCLIENTCURSOR_H diff --git a/src/plugins/platforms/mirclient/qmirclientdebugextension.cpp b/src/plugins/platforms/mirclient/qmirclientdebugextension.cpp deleted file mode 100644 index 9aa934083d..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientdebugextension.cpp +++ /dev/null @@ -1,79 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#include "qmirclientdebugextension.h" - -#include "qmirclientlogging.h" - -// mir client debug -#include <mir_toolkit/debug/surface.h> - -Q_LOGGING_CATEGORY(mirclientDebug, "qt.qpa.mirclient.debug") - -QMirClientDebugExtension::QMirClientDebugExtension() - : m_mirclientDebug(QStringLiteral("mirclient-debug-extension"), 1) - , m_mapper(nullptr) -{ - qCDebug(mirclientDebug) << "NOTICE: Loading mirclient-debug-extension"; - m_mapper = (MapperPrototype) m_mirclientDebug.resolve("mir_debug_surface_coords_to_screen"); - - if (!m_mirclientDebug.isLoaded()) { - qCWarning(mirclientDebug) << "ERROR: mirclient-debug-extension failed to load:" - << m_mirclientDebug.errorString(); - } else if (!m_mapper) { - qCWarning(mirclientDebug) << "ERROR: unable to find required symbols in mirclient-debug-extension:" - << m_mirclientDebug.errorString(); - } -} - -QPoint QMirClientDebugExtension::mapSurfacePointToScreen(MirSurface *surface, const QPoint &point) -{ - if (!m_mapper) { - return point; - } - - QPoint mappedPoint; - bool status = m_mapper(surface, point.x(), point.y(), &mappedPoint.rx(), &mappedPoint.ry()); - if (status) { - return mappedPoint; - } else { - return point; - } -} diff --git a/src/plugins/platforms/mirclient/qmirclientdesktopwindow.cpp b/src/plugins/platforms/mirclient/qmirclientdesktopwindow.cpp deleted file mode 100644 index 123f805c25..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientdesktopwindow.cpp +++ /dev/null @@ -1,50 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#include "qmirclientdesktopwindow.h" - -// local -#include "qmirclientlogging.h" - -QMirClientDesktopWindow::QMirClientDesktopWindow(QWindow *window) - : QPlatformWindow(window) -{ - qCDebug(mirclient, "QMirClientDesktopWindow(window=%p)", window); -} diff --git a/src/plugins/platforms/mirclient/qmirclientdesktopwindow.h b/src/plugins/platforms/mirclient/qmirclientdesktopwindow.h deleted file mode 100644 index 3ba54db826..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientdesktopwindow.h +++ /dev/null @@ -1,53 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTDESKTOPWINDOW_H -#define QMIRCLIENTDESKTOPWINDOW_H - -#include <qpa/qplatformwindow.h> - -// TODO Implement it. For now it's just an empty, dummy class. -class QMirClientDesktopWindow : public QPlatformWindow -{ -public: - QMirClientDesktopWindow(QWindow*); -}; - -#endif // QMIRCLIENTDESKTOPWINDOW_H diff --git a/src/plugins/platforms/mirclient/qmirclientglcontext.cpp b/src/plugins/platforms/mirclient/qmirclientglcontext.cpp deleted file mode 100644 index fc7d90d5ec..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientglcontext.cpp +++ /dev/null @@ -1,132 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#include "qmirclientglcontext.h" -#include "qmirclientlogging.h" -#include "qmirclientwindow.h" - -#include <QOpenGLFramebufferObject> -#include <QtEglSupport/private/qeglconvenience_p.h> -#include <QtEglSupport/private/qeglpbuffer_p.h> -#include <QtGui/private/qopenglcontext_p.h> - -Q_LOGGING_CATEGORY(mirclientGraphics, "qt.qpa.mirclient.graphics", QtWarningMsg) - -namespace { - -void printEglConfig(EGLDisplay display, EGLConfig config) -{ - Q_ASSERT(display != EGL_NO_DISPLAY); - Q_ASSERT(config != nullptr); - - const char *string = eglQueryString(display, EGL_VENDOR); - qCDebug(mirclientGraphics, "EGL vendor: %s", string); - - string = eglQueryString(display, EGL_VERSION); - qCDebug(mirclientGraphics, "EGL version: %s", string); - - string = eglQueryString(display, EGL_EXTENSIONS); - qCDebug(mirclientGraphics, "EGL extensions: %s", string); - - qCDebug(mirclientGraphics, "EGL configuration attributes:"); - q_printEglConfig(display, config); -} - -} // anonymous namespace - -QMirClientOpenGLContext::QMirClientOpenGLContext(const QSurfaceFormat &format, QPlatformOpenGLContext *share, - EGLDisplay display) - : QEGLPlatformContext(format, share, display, 0) -{ - if (mirclientGraphics().isDebugEnabled()) { - printEglConfig(display, eglConfig()); - } -} - -static bool needsFBOReadBackWorkaround() -{ - static bool set = false; - static bool needsWorkaround = false; - - if (Q_UNLIKELY(!set)) { - const char *rendererString = reinterpret_cast<const char *>(glGetString(GL_RENDERER)); - needsWorkaround = qstrncmp(rendererString, "Mali-400", 8) == 0 - || qstrncmp(rendererString, "Mali-T7", 7) == 0 - || qstrncmp(rendererString, "PowerVR Rogue G6200", 19) == 0; - set = true; - } - - return needsWorkaround; -} - -bool QMirClientOpenGLContext::makeCurrent(QPlatformSurface* surface) -{ - const bool ret = QEGLPlatformContext::makeCurrent(surface); - - if (Q_LIKELY(ret)) { - QOpenGLContextPrivate *ctx_d = QOpenGLContextPrivate::get(context()); - if (!ctx_d->workaround_brokenFBOReadBack && needsFBOReadBackWorkaround()) { - ctx_d->workaround_brokenFBOReadBack = true; - } - } - return ret; -} - -// Following method used internally in the base class QEGLPlatformContext to access -// the egl surface of a QPlatformSurface/QMirClientWindow -EGLSurface QMirClientOpenGLContext::eglSurfaceForPlatformSurface(QPlatformSurface *surface) -{ - if (surface->surface()->surfaceClass() == QSurface::Window) { - return static_cast<QMirClientWindow *>(surface)->eglSurface(); - } else { - return static_cast<QEGLPbuffer *>(surface)->pbuffer(); - } -} - -void QMirClientOpenGLContext::swapBuffers(QPlatformSurface* surface) -{ - QEGLPlatformContext::swapBuffers(surface); - - if (surface->surface()->surfaceClass() == QSurface::Window) { - // notify window on swap completion - auto platformWindow = static_cast<QMirClientWindow *>(surface); - platformWindow->onSwapBuffersDone(); - } -} diff --git a/src/plugins/platforms/mirclient/qmirclientglcontext.h b/src/plugins/platforms/mirclient/qmirclientglcontext.h deleted file mode 100644 index 92331a6fb1..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientglcontext.h +++ /dev/null @@ -1,63 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTGLCONTEXT_H -#define QMIRCLIENTGLCONTEXT_H - -#include <qpa/qplatformopenglcontext.h> -#include <QtEglSupport/private/qeglplatformcontext_p.h> - -#include <EGL/egl.h> - -class QMirClientOpenGLContext : public QEGLPlatformContext -{ -public: - QMirClientOpenGLContext(const QSurfaceFormat &format, QPlatformOpenGLContext *share, - EGLDisplay display); - - // QEGLPlatformContext methods. - void swapBuffers(QPlatformSurface *surface) final; - bool makeCurrent(QPlatformSurface *surface) final; - -protected: - EGLSurface eglSurfaceForPlatformSurface(QPlatformSurface *surface) final; -}; - -#endif // QMIRCLIENTGLCONTEXT_H diff --git a/src/plugins/platforms/mirclient/qmirclientinput.cpp b/src/plugins/platforms/mirclient/qmirclientinput.cpp deleted file mode 100644 index e5319b0435..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientinput.cpp +++ /dev/null @@ -1,708 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2014-2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -// Local -#include "qmirclientinput.h" -#include "qmirclientintegration.h" -#include "qmirclientnativeinterface.h" -#include "qmirclientscreen.h" -#include "qmirclientwindow.h" -#include "qmirclientlogging.h" -#include "qmirclientorientationchangeevent_p.h" - -// Qt -#include <QtCore/QThread> -#include <QtCore/qglobal.h> -#include <QtCore/QCoreApplication> -#include <QtGui/private/qguiapplication_p.h> -#include <qpa/qplatforminputcontext.h> -#include <qpa/qwindowsysteminterface.h> -#include <QTextCodec> - -#include <xkbcommon/xkbcommon.h> -#include <xkbcommon/xkbcommon-keysyms.h> - -#include <mir_toolkit/mir_client_library.h> - -Q_LOGGING_CATEGORY(mirclientInput, "qt.qpa.mirclient.input", QtWarningMsg) - -namespace -{ - -// XKB Keysyms which do not map directly to Qt types (i.e. Unicode points) -static const uint32_t KeyTable[] = { - XKB_KEY_Escape, Qt::Key_Escape, - XKB_KEY_Tab, Qt::Key_Tab, - XKB_KEY_ISO_Left_Tab, Qt::Key_Backtab, - XKB_KEY_BackSpace, Qt::Key_Backspace, - XKB_KEY_Return, Qt::Key_Return, - XKB_KEY_Insert, Qt::Key_Insert, - XKB_KEY_Delete, Qt::Key_Delete, - XKB_KEY_Clear, Qt::Key_Delete, - XKB_KEY_Pause, Qt::Key_Pause, - XKB_KEY_Print, Qt::Key_Print, - - XKB_KEY_Home, Qt::Key_Home, - XKB_KEY_End, Qt::Key_End, - XKB_KEY_Left, Qt::Key_Left, - XKB_KEY_Up, Qt::Key_Up, - XKB_KEY_Right, Qt::Key_Right, - XKB_KEY_Down, Qt::Key_Down, - XKB_KEY_Prior, Qt::Key_PageUp, - XKB_KEY_Next, Qt::Key_PageDown, - - XKB_KEY_Shift_L, Qt::Key_Shift, - XKB_KEY_Shift_R, Qt::Key_Shift, - XKB_KEY_Shift_Lock, Qt::Key_Shift, - XKB_KEY_Control_L, Qt::Key_Control, - XKB_KEY_Control_R, Qt::Key_Control, - XKB_KEY_Meta_L, Qt::Key_Meta, - XKB_KEY_Meta_R, Qt::Key_Meta, - XKB_KEY_Alt_L, Qt::Key_Alt, - XKB_KEY_Alt_R, Qt::Key_Alt, - XKB_KEY_Caps_Lock, Qt::Key_CapsLock, - XKB_KEY_Num_Lock, Qt::Key_NumLock, - XKB_KEY_Scroll_Lock, Qt::Key_ScrollLock, - XKB_KEY_Super_L, Qt::Key_Super_L, - XKB_KEY_Super_R, Qt::Key_Super_R, - XKB_KEY_Menu, Qt::Key_Menu, - XKB_KEY_Hyper_L, Qt::Key_Hyper_L, - XKB_KEY_Hyper_R, Qt::Key_Hyper_R, - XKB_KEY_Help, Qt::Key_Help, - - XKB_KEY_KP_Space, Qt::Key_Space, - XKB_KEY_KP_Tab, Qt::Key_Tab, - XKB_KEY_KP_Enter, Qt::Key_Enter, - XKB_KEY_KP_Home, Qt::Key_Home, - XKB_KEY_KP_Left, Qt::Key_Left, - XKB_KEY_KP_Up, Qt::Key_Up, - XKB_KEY_KP_Right, Qt::Key_Right, - XKB_KEY_KP_Down, Qt::Key_Down, - XKB_KEY_KP_Prior, Qt::Key_PageUp, - XKB_KEY_KP_Next, Qt::Key_PageDown, - XKB_KEY_KP_End, Qt::Key_End, - XKB_KEY_KP_Begin, Qt::Key_Clear, - XKB_KEY_KP_Insert, Qt::Key_Insert, - XKB_KEY_KP_Delete, Qt::Key_Delete, - XKB_KEY_KP_Equal, Qt::Key_Equal, - XKB_KEY_KP_Multiply, Qt::Key_Asterisk, - XKB_KEY_KP_Add, Qt::Key_Plus, - XKB_KEY_KP_Separator, Qt::Key_Comma, - XKB_KEY_KP_Subtract, Qt::Key_Minus, - XKB_KEY_KP_Decimal, Qt::Key_Period, - XKB_KEY_KP_Divide, Qt::Key_Slash, - - XKB_KEY_ISO_Level3_Shift, Qt::Key_AltGr, - XKB_KEY_Multi_key, Qt::Key_Multi_key, - XKB_KEY_Codeinput, Qt::Key_Codeinput, - XKB_KEY_SingleCandidate, Qt::Key_SingleCandidate, - XKB_KEY_MultipleCandidate, Qt::Key_MultipleCandidate, - XKB_KEY_PreviousCandidate, Qt::Key_PreviousCandidate, - - // dead keys - XKB_KEY_dead_grave, Qt::Key_Dead_Grave, - XKB_KEY_dead_acute, Qt::Key_Dead_Acute, - XKB_KEY_dead_circumflex, Qt::Key_Dead_Circumflex, - XKB_KEY_dead_tilde, Qt::Key_Dead_Tilde, - XKB_KEY_dead_macron, Qt::Key_Dead_Macron, - XKB_KEY_dead_breve, Qt::Key_Dead_Breve, - XKB_KEY_dead_abovedot, Qt::Key_Dead_Abovedot, - XKB_KEY_dead_diaeresis, Qt::Key_Dead_Diaeresis, - XKB_KEY_dead_abovering, Qt::Key_Dead_Abovering, - XKB_KEY_dead_doubleacute, Qt::Key_Dead_Doubleacute, - XKB_KEY_dead_caron, Qt::Key_Dead_Caron, - XKB_KEY_dead_cedilla, Qt::Key_Dead_Cedilla, - XKB_KEY_dead_ogonek, Qt::Key_Dead_Ogonek, - XKB_KEY_dead_iota, Qt::Key_Dead_Iota, - XKB_KEY_dead_voiced_sound, Qt::Key_Dead_Voiced_Sound, - XKB_KEY_dead_semivoiced_sound, Qt::Key_Dead_Semivoiced_Sound, - XKB_KEY_dead_belowdot, Qt::Key_Dead_Belowdot, - XKB_KEY_dead_hook, Qt::Key_Dead_Hook, - XKB_KEY_dead_horn, Qt::Key_Dead_Horn, - XKB_KEY_dead_stroke, Qt::Key_Dead_Stroke, - XKB_KEY_dead_abovecomma, Qt::Key_Dead_Abovecomma, - XKB_KEY_dead_abovereversedcomma, Qt::Key_Dead_Abovereversedcomma, - XKB_KEY_dead_doublegrave, Qt::Key_Dead_Doublegrave, - XKB_KEY_dead_belowring, Qt::Key_Dead_Belowring, - XKB_KEY_dead_belowmacron, Qt::Key_Dead_Belowmacron, - XKB_KEY_dead_belowcircumflex, Qt::Key_Dead_Belowcircumflex, - XKB_KEY_dead_belowtilde, Qt::Key_Dead_Belowtilde, - XKB_KEY_dead_belowbreve, Qt::Key_Dead_Belowbreve, - XKB_KEY_dead_belowdiaeresis, Qt::Key_Dead_Belowdiaeresis, - XKB_KEY_dead_invertedbreve, Qt::Key_Dead_Invertedbreve, - XKB_KEY_dead_belowcomma, Qt::Key_Dead_Belowcomma, - XKB_KEY_dead_currency, Qt::Key_Dead_Currency, - XKB_KEY_dead_a, Qt::Key_Dead_a, - XKB_KEY_dead_A, Qt::Key_Dead_A, - XKB_KEY_dead_e, Qt::Key_Dead_e, - XKB_KEY_dead_E, Qt::Key_Dead_E, - XKB_KEY_dead_i, Qt::Key_Dead_i, - XKB_KEY_dead_I, Qt::Key_Dead_I, - XKB_KEY_dead_o, Qt::Key_Dead_o, - XKB_KEY_dead_O, Qt::Key_Dead_O, - XKB_KEY_dead_u, Qt::Key_Dead_u, - XKB_KEY_dead_U, Qt::Key_Dead_U, - XKB_KEY_dead_small_schwa, Qt::Key_Dead_Small_Schwa, - XKB_KEY_dead_capital_schwa, Qt::Key_Dead_Capital_Schwa, - XKB_KEY_dead_greek, Qt::Key_Dead_Greek, - XKB_KEY_dead_lowline, Qt::Key_Dead_Lowline, - XKB_KEY_dead_aboveverticalline, Qt::Key_Dead_Aboveverticalline, - XKB_KEY_dead_belowverticalline, Qt::Key_Dead_Belowverticalline, - XKB_KEY_dead_longsolidusoverlay, Qt::Key_Dead_Longsolidusoverlay, - - XKB_KEY_Mode_switch, Qt::Key_Mode_switch, - XKB_KEY_script_switch, Qt::Key_Mode_switch, - XKB_KEY_XF86AudioRaiseVolume, Qt::Key_VolumeUp, - XKB_KEY_XF86AudioLowerVolume, Qt::Key_VolumeDown, - XKB_KEY_XF86PowerOff, Qt::Key_PowerOff, - XKB_KEY_XF86PowerDown, Qt::Key_PowerDown, - - 0, 0 -}; - -Qt::WindowState mirSurfaceStateToWindowState(MirSurfaceState state) -{ - switch (state) { - case mir_surface_state_fullscreen: - return Qt::WindowFullScreen; - case mir_surface_state_maximized: - case mir_surface_state_vertmaximized: - case mir_surface_state_horizmaximized: - return Qt::WindowMaximized; - case mir_surface_state_minimized: - return Qt::WindowMinimized; - case mir_surface_state_hidden: - // We should be handling this state separately. - Q_ASSERT(false); - case mir_surface_state_restored: - case mir_surface_state_unknown: - default: - return Qt::WindowNoState; - } -} - -} // namespace - -class UbuntuEvent : public QEvent -{ -public: - UbuntuEvent(QMirClientWindow* window, const MirEvent *event, QEvent::Type type) - : QEvent(type), window(window) { - nativeEvent = mir_event_ref(event); - } - ~UbuntuEvent() - { - mir_event_unref(nativeEvent); - } - - QPointer<QMirClientWindow> window; - const MirEvent *nativeEvent; -}; - -QMirClientInput::QMirClientInput(QMirClientClientIntegration* integration) - : QObject(nullptr) - , mIntegration(integration) - , mEventFilterType(static_cast<QMirClientNativeInterface*>( - integration->nativeInterface())->genericEventFilterType()) - , mEventType(static_cast<QEvent::Type>(QEvent::registerEventType())) - , mLastInputWindow(nullptr) -{ - // Initialize touch device. - mTouchDevice = new QTouchDevice; - mTouchDevice->setType(QTouchDevice::TouchScreen); - mTouchDevice->setCapabilities( - QTouchDevice::Position | QTouchDevice::Area | QTouchDevice::Pressure | - QTouchDevice::NormalizedPosition); - QWindowSystemInterface::registerTouchDevice(mTouchDevice); -} - -QMirClientInput::~QMirClientInput() -{ - // Qt will take care of deleting mTouchDevice. -} - -static const char* nativeEventTypeToStr(MirEventType t) -{ - switch (t) - { - case mir_event_type_key: - return "key"; - case mir_event_type_motion: - return "motion"; - case mir_event_type_surface: - return "surface"; - case mir_event_type_resize: - return "resize"; - case mir_event_type_prompt_session_state_change: - return "prompt_session_state_change"; - case mir_event_type_orientation: - return "orientation"; - case mir_event_type_close_surface: - return "close_surface"; - case mir_event_type_input: - return "input"; - case mir_event_type_keymap: - return "keymap"; - case mir_event_type_input_configuration: - return "input_configuration"; - case mir_event_type_surface_output: - return "surface_output"; - case mir_event_type_input_device_state: - return "input_device_state"; - default: - return "unknown"; - } -} - -void QMirClientInput::customEvent(QEvent* event) -{ - Q_ASSERT(QThread::currentThread() == thread()); - UbuntuEvent* ubuntuEvent = static_cast<UbuntuEvent*>(event); - const MirEvent *nativeEvent = ubuntuEvent->nativeEvent; - - if ((ubuntuEvent->window == nullptr) || (ubuntuEvent->window->window() == nullptr)) { - qCWarning(mirclient) << "Attempted to deliver an event to a non-existent window, ignoring."; - return; - } - - // Event filtering. - long result; - if (QWindowSystemInterface::handleNativeEvent( - ubuntuEvent->window->window(), mEventFilterType, - const_cast<void *>(static_cast<const void *>(nativeEvent)), &result) == true) { - qCDebug(mirclient, "event filtered out by native interface"); - return; - } - - qCDebug(mirclientInput, "customEvent(type=%s)", nativeEventTypeToStr(mir_event_get_type(nativeEvent))); - - // Event dispatching. - switch (mir_event_get_type(nativeEvent)) - { - case mir_event_type_input: - dispatchInputEvent(ubuntuEvent->window, mir_event_get_input_event(nativeEvent)); - break; - case mir_event_type_resize: - { - auto resizeEvent = mir_event_get_resize_event(nativeEvent); - - // Enable workaround for Screen rotation - auto const targetWindow = ubuntuEvent->window; - if (targetWindow) { - auto const screen = static_cast<QMirClientScreen*>(targetWindow->screen()); - if (screen) { - screen->handleWindowSurfaceResize( - mir_resize_event_get_width(resizeEvent), - mir_resize_event_get_height(resizeEvent)); - } - - targetWindow->handleSurfaceResized( - mir_resize_event_get_width(resizeEvent), - mir_resize_event_get_height(resizeEvent)); - } - break; - } - case mir_event_type_surface: - handleSurfaceEvent(ubuntuEvent->window, mir_event_get_surface_event(nativeEvent)); - break; - case mir_event_type_surface_output: - handleSurfaceOutputEvent(ubuntuEvent->window, mir_event_get_surface_output_event(nativeEvent)); - break; - case mir_event_type_orientation: - dispatchOrientationEvent(ubuntuEvent->window->window(), mir_event_get_orientation_event(nativeEvent)); - break; - case mir_event_type_close_surface: - QWindowSystemInterface::handleCloseEvent(ubuntuEvent->window->window()); - break; - default: - qCDebug(mirclient, "unhandled event type: %d", static_cast<int>(mir_event_get_type(nativeEvent))); - } -} - -void QMirClientInput::postEvent(QMirClientWindow *platformWindow, const MirEvent *event) -{ - QWindow *window = platformWindow->window(); - - QCoreApplication::postEvent(this, new UbuntuEvent( - platformWindow, event, mEventType)); - - if ((window->flags().testFlag(Qt::WindowTransparentForInput)) && window->parent()) { - QCoreApplication::postEvent(this, new UbuntuEvent( - static_cast<QMirClientWindow*>(platformWindow->QPlatformWindow::parent()), - event, mEventType)); - } -} - -void QMirClientInput::dispatchInputEvent(QMirClientWindow *window, const MirInputEvent *ev) -{ - switch (mir_input_event_get_type(ev)) - { - case mir_input_event_type_key: - dispatchKeyEvent(window, ev); - break; - case mir_input_event_type_touch: - dispatchTouchEvent(window, ev); - break; - case mir_input_event_type_pointer: - dispatchPointerEvent(window, ev); - break; - default: - break; - } -} - -void QMirClientInput::dispatchTouchEvent(QMirClientWindow *window, const MirInputEvent *ev) -{ - const MirTouchEvent *tev = mir_input_event_get_touch_event(ev); - - // FIXME(loicm) Max pressure is device specific. That one is for the Samsung Galaxy Nexus. That - // needs to be fixed as soon as the compat input lib adds query support. - const float kMaxPressure = 1.28; - const QRect kWindowGeometry = window->geometry(); - QList<QWindowSystemInterface::TouchPoint> touchPoints; - - - // TODO: Is it worth setting the Qt::TouchPointStationary ones? Currently they are left - // as Qt::TouchPointMoved - const unsigned int kPointerCount = mir_touch_event_point_count(tev); - touchPoints.reserve(int(kPointerCount)); - for (unsigned int i = 0; i < kPointerCount; ++i) { - QWindowSystemInterface::TouchPoint touchPoint; - - const float kX = mir_touch_event_axis_value(tev, i, mir_touch_axis_x) + kWindowGeometry.x(); - const float kY = mir_touch_event_axis_value(tev, i, mir_touch_axis_y) + kWindowGeometry.y(); // see bug lp:1346633 workaround comments elsewhere - const float kW = mir_touch_event_axis_value(tev, i, mir_touch_axis_touch_major); - const float kH = mir_touch_event_axis_value(tev, i, mir_touch_axis_touch_minor); - const float kP = mir_touch_event_axis_value(tev, i, mir_touch_axis_pressure); - touchPoint.id = mir_touch_event_id(tev, i); - touchPoint.normalPosition = QPointF(kX / kWindowGeometry.width(), kY / kWindowGeometry.height()); - touchPoint.area = QRectF(kX - (kW / 2.0), kY - (kH / 2.0), kW, kH); - touchPoint.pressure = kP / kMaxPressure; - - MirTouchAction touch_action = mir_touch_event_action(tev, i); - switch (touch_action) - { - case mir_touch_action_down: - mLastInputWindow = window; - touchPoint.state = Qt::TouchPointPressed; - break; - case mir_touch_action_up: - touchPoint.state = Qt::TouchPointReleased; - break; - case mir_touch_action_change: - touchPoint.state = Qt::TouchPointMoved; - break; - default: - Q_UNREACHABLE(); - } - - touchPoints.append(touchPoint); - } - - ulong timestamp = mir_input_event_get_event_time(ev) / 1000000; - QWindowSystemInterface::handleTouchEvent(window->window(), timestamp, - mTouchDevice, touchPoints); -} - -static uint32_t translateKeysym(uint32_t sym, const QString &text) { - int code = 0; - - QTextCodec *systemCodec = QTextCodec::codecForLocale(); - if (sym < 128 || (sym < 256 && systemCodec->mibEnum() == 4)) { - // upper-case key, if known - code = isprint((int)sym) ? toupper((int)sym) : 0; - } else if (sym >= XKB_KEY_F1 && sym <= XKB_KEY_F35) { - return Qt::Key_F1 + (int(sym) - XKB_KEY_F1); - } else if (text.length() == 1 && text.unicode()->unicode() > 0x1f - && text.unicode()->unicode() != 0x7f - && !(sym >= XKB_KEY_dead_grave && sym <= XKB_KEY_dead_currency)) { - code = text.unicode()->toUpper().unicode(); - } else { - for (int i = 0; KeyTable[i]; i += 2) - if (sym == KeyTable[i]) - code = KeyTable[i + 1]; - } - - return code; -} - -namespace -{ -Qt::KeyboardModifiers qt_modifiers_from_mir(MirInputEventModifiers modifiers) -{ - Qt::KeyboardModifiers q_modifiers = Qt::NoModifier; - if (modifiers & mir_input_event_modifier_shift) { - q_modifiers |= Qt::ShiftModifier; - } - if (modifiers & mir_input_event_modifier_ctrl) { - q_modifiers |= Qt::ControlModifier; - } - if (modifiers & mir_input_event_modifier_alt_left) { - q_modifiers |= Qt::AltModifier; - } - if (modifiers & mir_input_event_modifier_meta) { - q_modifiers |= Qt::MetaModifier; - } - if (modifiers & mir_input_event_modifier_alt_right) { - q_modifiers |= Qt::GroupSwitchModifier; - } - return q_modifiers; -} -} - -void QMirClientInput::dispatchKeyEvent(QMirClientWindow *window, const MirInputEvent *event) -{ - const MirKeyboardEvent *key_event = mir_input_event_get_keyboard_event(event); - - ulong timestamp = mir_input_event_get_event_time(event) / 1000000; - xkb_keysym_t xk_sym = mir_keyboard_event_key_code(key_event); - quint32 scan_code = mir_keyboard_event_scan_code(key_event); - quint32 native_modifiers = mir_keyboard_event_modifiers(key_event); - - // Key modifier and unicode index mapping. - auto modifiers = qt_modifiers_from_mir(native_modifiers); - - MirKeyboardAction action = mir_keyboard_event_action(key_event); - QEvent::Type keyType = action == mir_keyboard_action_up - ? QEvent::KeyRelease : QEvent::KeyPress; - - if (action == mir_keyboard_action_down) - mLastInputWindow = window; - - QString text; - QVarLengthArray<char, 32> chars(32); - { - int result = xkb_keysym_to_utf8(xk_sym, chars.data(), chars.size()); - - if (result > 0) { - text = QString::fromUtf8(chars.constData()); - } - } - int sym = translateKeysym(xk_sym, text); - - bool is_auto_rep = action == mir_keyboard_action_repeat; - - QPlatformInputContext *context = QGuiApplicationPrivate::platformIntegration()->inputContext(); - if (context) { - QKeyEvent qKeyEvent(keyType, sym, modifiers, scan_code, xk_sym, native_modifiers, text, is_auto_rep); - qKeyEvent.setTimestamp(timestamp); - if (context->filterEvent(&qKeyEvent)) { - qCDebug(mirclient, "key event filtered out by input context"); - return; - } - } - - QWindowSystemInterface::handleExtendedKeyEvent(window->window(), timestamp, keyType, sym, modifiers, scan_code, xk_sym, native_modifiers, text, is_auto_rep); -} - -namespace -{ -Qt::MouseButtons extract_buttons(const MirPointerEvent *pev) -{ - Qt::MouseButtons buttons = Qt::NoButton; - if (mir_pointer_event_button_state(pev, mir_pointer_button_primary)) - buttons |= Qt::LeftButton; - if (mir_pointer_event_button_state(pev, mir_pointer_button_secondary)) - buttons |= Qt::RightButton; - if (mir_pointer_event_button_state(pev, mir_pointer_button_tertiary)) - buttons |= Qt::MiddleButton; - if (mir_pointer_event_button_state(pev, mir_pointer_button_back)) - buttons |= Qt::BackButton; - if (mir_pointer_event_button_state(pev, mir_pointer_button_forward)) - buttons |= Qt::ForwardButton; - - return buttons; -} -} - -void QMirClientInput::dispatchPointerEvent(QMirClientWindow *platformWindow, const MirInputEvent *ev) -{ - const auto window = platformWindow->window(); - const auto timestamp = mir_input_event_get_event_time(ev) / 1000000; - - const auto pev = mir_input_event_get_pointer_event(ev); - const auto action = mir_pointer_event_action(pev); - - const auto modifiers = qt_modifiers_from_mir(mir_pointer_event_modifiers(pev)); - const auto localPoint = QPointF(mir_pointer_event_axis_value(pev, mir_pointer_axis_x), - mir_pointer_event_axis_value(pev, mir_pointer_axis_y)); - - mLastInputWindow = platformWindow; - - switch (action) { - case mir_pointer_action_button_up: - case mir_pointer_action_button_down: - case mir_pointer_action_motion: - { - const float hDelta = mir_pointer_event_axis_value(pev, mir_pointer_axis_hscroll); - const float vDelta = mir_pointer_event_axis_value(pev, mir_pointer_axis_vscroll); - - if (hDelta != 0 || vDelta != 0) { - // QWheelEvent::DefaultDeltasPerStep = 120 but doesn't exist on vivid - const QPoint angleDelta(120 * hDelta, 120 * vDelta); - QWindowSystemInterface::handleWheelEvent(window, timestamp, localPoint, window->position() + localPoint, - QPoint(), angleDelta, modifiers, Qt::ScrollUpdate); - } - auto buttons = extract_buttons(pev); - QWindowSystemInterface::handleMouseEvent(window, timestamp, localPoint, window->position() + localPoint /* Should we omit global point instead? */, - buttons, modifiers); - break; - } - case mir_pointer_action_enter: - QWindowSystemInterface::handleEnterEvent(window, localPoint, window->position() + localPoint); - break; - case mir_pointer_action_leave: - QWindowSystemInterface::handleLeaveEvent(window); - break; - default: - Q_UNREACHABLE(); - } -} - -static const char* nativeOrientationDirectionToStr(MirOrientation orientation) -{ - switch (orientation) { - case mir_orientation_normal: - return "Normal"; - case mir_orientation_left: - return "Left"; - case mir_orientation_inverted: - return "Inverted"; - case mir_orientation_right: - return "Right"; - } - Q_UNREACHABLE(); -} - -void QMirClientInput::dispatchOrientationEvent(QWindow *window, const MirOrientationEvent *event) -{ - MirOrientation mir_orientation = mir_orientation_event_get_direction(event); - qCDebug(mirclientInput, "orientation direction: %s", nativeOrientationDirectionToStr(mir_orientation)); - - if (!window->screen()) { - qCDebug(mirclient, "Window has no associated screen, dropping orientation event"); - return; - } - - OrientationChangeEvent::Orientation orientation; - switch (mir_orientation) { - case mir_orientation_normal: - orientation = OrientationChangeEvent::TopUp; - break; - case mir_orientation_left: - orientation = OrientationChangeEvent::LeftUp; - break; - case mir_orientation_inverted: - orientation = OrientationChangeEvent::TopDown; - break; - case mir_orientation_right: - orientation = OrientationChangeEvent::RightUp; - break; - default: - qCDebug(mirclient, "No such orientation %d", mir_orientation); - return; - } - - // Dispatch orientation event to [Platform]Screen, as that is where Qt reads it. Screen will handle - // notifying Qt of the actual orientation change - done to prevent multiple Windows each creating - // an identical orientation change event and passing it directly to Qt. - // [Platform]Screen can also factor in the native orientation. - QCoreApplication::postEvent(static_cast<QMirClientScreen*>(window->screen()->handle()), - new OrientationChangeEvent(OrientationChangeEvent::mType, orientation)); -} - -void QMirClientInput::handleSurfaceEvent(const QPointer<QMirClientWindow> &window, const MirSurfaceEvent *event) -{ - auto surfaceEventAttribute = mir_surface_event_get_attribute(event); - - switch (surfaceEventAttribute) { - case mir_surface_attrib_focus: { - window->handleSurfaceFocusChanged( - mir_surface_event_get_attribute_value(event) == mir_surface_focused); - break; - } - case mir_surface_attrib_visibility: { - window->handleSurfaceExposeChange( - mir_surface_event_get_attribute_value(event) == mir_surface_visibility_exposed); - break; - } - // Remaining attributes are ones client sets for server, and server should not override them - case mir_surface_attrib_state: { - MirSurfaceState state = static_cast<MirSurfaceState>(mir_surface_event_get_attribute_value(event)); - - if (state == mir_surface_state_hidden) { - window->handleSurfaceVisibilityChanged(false); - } else { - // it's visible! - window->handleSurfaceVisibilityChanged(true); - window->handleSurfaceStateChanged(mirSurfaceStateToWindowState(state)); - } - break; - } - case mir_surface_attrib_type: - case mir_surface_attrib_swapinterval: - case mir_surface_attrib_dpi: - case mir_surface_attrib_preferred_orientation: - case mir_surface_attribs: - break; - } -} - -void QMirClientInput::handleSurfaceOutputEvent(const QPointer<QMirClientWindow> &window, const MirSurfaceOutputEvent *event) -{ - const uint32_t outputId = mir_surface_output_event_get_output_id(event); - const int dpi = mir_surface_output_event_get_dpi(event); - const MirFormFactor formFactor = mir_surface_output_event_get_form_factor(event); - const float scale = mir_surface_output_event_get_scale(event); - - const auto screenObserver = mIntegration->screenObserver(); - QMirClientScreen *screen = screenObserver->findScreenWithId(outputId); - if (!screen) { - qCWarning(mirclient) << "Mir notified window" << window->window() << "on an unknown screen with id" << outputId; - return; - } - - screenObserver->handleScreenPropertiesChange(screen, dpi, formFactor, scale); - window->handleScreenPropertiesChange(formFactor, scale); - - if (window->screen() != screen) { - QWindowSystemInterface::handleWindowScreenChanged(window->window(), screen->screen()); - } -} diff --git a/src/plugins/platforms/mirclient/qmirclientinput.h b/src/plugins/platforms/mirclient/qmirclientinput.h deleted file mode 100644 index 263cb5e54e..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientinput.h +++ /dev/null @@ -1,86 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2014-2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTINPUT_H -#define QMIRCLIENTINPUT_H - -// Qt -#include <qpa/qwindowsysteminterface.h> - -#include <mir_toolkit/mir_client_library.h> - -class QMirClientClientIntegration; -class QMirClientWindow; - -class QMirClientInput : public QObject -{ - Q_OBJECT - -public: - QMirClientInput(QMirClientClientIntegration* integration); - virtual ~QMirClientInput(); - - // QObject methods. - void customEvent(QEvent* event) override; - - void postEvent(QMirClientWindow* window, const MirEvent *event); - QMirClientClientIntegration* integration() const { return mIntegration; } - QMirClientWindow *lastInputWindow() const {return mLastInputWindow; } - -protected: - void dispatchKeyEvent(QMirClientWindow *window, const MirInputEvent *event); - void dispatchPointerEvent(QMirClientWindow *window, const MirInputEvent *event); - void dispatchTouchEvent(QMirClientWindow *window, const MirInputEvent *event); - void dispatchInputEvent(QMirClientWindow *window, const MirInputEvent *event); - - void dispatchOrientationEvent(QWindow* window, const MirOrientationEvent *event); - void handleSurfaceEvent(const QPointer<QMirClientWindow> &window, const MirSurfaceEvent *event); - void handleSurfaceOutputEvent(const QPointer<QMirClientWindow> &window, const MirSurfaceOutputEvent *event); - -private: - QMirClientClientIntegration* mIntegration; - QTouchDevice* mTouchDevice; - const QByteArray mEventFilterType; - const QEvent::Type mEventType; - - QMirClientWindow *mLastInputWindow; -}; - -#endif // QMIRCLIENTINPUT_H diff --git a/src/plugins/platforms/mirclient/qmirclientintegration.cpp b/src/plugins/platforms/mirclient/qmirclientintegration.cpp deleted file mode 100644 index d2b1dbee0d..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientintegration.cpp +++ /dev/null @@ -1,412 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2014-2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -// Local -#include "qmirclientintegration.h" -#include "qmirclientbackingstore.h" -#include "qmirclientclipboard.h" -#include "qmirclientdebugextension.h" -#include "qmirclientdesktopwindow.h" -#include "qmirclientglcontext.h" -#include "qmirclientinput.h" -#include "qmirclientlogging.h" -#include "qmirclientnativeinterface.h" -#include "qmirclientscreen.h" -#include "qmirclienttheme.h" -#include "qmirclientwindow.h" - -// Qt -#include <QFileInfo> -#include <QGuiApplication> -#include <qpa/qplatformnativeinterface.h> -#include <qpa/qplatforminputcontextfactory_p.h> -#include <qpa/qplatforminputcontext.h> -#include <qpa/qwindowsysteminterface.h> -#include <QtEglSupport/private/qeglconvenience_p.h> -#include <QtEglSupport/private/qeglpbuffer_p.h> -#include <QtFontDatabaseSupport/private/qgenericunixfontdatabase_p.h> -#include <QtEventDispatcherSupport/private/qgenericunixeventdispatcher_p.h> -#ifndef QT_NO_ACCESSIBILITY -#include <qpa/qplatformaccessibility.h> -#ifndef QT_NO_ACCESSIBILITY_ATSPI_BRIDGE -#include <QtLinuxAccessibilitySupport/private/bridge_p.h> -#endif -#endif - -#include <QOpenGLContext> -#include <QOffscreenSurface> - -// platform-api -#include <ubuntu/application/lifecycle_delegate.h> -#include <ubuntu/application/id.h> -#include <ubuntu/application/options.h> - -static void resumedCallback(const UApplicationOptions */*options*/, void* context) -{ - auto integration = static_cast<QMirClientClientIntegration*>(context); - integration->appStateController()->setResumed(); -} - -static void aboutToStopCallback(UApplicationArchive */*archive*/, void* context) -{ - auto integration = static_cast<QMirClientClientIntegration*>(context); - auto inputContext = integration->inputContext(); - if (inputContext) { - inputContext->hideInputPanel(); - } else { - qCWarning(mirclient) << "aboutToStopCallback(): no input context"; - } - integration->appStateController()->setSuspended(); -} - -QMirClientClientIntegration::QMirClientClientIntegration(int argc, char **argv) - : QPlatformIntegration() - , mNativeInterface(new QMirClientNativeInterface(this)) - , mFontDb(new QGenericUnixFontDatabase) - , mServices(new QMirClientPlatformServices) - , mAppStateController(new QMirClientAppStateController) - , mScaleFactor(1.0) -{ - { - QStringList args = QCoreApplication::arguments(); - setupOptions(args); - QByteArray sessionName = generateSessionName(args); - setupDescription(sessionName); - } - - // Create new application instance - mInstance = u_application_instance_new_from_description_with_options(mDesc, mOptions); - - if (Q_UNLIKELY(!mInstance)) - qFatal("QMirClientClientIntegration: connection to Mir server failed. Check that a Mir server is\n" - "running, and the correct socket is being used and is accessible. The shell may have\n" - "rejected the incoming connection, so check its log file"); - - mMirConnection = u_application_instance_get_mir_connection(mInstance); - - // Choose the default surface format suited to the Mir platform - QSurfaceFormat defaultFormat; - defaultFormat.setRedBufferSize(8); - defaultFormat.setGreenBufferSize(8); - defaultFormat.setBlueBufferSize(8); - QSurfaceFormat::setDefaultFormat(defaultFormat); - - // Initialize EGL. - mEglNativeDisplay = mir_connection_get_egl_native_display(mMirConnection); - ASSERT((mEglDisplay = eglGetDisplay(mEglNativeDisplay)) != EGL_NO_DISPLAY); - ASSERT(eglInitialize(mEglDisplay, nullptr, nullptr) == EGL_TRUE); - - // Has debug mode been requsted, either with "-testability" switch or QT_LOAD_TESTABILITY env var - bool testability = qEnvironmentVariableIsSet("QT_LOAD_TESTABILITY"); - for (int i=1; !testability && i<argc; i++) { - if (strcmp(argv[i], "-testability") == 0) { - testability = true; - } - } - if (testability) { - mDebugExtension.reset(new QMirClientDebugExtension); - } -} - -void QMirClientClientIntegration::initialize() -{ - // Init the ScreenObserver - mScreenObserver.reset(new QMirClientScreenObserver(mMirConnection)); - connect(mScreenObserver.data(), &QMirClientScreenObserver::screenAdded, - [this](QMirClientScreen *screen) { QWindowSystemInterface::handleScreenAdded(screen); }); - connect(mScreenObserver.data(), &QMirClientScreenObserver::screenRemoved, - this, &QMirClientClientIntegration::destroyScreen); - - Q_FOREACH (auto screen, mScreenObserver->screens()) { - QWindowSystemInterface::handleScreenAdded(screen); - } - - // Initialize input. - mInput = new QMirClientInput(this); - mInputContext = QPlatformInputContextFactory::create(); - - // compute the scale factor - const int defaultGridUnit = 8; - int gridUnit = defaultGridUnit; - QByteArray gridUnitString = qgetenv("GRID_UNIT_PX"); - if (!gridUnitString.isEmpty()) { - bool ok; - gridUnit = gridUnitString.toInt(&ok); - if (!ok) { - gridUnit = defaultGridUnit; - } - } - mScaleFactor = static_cast<qreal>(gridUnit) / defaultGridUnit; -} - -QMirClientClientIntegration::~QMirClientClientIntegration() -{ - eglTerminate(mEglDisplay); - delete mInput; - delete mInputContext; - delete mServices; -} - -QPlatformServices *QMirClientClientIntegration::services() const -{ - return mServices; -} - -void QMirClientClientIntegration::setupOptions(QStringList &args) -{ - int argc = args.size() + 1; - char **argv = new char*[argc]; - for (int i = 0; i < argc - 1; i++) - argv[i] = qstrdup(args.at(i).toLocal8Bit()); - argv[argc - 1] = nullptr; - - mOptions = u_application_options_new_from_cmd_line(argc - 1, argv); - - for (int i = 0; i < argc; i++) - delete [] argv[i]; - delete [] argv; -} - -void QMirClientClientIntegration::setupDescription(QByteArray &sessionName) -{ - mDesc = u_application_description_new(); - - UApplicationId* id = u_application_id_new_from_stringn(sessionName.data(), sessionName.count()); - u_application_description_set_application_id(mDesc, id); - - UApplicationLifecycleDelegate* delegate = u_application_lifecycle_delegate_new(); - u_application_lifecycle_delegate_set_application_resumed_cb(delegate, &resumedCallback); - u_application_lifecycle_delegate_set_application_about_to_stop_cb(delegate, &aboutToStopCallback); - u_application_lifecycle_delegate_set_context(delegate, this); - u_application_description_set_application_lifecycle_delegate(mDesc, delegate); -} - -QByteArray QMirClientClientIntegration::generateSessionName(QStringList &args) -{ - // Try to come up with some meaningful session name to uniquely identify this session, - // helping with shell debugging - - if (args.count() == 0) { - return QByteArray("QtUbuntu"); - } if (args[0].contains("qmlscene")) { - return generateSessionNameFromQmlFile(args); - } else { - // use the executable name - QFileInfo fileInfo(args[0]); - return fileInfo.fileName().toLocal8Bit(); - } -} - -QByteArray QMirClientClientIntegration::generateSessionNameFromQmlFile(QStringList &args) -{ - Q_FOREACH (QString arg, args) { - if (arg.endsWith(".qml")) { - QFileInfo fileInfo(arg); - return fileInfo.fileName().toLocal8Bit(); - } - } - - // give up - return "qmlscene"; -} - -QPlatformWindow* QMirClientClientIntegration::createPlatformWindow(QWindow* window) const -{ - if (window->type() == Qt::Desktop) { - // Desktop windows should not be backed up by a mir surface as they don't draw anything (nor should). - return new QMirClientDesktopWindow(window); - } else { - return new QMirClientWindow(window, mInput, mNativeInterface, mAppStateController.data(), - mEglDisplay, mMirConnection, mDebugExtension.data()); - } -} - -bool QMirClientClientIntegration::hasCapability(QPlatformIntegration::Capability cap) const -{ - switch (cap) { - case ThreadedOpenGL: - if (qEnvironmentVariableIsEmpty("QTUBUNTU_NO_THREADED_OPENGL")) { - return true; - } else { - qCDebug(mirclient, "disabled threaded OpenGL"); - return false; - } - - case ThreadedPixmaps: - case OpenGL: - case ApplicationState: - case MultipleWindows: - case NonFullScreenWindows: -#if QT_VERSION > QT_VERSION_CHECK(5, 5, 0) - case SwitchableWidgetComposition: -#endif - case RasterGLSurface: // needed for QQuickWidget - return true; - default: - return QPlatformIntegration::hasCapability(cap); - } -} - -QAbstractEventDispatcher *QMirClientClientIntegration::createEventDispatcher() const -{ - return createUnixEventDispatcher(); -} - -QPlatformBackingStore* QMirClientClientIntegration::createPlatformBackingStore(QWindow* window) const -{ - return new QMirClientBackingStore(window); -} - -QPlatformOpenGLContext* QMirClientClientIntegration::createPlatformOpenGLContext( - QOpenGLContext* context) const -{ - QSurfaceFormat format(context->format()); - - auto platformContext = new QMirClientOpenGLContext(format, context->shareHandle(), mEglDisplay); - if (!platformContext->isValid()) { - // Older Intel Atom-based devices only support OpenGL 1.4 compatibility profile but by default - // QML asks for at least OpenGL 2.0. The XCB GLX backend ignores this request and returns a - // 1.4 context, but the XCB EGL backend tries to honor it, and fails. The 1.4 context appears to - // have sufficient capabilities on MESA (i915) to render correctly however. So reduce the default - // requested OpenGL version to 1.0 to ensure EGL will give us a working context (lp:1549455). - static const bool isMesa = QString(eglQueryString(mEglDisplay, EGL_VENDOR)).contains(QStringLiteral("Mesa")); - if (isMesa) { - qCDebug(mirclientGraphics, "Attempting to choose OpenGL 1.4 context which may suit Mesa"); - format.setMajorVersion(1); - format.setMinorVersion(4); - delete platformContext; - platformContext = new QMirClientOpenGLContext(format, context->shareHandle(), mEglDisplay); - } - } - return platformContext; -} - -QStringList QMirClientClientIntegration::themeNames() const -{ - return QStringList(QMirClientTheme::name); -} - -QPlatformTheme* QMirClientClientIntegration::createPlatformTheme(const QString& name) const -{ - Q_UNUSED(name); - return new QMirClientTheme; -} - -QVariant QMirClientClientIntegration::styleHint(StyleHint hint) const -{ - switch (hint) { - case QPlatformIntegration::StartDragDistance: { - // default is 10 pixels (see QPlatformTheme::defaultThemeHint) - return 10.0 * mScaleFactor; - } - case QPlatformIntegration::PasswordMaskDelay: { - // return time in milliseconds - 1 second - return QVariant(1000); - } - default: - break; - } - return QPlatformIntegration::styleHint(hint); -} - -QPlatformClipboard* QMirClientClientIntegration::clipboard() const -{ - static QPlatformClipboard *clipboard = nullptr; - if (!clipboard) { - clipboard = new QMirClientClipboard; - } - return clipboard; -} - -QPlatformNativeInterface* QMirClientClientIntegration::nativeInterface() const -{ - return mNativeInterface; -} - -QPlatformOffscreenSurface *QMirClientClientIntegration::createPlatformOffscreenSurface( - QOffscreenSurface *surface) const -{ - return new QEGLPbuffer(mEglDisplay, surface->requestedFormat(), surface); -} - -void QMirClientClientIntegration::destroyScreen(QMirClientScreen *screen) -{ - // FIXME: on deleting a screen while a Window is on it, Qt will automatically - // move the window to the primaryScreen(). This will trigger a screenChanged - // signal, causing things like QQuickScreenAttached to re-fetch screen properties - // like DPI and physical size. However this is crashing, as Qt is calling virtual - // functions on QPlatformScreen, for reasons unclear. As workaround, move window - // to primaryScreen() before deleting the screen. Might be QTBUG-38650 - - QScreen *primaryScreen = QGuiApplication::primaryScreen(); - if (screen != primaryScreen->handle()) { - uint32_t movedWindowCount = 0; - Q_FOREACH (QWindow *w, QGuiApplication::topLevelWindows()) { - if (w->screen()->handle() == screen) { - QWindowSystemInterface::handleWindowScreenChanged(w, primaryScreen); - ++movedWindowCount; - } - } - if (movedWindowCount > 0) { - QWindowSystemInterface::flushWindowSystemEvents(); - } - } - - qCDebug(mirclient) << "Removing Screen with id" << screen->mirOutputId() << "and geometry" << screen->geometry(); -#if QT_VERSION < QT_VERSION_CHECK(5, 5, 0) - delete screen; -#else - QWindowSystemInterface::handleScreenRemoved(screen); -#endif -} - -#ifndef QT_NO_ACCESSIBILITY -QPlatformAccessibility *QMirClientClientIntegration::accessibility() const -{ -#if !defined(QT_NO_ACCESSIBILITY_ATSPI_BRIDGE) - if (!mAccessibility) { - Q_ASSERT_X(QCoreApplication::eventDispatcher(), "QMirClientIntegration", - "Initializing accessibility without event-dispatcher!"); - mAccessibility.reset(new QSpiAccessibleBridge()); - } -#endif - return mAccessibility.data(); -} -#endif diff --git a/src/plugins/platforms/mirclient/qmirclientintegration.h b/src/plugins/platforms/mirclient/qmirclientintegration.h deleted file mode 100644 index 035117f4da..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientintegration.h +++ /dev/null @@ -1,131 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTINTEGRATION_H -#define QMIRCLIENTINTEGRATION_H - -#include <qpa/qplatformintegration.h> -#include <QSharedPointer> - -#include "qmirclientappstatecontroller.h" -#include "qmirclientplatformservices.h" -#include "qmirclientscreenobserver.h" - -// platform-api -#include <ubuntu/application/description.h> -#include <ubuntu/application/instance.h> - -#include <EGL/egl.h> - -class QMirClientDebugExtension; -class QMirClientInput; -class QMirClientNativeInterface; -class QMirClientScreen; -class MirConnection; - -class QMirClientClientIntegration : public QObject, public QPlatformIntegration -{ - Q_OBJECT - -public: - QMirClientClientIntegration(int argc, char **argv); - virtual ~QMirClientClientIntegration(); - - // QPlatformIntegration methods. - bool hasCapability(QPlatformIntegration::Capability cap) const override; - QAbstractEventDispatcher *createEventDispatcher() const override; - QPlatformNativeInterface* nativeInterface() const override; - QPlatformBackingStore* createPlatformBackingStore(QWindow* window) const override; - QPlatformOpenGLContext* createPlatformOpenGLContext(QOpenGLContext* context) const override; - QPlatformFontDatabase* fontDatabase() const override { return mFontDb; } - QStringList themeNames() const override; - QPlatformTheme* createPlatformTheme(const QString& name) const override; - QVariant styleHint(StyleHint hint) const override; - QPlatformServices *services() const override; - QPlatformWindow* createPlatformWindow(QWindow* window) const override; - QPlatformInputContext* inputContext() const override { return mInputContext; } - QPlatformClipboard* clipboard() const override; - void initialize() override; - QPlatformOffscreenSurface *createPlatformOffscreenSurface(QOffscreenSurface *surface) const override; - QPlatformAccessibility *accessibility() const override; - - // New methods. - MirConnection *mirConnection() const { return mMirConnection; } - EGLDisplay eglDisplay() const { return mEglDisplay; } - EGLNativeDisplayType eglNativeDisplay() const { return mEglNativeDisplay; } - QMirClientAppStateController *appStateController() const { return mAppStateController.data(); } - QMirClientScreenObserver *screenObserver() const { return mScreenObserver.data(); } - QMirClientDebugExtension *debugExtension() const { return mDebugExtension.data(); } - -private Q_SLOTS: - void destroyScreen(QMirClientScreen *screen); - -private: - void setupOptions(QStringList &args); - void setupDescription(QByteArray &sessionName); - static QByteArray generateSessionName(QStringList &args); - static QByteArray generateSessionNameFromQmlFile(QStringList &args); - - QMirClientNativeInterface* mNativeInterface; - QPlatformFontDatabase* mFontDb; - - QMirClientPlatformServices* mServices; - - QMirClientInput* mInput; - QPlatformInputContext* mInputContext; - mutable QScopedPointer<QPlatformAccessibility> mAccessibility; - QScopedPointer<QMirClientDebugExtension> mDebugExtension; - QScopedPointer<QMirClientScreenObserver> mScreenObserver; - QScopedPointer<QMirClientAppStateController> mAppStateController; - qreal mScaleFactor; - - MirConnection *mMirConnection; - - // Platform API stuff - UApplicationOptions* mOptions; - UApplicationDescription* mDesc; - UApplicationInstance* mInstance; - - // EGL related - EGLDisplay mEglDisplay{EGL_NO_DISPLAY}; - EGLNativeDisplayType mEglNativeDisplay; -}; - -#endif // QMIRCLIENTINTEGRATION_H diff --git a/src/plugins/platforms/mirclient/qmirclientlogging.h b/src/plugins/platforms/mirclient/qmirclientlogging.h deleted file mode 100644 index 4921864ced..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientlogging.h +++ /dev/null @@ -1,55 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTLOGGING_H -#define QMIRCLIENTLOGGING_H - -#include <QLoggingCategory> - -#define ASSERT(cond) ((!(cond)) ? qt_assert(#cond,__FILE__,__LINE__) : qt_noop()) - -Q_DECLARE_LOGGING_CATEGORY(mirclient) -Q_DECLARE_LOGGING_CATEGORY(mirclientBufferSwap) -Q_DECLARE_LOGGING_CATEGORY(mirclientInput) -Q_DECLARE_LOGGING_CATEGORY(mirclientGraphics) -Q_DECLARE_LOGGING_CATEGORY(mirclientCursor) -Q_DECLARE_LOGGING_CATEGORY(mirclientDebug) - -#endif // QMIRCLIENTLOGGING_H diff --git a/src/plugins/platforms/mirclient/qmirclientnativeinterface.cpp b/src/plugins/platforms/mirclient/qmirclientnativeinterface.cpp deleted file mode 100644 index b85e6fedfa..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientnativeinterface.cpp +++ /dev/null @@ -1,217 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -// Local -#include "qmirclientnativeinterface.h" -#include "qmirclientscreen.h" -#include "qmirclientglcontext.h" -#include "qmirclientwindow.h" - -// Qt -#include <QtGui/private/qguiapplication_p.h> -#include <QtGui/qopenglcontext.h> -#include <QtGui/qscreen.h> -#include <QtCore/QMap> - -class UbuntuResourceMap : public QMap<QByteArray, QMirClientNativeInterface::ResourceType> -{ -public: - UbuntuResourceMap() - : QMap<QByteArray, QMirClientNativeInterface::ResourceType>() { - insert("egldisplay", QMirClientNativeInterface::EglDisplay); - insert("eglcontext", QMirClientNativeInterface::EglContext); - insert("nativeorientation", QMirClientNativeInterface::NativeOrientation); - insert("display", QMirClientNativeInterface::Display); - insert("mirconnection", QMirClientNativeInterface::MirConnection); - insert("mirsurface", QMirClientNativeInterface::MirSurface); - insert("scale", QMirClientNativeInterface::Scale); - insert("formfactor", QMirClientNativeInterface::FormFactor); - } -}; - -Q_GLOBAL_STATIC(UbuntuResourceMap, ubuntuResourceMap) - -QMirClientNativeInterface::QMirClientNativeInterface(const QMirClientClientIntegration *integration) - : mIntegration(integration) - , mGenericEventFilterType(QByteArrayLiteral("Event")) - , mNativeOrientation(nullptr) -{ -} - -QMirClientNativeInterface::~QMirClientNativeInterface() -{ - delete mNativeOrientation; - mNativeOrientation = nullptr; -} - -void* QMirClientNativeInterface::nativeResourceForIntegration(const QByteArray &resourceString) -{ - const QByteArray lowerCaseResource = resourceString.toLower(); - - if (!ubuntuResourceMap()->contains(lowerCaseResource)) { - return nullptr; - } - - const ResourceType resourceType = ubuntuResourceMap()->value(lowerCaseResource); - - if (resourceType == QMirClientNativeInterface::MirConnection) { - return mIntegration->mirConnection(); - } else { - return nullptr; - } -} - -void* QMirClientNativeInterface::nativeResourceForContext( - const QByteArray& resourceString, QOpenGLContext* context) -{ - if (!context) - return nullptr; - - const QByteArray kLowerCaseResource = resourceString.toLower(); - - if (!ubuntuResourceMap()->contains(kLowerCaseResource)) - return nullptr; - - const ResourceType kResourceType = ubuntuResourceMap()->value(kLowerCaseResource); - - if (kResourceType == QMirClientNativeInterface::EglContext) - return static_cast<QMirClientOpenGLContext*>(context->handle())->eglContext(); - else - return nullptr; -} - -void* QMirClientNativeInterface::nativeResourceForWindow(const QByteArray& resourceString, QWindow* window) -{ - const QByteArray kLowerCaseResource = resourceString.toLower(); - if (!ubuntuResourceMap()->contains(kLowerCaseResource)) - return NULL; - const ResourceType kResourceType = ubuntuResourceMap()->value(kLowerCaseResource); - - switch (kResourceType) { - case EglDisplay: - return mIntegration->eglDisplay(); - case NativeOrientation: - // Return the device's native screen orientation. - if (window) { - QMirClientScreen *ubuntuScreen = static_cast<QMirClientScreen*>(window->screen()->handle()); - mNativeOrientation = new Qt::ScreenOrientation(ubuntuScreen->nativeOrientation()); - } else { - QPlatformScreen *platformScreen = QGuiApplication::primaryScreen()->handle(); - mNativeOrientation = new Qt::ScreenOrientation(platformScreen->nativeOrientation()); - } - return mNativeOrientation; - case MirSurface: - if (window) { - auto ubuntuWindow = static_cast<QMirClientWindow*>(window->handle()); - if (ubuntuWindow) { - return ubuntuWindow->mirSurface(); - } else { - return nullptr; - } - } else { - return nullptr; - } - default: - return nullptr; - } -} - -void* QMirClientNativeInterface::nativeResourceForScreen(const QByteArray& resourceString, QScreen* screen) -{ - const QByteArray kLowerCaseResource = resourceString.toLower(); - if (!ubuntuResourceMap()->contains(kLowerCaseResource)) - return NULL; - const ResourceType kResourceType = ubuntuResourceMap()->value(kLowerCaseResource); - if (!screen) - screen = QGuiApplication::primaryScreen(); - auto ubuntuScreen = static_cast<QMirClientScreen*>(screen->handle()); - if (kResourceType == QMirClientNativeInterface::Display) { - return mIntegration->eglNativeDisplay(); - // Changes to the following properties are emitted via the QMirClientNativeInterface::screenPropertyChanged - // signal fired by QMirClientScreen. Connect to this signal for these properties updates. - // WARNING: code highly thread unsafe! - } else if (kResourceType == QMirClientNativeInterface::Scale) { - // In application code, read with: - // float scale = *reinterpret_cast<float*>(nativeResourceForScreen("scale", screen())); - return &ubuntuScreen->mScale; - } else if (kResourceType == QMirClientNativeInterface::FormFactor) { - return &ubuntuScreen->mFormFactor; - } else - return NULL; -} - -// Changes to these properties are emitted via the QMirClientNativeInterface::windowPropertyChanged -// signal fired by QMirClientWindow. Connect to this signal for these properties updates. -QVariantMap QMirClientNativeInterface::windowProperties(QPlatformWindow *window) const -{ - QVariantMap propertyMap; - auto w = static_cast<QMirClientWindow*>(window); - if (w) { - propertyMap.insert("scale", w->scale()); - propertyMap.insert("formFactor", w->formFactor()); - } - return propertyMap; -} - -QVariant QMirClientNativeInterface::windowProperty(QPlatformWindow *window, const QString &name) const -{ - auto w = static_cast<QMirClientWindow*>(window); - if (!w) { - return QVariant(); - } - - if (name == QStringLiteral("scale")) { - return w->scale(); - } else if (name == QStringLiteral("formFactor")) { - return w->formFactor(); - } else { - return QVariant(); - } -} - -QVariant QMirClientNativeInterface::windowProperty(QPlatformWindow *window, const QString &name, const QVariant &defaultValue) const -{ - QVariant returnVal = windowProperty(window, name); - if (!returnVal.isValid()) { - return defaultValue; - } else { - return returnVal; - } -} diff --git a/src/plugins/platforms/mirclient/qmirclientnativeinterface.h b/src/plugins/platforms/mirclient/qmirclientnativeinterface.h deleted file mode 100644 index eb601de301..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientnativeinterface.h +++ /dev/null @@ -1,83 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTNATIVEINTERFACE_H -#define QMIRCLIENTNATIVEINTERFACE_H - -#include <qpa/qplatformnativeinterface.h> - -#include "qmirclientintegration.h" - -class QPlatformScreen; - -class QMirClientNativeInterface : public QPlatformNativeInterface { - Q_OBJECT -public: - enum ResourceType { EglDisplay, EglContext, NativeOrientation, Display, MirConnection, MirSurface, Scale, FormFactor }; - - QMirClientNativeInterface(const QMirClientClientIntegration *integration); - ~QMirClientNativeInterface(); - - // QPlatformNativeInterface methods. - void* nativeResourceForIntegration(const QByteArray &resource) override; - void* nativeResourceForContext(const QByteArray& resourceString, - QOpenGLContext* context) override; - void* nativeResourceForWindow(const QByteArray& resourceString, - QWindow* window) override; - void* nativeResourceForScreen(const QByteArray& resourceString, - QScreen* screen) override; - - QVariantMap windowProperties(QPlatformWindow *window) const override; - QVariant windowProperty(QPlatformWindow *window, const QString &name) const override; - QVariant windowProperty(QPlatformWindow *window, const QString &name, const QVariant &defaultValue) const override; - - // New methods. - const QByteArray& genericEventFilterType() const { return mGenericEventFilterType; } - -Q_SIGNALS: // New signals - void screenPropertyChanged(QPlatformScreen *screen, const QString &propertyName); - -private: - const QMirClientClientIntegration *mIntegration; - const QByteArray mGenericEventFilterType; - Qt::ScreenOrientation* mNativeOrientation; -}; - -#endif // QMIRCLIENTNATIVEINTERFACE_H diff --git a/src/plugins/platforms/mirclient/qmirclientorientationchangeevent_p.h b/src/plugins/platforms/mirclient/qmirclientorientationchangeevent_p.h deleted file mode 100644 index 5abd3262dc..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientorientationchangeevent_p.h +++ /dev/null @@ -1,61 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTORIENTATIONCHANGEEVENT_P_H -#define QMIRCLIENTORIENTATIONCHANGEEVENT_P_H - -#include <QEvent> -#include "qmirclientlogging.h" - -class OrientationChangeEvent : public QEvent { -public: - enum Orientation { TopUp, LeftUp, TopDown, RightUp }; - - OrientationChangeEvent(QEvent::Type type, Orientation orientation) - : QEvent(type) - , mOrientation(orientation) - { - } - - static const QEvent::Type mType; - Orientation mOrientation; -}; - -#endif // QMIRCLIENTORIENTATIONCHANGEEVENT_P_H diff --git a/src/plugins/platforms/mirclient/qmirclientplatformservices.cpp b/src/plugins/platforms/mirclient/qmirclientplatformservices.cpp deleted file mode 100644 index 1ccd57fc28..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientplatformservices.cpp +++ /dev/null @@ -1,75 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#include "qmirclientplatformservices.h" - -#include <QUrl> - -#include <ubuntu/application/url_dispatcher/service.h> -#include <ubuntu/application/url_dispatcher/session.h> - -bool QMirClientPlatformServices::openUrl(const QUrl &url) -{ - return callDispatcher(url); -} - -bool QMirClientPlatformServices::openDocument(const QUrl &url) -{ - return callDispatcher(url); -} - -bool QMirClientPlatformServices::callDispatcher(const QUrl &url) -{ - UAUrlDispatcherSession* session = ua_url_dispatcher_session(); - if (!session) - return false; - - ua_url_dispatcher_session_open(session, url.toEncoded().constData(), NULL, NULL); - - free(session); - - // We are returning true here because the other option - // is spawning a nested event loop and wait for the - // callback. But there is no guarantee on how fast - // the callback is going to be so we prefer to avoid the - // nested event loop. Long term plan is improve Qt API - // to support an async openUrl - return true; -} diff --git a/src/plugins/platforms/mirclient/qmirclientplatformservices.h b/src/plugins/platforms/mirclient/qmirclientplatformservices.h deleted file mode 100644 index a1cd5758ca..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientplatformservices.h +++ /dev/null @@ -1,57 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTPLATFORMSERVICES_H -#define QMIRCLIENTPLATFORMSERVICES_H - -#include <qpa/qplatformservices.h> -#include <QtFontDatabaseSupport/private/qgenericunixfontdatabase_p.h> -#include <QtEventDispatcherSupport/private/qgenericunixeventdispatcher_p.h> - -class QMirClientPlatformServices : public QPlatformServices { -public: - bool openUrl(const QUrl &url) override; - bool openDocument(const QUrl &url) override; - -private: - bool callDispatcher(const QUrl &url); -}; - -#endif // QMIRCLIENTPLATFORMSERVICES_H diff --git a/src/plugins/platforms/mirclient/qmirclientplugin.cpp b/src/plugins/platforms/mirclient/qmirclientplugin.cpp deleted file mode 100644 index fc44edfe40..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientplugin.cpp +++ /dev/null @@ -1,56 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#include "qmirclientplugin.h" -#include "qmirclientintegration.h" -#include "qmirclientlogging.h" - -Q_LOGGING_CATEGORY(mirclient, "qt.qpa.mirclient", QtWarningMsg) - -QPlatformIntegration *QMirClientIntegrationPlugin::create(const QString &system, - const QStringList &/*paramList*/, - int &argc, char **argv) -{ - if (system.toLower() == QLatin1String("mirclient")) { - return new QMirClientClientIntegration(argc, argv); - } else { - return 0; - } -} diff --git a/src/plugins/platforms/mirclient/qmirclientplugin.h b/src/plugins/platforms/mirclient/qmirclientplugin.h deleted file mode 100644 index 207d97b5af..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientplugin.h +++ /dev/null @@ -1,56 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTPLUGIN_H -#define QMIRCLIENTPLUGIN_H - -#include <qpa/qplatformintegrationplugin.h> - -class QMirClientIntegrationPlugin : public QPlatformIntegrationPlugin -{ - Q_OBJECT - Q_PLUGIN_METADATA(IID QPlatformIntegrationFactoryInterface_iid FILE "mirclient.json") - -public: - QPlatformIntegration *create(const QString &system, const QStringList ¶mList, - int &argc, char **argv) override; -}; - -#endif // QMIRCLIENTPLUGIN_H diff --git a/src/plugins/platforms/mirclient/qmirclientscreen.cpp b/src/plugins/platforms/mirclient/qmirclientscreen.cpp deleted file mode 100644 index cc8db830aa..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientscreen.cpp +++ /dev/null @@ -1,262 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2014-2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -// local -#include "qmirclientscreen.h" -#include "qmirclientlogging.h" -#include "qmirclientorientationchangeevent_p.h" -#include "qmirclientnativeinterface.h" - -#include <mir_toolkit/mir_client_library.h> - -// Qt -#include <QGuiApplication> -#include <QtCore/qmath.h> -#include <QScreen> -#include <QThread> -#include <qpa/qwindowsysteminterface.h> -#include <QtEglSupport/private/qeglconvenience_p.h> - -#include <memory> - -static const int overrideDevicePixelRatio = qgetenv("QT_DEVICE_PIXEL_RATIO").toInt(); - -static const char *orientationToStr(Qt::ScreenOrientation orientation) { - switch (orientation) { - case Qt::PrimaryOrientation: - return "primary"; - case Qt::PortraitOrientation: - return "portrait"; - case Qt::LandscapeOrientation: - return "landscape"; - case Qt::InvertedPortraitOrientation: - return "inverted portrait"; - case Qt::InvertedLandscapeOrientation: - return "inverted landscape"; - } - Q_UNREACHABLE(); -} - -const QEvent::Type OrientationChangeEvent::mType = - static_cast<QEvent::Type>(QEvent::registerEventType()); - - -QMirClientScreen::QMirClientScreen(const MirOutput *output, MirConnection *connection) - : mDevicePixelRatio(1.0) - , mFormat(QImage::Format_RGB32) - , mDepth(32) - , mDpi{0} - , mFormFactor{mir_form_factor_unknown} - , mScale{1.0} - , mOutputId(0) - , mCursor(connection) -{ - setMirOutput(output); -} - -QMirClientScreen::~QMirClientScreen() -{ -} - -void QMirClientScreen::customEvent(QEvent* event) { - Q_ASSERT(QThread::currentThread() == thread()); - - OrientationChangeEvent* oReadingEvent = static_cast<OrientationChangeEvent*>(event); - switch (oReadingEvent->mOrientation) { - case OrientationChangeEvent::LeftUp: { - mCurrentOrientation = (screen()->primaryOrientation() == Qt::LandscapeOrientation) ? - Qt::InvertedPortraitOrientation : Qt::LandscapeOrientation; - break; - } - case OrientationChangeEvent::TopUp: { - mCurrentOrientation = (screen()->primaryOrientation() == Qt::LandscapeOrientation) ? - Qt::LandscapeOrientation : Qt::PortraitOrientation; - break; - } - case OrientationChangeEvent::RightUp: { - mCurrentOrientation = (screen()->primaryOrientation() == Qt::LandscapeOrientation) ? - Qt::PortraitOrientation : Qt::InvertedLandscapeOrientation; - break; - } - case OrientationChangeEvent::TopDown: { - mCurrentOrientation = (screen()->primaryOrientation() == Qt::LandscapeOrientation) ? - Qt::InvertedLandscapeOrientation : Qt::InvertedPortraitOrientation; - break; - } - } - - // Raise the event signal so that client apps know the orientation changed - qCDebug(mirclient, "QMirClientScreen::customEvent - handling orientation change to %s", orientationToStr(mCurrentOrientation)); - QWindowSystemInterface::handleScreenOrientationChange(screen(), mCurrentOrientation); -} - -void QMirClientScreen::handleWindowSurfaceResize(int windowWidth, int windowHeight) -{ - if ((windowWidth > windowHeight && mGeometry.width() < mGeometry.height()) - || (windowWidth < windowHeight && mGeometry.width() > mGeometry.height())) { - - // The window aspect ratio differ's from the screen one. This means that - // unity8 has rotated the window in its scene. - // As there's no way to express window rotation in Qt's API, we have - // Flip QScreen's dimensions so that orientation properties match - // (primaryOrientation particularly). - // FIXME: This assumes a phone scenario. Won't work, or make sense, - // on the desktop - - QRect currGeometry = mGeometry; - mGeometry.setWidth(currGeometry.height()); - mGeometry.setHeight(currGeometry.width()); - - qCDebug(mirclient, "QMirClientScreen::handleWindowSurfaceResize - new screen geometry (w=%d, h=%d)", - mGeometry.width(), mGeometry.height()); - QWindowSystemInterface::handleScreenGeometryChange(screen(), - mGeometry /* newGeometry */, - mGeometry /* newAvailableGeometry */); - - if (mGeometry.width() < mGeometry.height()) { - mCurrentOrientation = Qt::PortraitOrientation; - } else { - mCurrentOrientation = Qt::LandscapeOrientation; - } - qCDebug(mirclient, "QMirClientScreen::handleWindowSurfaceResize - new orientation %s",orientationToStr(mCurrentOrientation)); - QWindowSystemInterface::handleScreenOrientationChange(screen(), mCurrentOrientation); - } -} - -void QMirClientScreen::setMirOutput(const MirOutput *output) -{ - // Physical screen size (in mm) - mPhysicalSize.setWidth(mir_output_get_physical_width_mm(output)); - mPhysicalSize.setHeight(mir_output_get_physical_height_mm(output)); - - // Pixel Format -// mFormat = qImageFormatFromMirPixelFormat(mir_output_get_current_pixel_format(output)); // GERRY: TODO - - // Pixel depth - mDepth = 8 * MIR_BYTES_PER_PIXEL(mir_output_get_current_pixel_format(output)); - - // Mode = Resolution & refresh rate - const MirOutputMode *mode = mir_output_get_current_mode(output); - mNativeGeometry.setX(mir_output_get_position_x(output)); - mNativeGeometry.setY(mir_output_get_position_y(output)); - mNativeGeometry.setWidth(mir_output_mode_get_width(mode)); - mNativeGeometry.setHeight(mir_output_mode_get_height(mode)); - - mRefreshRate = mir_output_mode_get_refresh_rate(mode); - - // UI scale & DPR - mScale = mir_output_get_scale_factor(output); - if (overrideDevicePixelRatio > 0) { - mDevicePixelRatio = overrideDevicePixelRatio; - } else { - mDevicePixelRatio = 1.0; // FIXME - need to determine suitable DPR for the specified scale - } - - mFormFactor = mir_output_get_form_factor(output); - - mOutputId = mir_output_get_id(output); - - mGeometry.setX(mNativeGeometry.x()); - mGeometry.setY(mNativeGeometry.y()); - mGeometry.setWidth(mNativeGeometry.width()); - mGeometry.setHeight(mNativeGeometry.height()); - - // Set the default orientation based on the initial screen dimensions. - mNativeOrientation = (mGeometry.width() >= mGeometry.height()) ? Qt::LandscapeOrientation : Qt::PortraitOrientation; - - // If it's a landscape device (i.e. some tablets), start in landscape, otherwise portrait - mCurrentOrientation = (mNativeOrientation == Qt::LandscapeOrientation) ? Qt::LandscapeOrientation : Qt::PortraitOrientation; -} - -void QMirClientScreen::updateMirOutput(const MirOutput *output) -{ - auto oldRefreshRate = mRefreshRate; - auto oldScale = mScale; - auto oldFormFactor = mFormFactor; - auto oldGeometry = mGeometry; - - setMirOutput(output); - - // Emit change signals in particular order - if (oldGeometry != mGeometry) { - QWindowSystemInterface::handleScreenGeometryChange(screen(), - mGeometry /* newGeometry */, - mGeometry /* newAvailableGeometry */); - } - - if (!qFuzzyCompare(mRefreshRate, oldRefreshRate)) { - QWindowSystemInterface::handleScreenRefreshRateChange(screen(), mRefreshRate); - } - - auto nativeInterface = static_cast<QMirClientNativeInterface *>(qGuiApp->platformNativeInterface()); - if (!qFuzzyCompare(mScale, oldScale)) { - nativeInterface->screenPropertyChanged(this, QStringLiteral("scale")); - } - if (mFormFactor != oldFormFactor) { - nativeInterface->screenPropertyChanged(this, QStringLiteral("formFactor")); - } -} - -void QMirClientScreen::setAdditionalMirDisplayProperties(float scale, MirFormFactor formFactor, int dpi) -{ - if (mDpi != dpi) { - mDpi = dpi; - QWindowSystemInterface::handleScreenLogicalDotsPerInchChange(screen(), dpi, dpi); - } - - auto nativeInterface = static_cast<QMirClientNativeInterface *>(qGuiApp->platformNativeInterface()); - if (!qFuzzyCompare(mScale, scale)) { - mScale = scale; - nativeInterface->screenPropertyChanged(this, QStringLiteral("scale")); - } - if (mFormFactor != formFactor) { - mFormFactor = formFactor; - nativeInterface->screenPropertyChanged(this, QStringLiteral("formFactor")); - } -} - -QDpi QMirClientScreen::logicalDpi() const -{ - if (mDpi > 0) { - return QDpi(mDpi, mDpi); - } else { - return QPlatformScreen::logicalDpi(); - } -} diff --git a/src/plugins/platforms/mirclient/qmirclientscreen.h b/src/plugins/platforms/mirclient/qmirclientscreen.h deleted file mode 100644 index b31cba1964..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientscreen.h +++ /dev/null @@ -1,106 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2014-2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTSCREEN_H -#define QMIRCLIENTSCREEN_H - -#include <qpa/qplatformscreen.h> -#include <QSurfaceFormat> - -#include <mir_toolkit/common.h> // just for MirFormFactor enum - -#include "qmirclientcursor.h" - -struct MirConnection; -struct MirOutput; - -class QMirClientScreen : public QObject, public QPlatformScreen -{ - Q_OBJECT -public: - QMirClientScreen(const MirOutput *output, MirConnection *connection); - virtual ~QMirClientScreen(); - - // QPlatformScreen methods. - QImage::Format format() const override { return mFormat; } - int depth() const override { return mDepth; } - QRect geometry() const override { return mGeometry; } - QRect availableGeometry() const override { return mGeometry; } - QSizeF physicalSize() const override { return mPhysicalSize; } - qreal devicePixelRatio() const override { return mDevicePixelRatio; } - QDpi logicalDpi() const override; - Qt::ScreenOrientation nativeOrientation() const override { return mNativeOrientation; } - Qt::ScreenOrientation orientation() const override { return mNativeOrientation; } - QPlatformCursor *cursor() const override { return const_cast<QMirClientCursor*>(&mCursor); } - - // Additional Screen properties from Mir - int mirOutputId() const { return mOutputId; } - MirFormFactor formFactor() const { return mFormFactor; } - float scale() const { return mScale; } - - // Internally used methods - void updateMirOutput(const MirOutput *output); - void setAdditionalMirDisplayProperties(float scale, MirFormFactor formFactor, int dpi); - void handleWindowSurfaceResize(int width, int height); - - // QObject methods. - void customEvent(QEvent* event) override; - -private: - void setMirOutput(const MirOutput *output); - - QRect mGeometry, mNativeGeometry; - QSizeF mPhysicalSize; - qreal mDevicePixelRatio; - Qt::ScreenOrientation mNativeOrientation; - Qt::ScreenOrientation mCurrentOrientation; - QImage::Format mFormat; - int mDepth; - int mDpi; - qreal mRefreshRate; - MirFormFactor mFormFactor; - float mScale; - int mOutputId; - QMirClientCursor mCursor; - - friend class QMirClientNativeInterface; -}; - -#endif // QMIRCLIENTSCREEN_H diff --git a/src/plugins/platforms/mirclient/qmirclientscreenobserver.cpp b/src/plugins/platforms/mirclient/qmirclientscreenobserver.cpp deleted file mode 100644 index 792aeca351..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientscreenobserver.cpp +++ /dev/null @@ -1,161 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#include "qmirclientscreenobserver.h" -#include "qmirclientscreen.h" -#include "qmirclientwindow.h" -#include "qmirclientlogging.h" - -// Qt -#include <QMetaObject> -#include <QPointer> - -// Mir -#include <mirclient/mir_toolkit/mir_connection.h> -#include <mirclient/mir_toolkit/mir_display_configuration.h> - -#include <memory> - -namespace { - static void displayConfigurationChangedCallback(MirConnection */*connection*/, void* context) - { - ASSERT(context != NULL); - QMirClientScreenObserver *observer = static_cast<QMirClientScreenObserver *>(context); - QMetaObject::invokeMethod(observer, "update"); - } - - const char *mirFormFactorToStr(MirFormFactor formFactor) - { - switch (formFactor) { - case mir_form_factor_unknown: return "unknown"; - case mir_form_factor_phone: return "phone"; - case mir_form_factor_tablet: return "tablet"; - case mir_form_factor_monitor: return "monitor"; - case mir_form_factor_tv: return "tv"; - case mir_form_factor_projector: return "projector"; - } - Q_UNREACHABLE(); - } -} // anonymous namespace - -QMirClientScreenObserver::QMirClientScreenObserver(MirConnection *mirConnection) - : mMirConnection(mirConnection) -{ - mir_connection_set_display_config_change_callback(mirConnection, ::displayConfigurationChangedCallback, this); - update(); -} - -void QMirClientScreenObserver::update() -{ - // Wrap MirDisplayConfiguration to always delete when out of scope - auto configDeleter = [](MirDisplayConfig *config) { mir_display_config_release(config); }; - using configUp = std::unique_ptr<MirDisplayConfig, decltype(configDeleter)>; - configUp displayConfig(mir_connection_create_display_configuration(mMirConnection), configDeleter); - - // Mir only tells us something changed, it is up to us to figure out what. - QList<QMirClientScreen*> newScreenList; - QList<QMirClientScreen*> oldScreenList = mScreenList; - mScreenList.clear(); - - for (int i = 0; i < mir_display_config_get_num_outputs(displayConfig.get()); i++) { - const MirOutput *output = mir_display_config_get_output(displayConfig.get(), i); - if (mir_output_is_enabled(output)) { - QMirClientScreen *screen = findScreenWithId(oldScreenList, mir_output_get_id(output)); - if (screen) { // we've already set up this display before - screen->updateMirOutput(output); - oldScreenList.removeAll(screen); - } else { - // new display, so create QMirClientScreen for it - screen = new QMirClientScreen(output, mMirConnection); - newScreenList.append(screen); - qCDebug(mirclient) << "Added Screen with id" << mir_output_get_id(output) - << "and geometry" << screen->geometry(); - } - mScreenList.append(screen); - } - } - - // Announce old & unused Screens, should be deleted by the slot - Q_FOREACH (const auto screen, oldScreenList) { - Q_EMIT screenRemoved(screen); - } - - /* - * Mir's MirDisplayOutput does not include formFactor or scale for some reason, but Qt - * will want that information on creating the QScreen. Only way we get that info is when - * Mir positions a Window on that Screen. See "handleScreenPropertiesChange" method - */ - - // Announce new Screens - Q_FOREACH (const auto screen, newScreenList) { - Q_EMIT screenAdded(screen); - } - - qCDebug(mirclient) << "======================================="; - for (auto screen: mScreenList) { - qCDebug(mirclient) << screen << "- id:" << screen->mirOutputId() - << "geometry:" << screen->geometry() - << "form factor:" << mirFormFactorToStr(screen->formFactor()) - << "scale:" << screen->scale(); - } - qCDebug(mirclient) << "======================================="; -} - -QMirClientScreen *QMirClientScreenObserver::findScreenWithId(int id) -{ - return findScreenWithId(mScreenList, id); -} - -QMirClientScreen *QMirClientScreenObserver::findScreenWithId(const QList<QMirClientScreen *> &list, int id) -{ - Q_FOREACH (const auto screen, list) { - if (screen->mirOutputId() == id) { - return screen; - } - } - return nullptr; -} - -void QMirClientScreenObserver::handleScreenPropertiesChange(QMirClientScreen *screen, int dpi, - MirFormFactor formFactor, float scale) -{ - screen->setAdditionalMirDisplayProperties(scale, formFactor, dpi); -} - diff --git a/src/plugins/platforms/mirclient/qmirclienttheme.cpp b/src/plugins/platforms/mirclient/qmirclienttheme.cpp deleted file mode 100644 index dcfef7ca67..0000000000 --- a/src/plugins/platforms/mirclient/qmirclienttheme.cpp +++ /dev/null @@ -1,67 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#include "qmirclienttheme.h" - -#include <QtCore/QVariant> - -const char *QMirClientTheme::name = "ubuntu"; - -QMirClientTheme::QMirClientTheme() -{ -} - -QMirClientTheme::~QMirClientTheme() -{ -} - -QVariant QMirClientTheme::themeHint(ThemeHint hint) const -{ - if (hint == QPlatformTheme::SystemIconThemeName) { - QByteArray iconTheme = qgetenv("QTUBUNTU_ICON_THEME"); - if (iconTheme.isEmpty()) { - return QVariant(QStringLiteral("ubuntu-mobile")); - } else { - return QVariant(QString(iconTheme)); - } - } else { - return QGenericUnixTheme::themeHint(hint); - } -} diff --git a/src/plugins/platforms/mirclient/qmirclienttheme.h b/src/plugins/platforms/mirclient/qmirclienttheme.h deleted file mode 100644 index 4bab1d0ee0..0000000000 --- a/src/plugins/platforms/mirclient/qmirclienttheme.h +++ /dev/null @@ -1,57 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTTHEME_H -#define QMIRCLIENTTHEME_H - -#include <QtThemeSupport/private/qgenericunixthemes_p.h> - -class QMirClientTheme : public QGenericUnixTheme -{ -public: - static const char* name; - QMirClientTheme(); - virtual ~QMirClientTheme(); - - // From QPlatformTheme - QVariant themeHint(ThemeHint hint) const override; -}; - -#endif // QMIRCLIENTTHEME_H diff --git a/src/plugins/platforms/mirclient/qmirclientwindow.cpp b/src/plugins/platforms/mirclient/qmirclientwindow.cpp deleted file mode 100644 index decd21516e..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientwindow.cpp +++ /dev/null @@ -1,968 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2014-2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -// Local -#include "qmirclientwindow.h" -#include "qmirclientdebugextension.h" -#include "qmirclientnativeinterface.h" -#include "qmirclientinput.h" -#include "qmirclientintegration.h" -#include "qmirclientscreen.h" -#include "qmirclientlogging.h" - -#include <mir_toolkit/mir_client_library.h> -#include <mir_toolkit/version.h> - -// Qt -#include <qpa/qwindowsysteminterface.h> -#include <QMutexLocker> -#include <QSize> -#include <QtMath> -#include <QtEglSupport/private/qeglconvenience_p.h> - -// Platform API -#include <ubuntu/application/instance.h> - -#include <EGL/egl.h> - -Q_LOGGING_CATEGORY(mirclientBufferSwap, "qt.qpa.mirclient.bufferSwap", QtWarningMsg) - -namespace -{ -const Qt::WindowType LowChromeWindowHint = (Qt::WindowType)0x00800000; - -// FIXME: this used to be defined by platform-api, but it's been removed in v3. Change ubuntu-keyboard to use -// a different enum for window roles. -enum UAUiWindowRole { - U_MAIN_ROLE = 1, - U_DASH_ROLE, - U_INDICATOR_ROLE, - U_NOTIFICATIONS_ROLE, - U_GREETER_ROLE, - U_LAUNCHER_ROLE, - U_ON_SCREEN_KEYBOARD_ROLE, - U_SHUTDOWN_DIALOG_ROLE, -}; - -struct MirSpecDeleter -{ - void operator()(MirSurfaceSpec *spec) { mir_surface_spec_release(spec); } -}; - -using Spec = std::unique_ptr<MirSurfaceSpec, MirSpecDeleter>; - -EGLNativeWindowType nativeWindowFor(MirSurface *surf) -{ - auto stream = mir_surface_get_buffer_stream(surf); - return reinterpret_cast<EGLNativeWindowType>(mir_buffer_stream_get_egl_native_window(stream)); -} - -const char *qtWindowStateToStr(Qt::WindowState state) -{ - switch (state) { - case Qt::WindowNoState: - return "NoState"; - case Qt::WindowFullScreen: - return "FullScreen"; - case Qt::WindowMaximized: - return "Maximized"; - case Qt::WindowMinimized: - return "Minimized"; - case Qt::WindowActive: - return "Active"; - } - Q_UNREACHABLE(); -} - -const char *mirSurfaceStateToStr(MirSurfaceState surfaceState) -{ - switch (surfaceState) { - case mir_surface_state_unknown: return "unknown"; - case mir_surface_state_restored: return "restored"; - case mir_surface_state_minimized: return "minimized"; - case mir_surface_state_maximized: return "vertmaximized"; - case mir_surface_state_vertmaximized: return "vertmaximized"; - case mir_surface_state_fullscreen: return "fullscreen"; - case mir_surface_state_horizmaximized: return "horizmaximized"; - case mir_surface_state_hidden: return "hidden"; - case mir_surface_states: Q_UNREACHABLE(); - } - Q_UNREACHABLE(); -} - -const char *mirPixelFormatToStr(MirPixelFormat pixelFormat) -{ - switch (pixelFormat) { - case mir_pixel_format_invalid: return "invalid"; - case mir_pixel_format_abgr_8888: return "ABGR8888"; - case mir_pixel_format_xbgr_8888: return "XBGR8888"; - case mir_pixel_format_argb_8888: return "ARGB8888"; - case mir_pixel_format_xrgb_8888: return "XRGB8888"; - case mir_pixel_format_bgr_888: return "BGR888"; - case mir_pixel_format_rgb_888: return "RGB888"; - case mir_pixel_format_rgb_565: return "RGB565"; - case mir_pixel_format_rgba_5551: return "RGBA5551"; - case mir_pixel_format_rgba_4444: return "RGBA4444"; - case mir_pixel_formats: Q_UNREACHABLE(); - } - Q_UNREACHABLE(); -} - -const char *mirSurfaceTypeToStr(MirSurfaceType type) -{ - switch (type) { - case mir_surface_type_normal: return "Normal"; /**< AKA "regular" */ - case mir_surface_type_utility: return "Utility"; /**< AKA "floating regular" */ - case mir_surface_type_dialog: return "Dialog"; - case mir_surface_type_gloss: return "Gloss"; - case mir_surface_type_freestyle: return "Freestyle"; - case mir_surface_type_menu: return "Menu"; - case mir_surface_type_inputmethod: return "Input Method"; /**< AKA "OSK" or handwriting etc. */ - case mir_surface_type_satellite: return "Satellite"; /**< AKA "toolbox"/"toolbar" */ - case mir_surface_type_tip: return "Tip"; /**< AKA "tooltip" */ - case mir_surface_types: Q_UNREACHABLE(); - } - return ""; -} - -MirSurfaceState qtWindowStateToMirSurfaceState(Qt::WindowState state) -{ - switch (state) { - case Qt::WindowNoState: - case Qt::WindowActive: - return mir_surface_state_restored; - case Qt::WindowFullScreen: - return mir_surface_state_fullscreen; - case Qt::WindowMaximized: - return mir_surface_state_maximized; - case Qt::WindowMinimized: - return mir_surface_state_minimized; - } - return mir_surface_state_unknown; // should never be reached -} - -MirSurfaceType qtWindowTypeToMirSurfaceType(Qt::WindowType type) -{ - switch (type & Qt::WindowType_Mask) { - case Qt::Dialog: - return mir_surface_type_dialog; - case Qt::Sheet: - case Qt::Drawer: - return mir_surface_type_utility; - case Qt::Popup: - case Qt::Tool: - return mir_surface_type_menu; - case Qt::ToolTip: - return mir_surface_type_tip; - case Qt::SplashScreen: - return mir_surface_type_freestyle; - case Qt::Window: - default: - return mir_surface_type_normal; - } -} - -WId makeId() -{ - static int id = 1; - return id++; -} - -UAUiWindowRole roleFor(QWindow *window) -{ - QVariant roleVariant = window->property("role"); - if (!roleVariant.isValid()) - return U_MAIN_ROLE; - - uint role = roleVariant.toUInt(); - if (role < U_MAIN_ROLE || role > U_SHUTDOWN_DIALOG_ROLE) - return U_MAIN_ROLE; - - return static_cast<UAUiWindowRole>(role); -} - -QMirClientWindow *transientParentFor(QWindow *window) -{ - QWindow *parent = window->transientParent(); - return parent ? static_cast<QMirClientWindow *>(parent->handle()) : nullptr; -} - -bool requiresParent(const MirSurfaceType type) -{ - switch (type) { - case mir_surface_type_dialog: //FIXME - not quite what the specification dictates, but is what Mir's api dictates - case mir_surface_type_utility: - case mir_surface_type_gloss: - case mir_surface_type_menu: - case mir_surface_type_satellite: - case mir_surface_type_tip: - return true; - default: - return false; - } -} - -bool requiresParent(const Qt::WindowType type) -{ - return requiresParent(qtWindowTypeToMirSurfaceType(type)); -} - -bool isMovable(const Qt::WindowType type) -{ - auto mirType = qtWindowTypeToMirSurfaceType(type); - switch (mirType) { - case mir_surface_type_menu: - case mir_surface_type_tip: - return true; - default: - return false; - } -} - -Spec makeSurfaceSpec(QWindow *window, MirPixelFormat pixelFormat, QMirClientWindow *parentWindowHandle, - MirConnection *connection) -{ - const auto geometry = window->geometry(); - const int width = geometry.width() > 0 ? geometry.width() : 1; - const int height = geometry.height() > 0 ? geometry.height() : 1; - auto type = qtWindowTypeToMirSurfaceType(window->type()); - - if (U_ON_SCREEN_KEYBOARD_ROLE == roleFor(window)) { - type = mir_surface_type_inputmethod; - } - - MirRectangle location{geometry.x(), geometry.y(), 0, 0}; - MirSurface *parent = nullptr; - if (parentWindowHandle) { - parent = parentWindowHandle->mirSurface(); - // Qt uses absolute positioning, but Mir positions surfaces relative to parent. - location.top -= parentWindowHandle->geometry().top(); - location.left -= parentWindowHandle->geometry().left(); - } - - Spec spec; - - switch (type) { - case mir_surface_type_menu: - spec = Spec{mir_connection_create_spec_for_menu(connection, width, height, pixelFormat, parent, - &location, mir_edge_attachment_any)}; - break; - case mir_surface_type_dialog: - spec = Spec{mir_connection_create_spec_for_modal_dialog(connection, width, height, pixelFormat, parent)}; - break; - case mir_surface_type_utility: - spec = Spec{mir_connection_create_spec_for_dialog(connection, width, height, pixelFormat)}; - break; - case mir_surface_type_tip: -#if MIR_CLIENT_VERSION < MIR_VERSION_NUMBER(3, 4, 0) - spec = Spec{mir_connection_create_spec_for_tooltip(connection, width, height, pixelFormat, parent, - &location)}; -#else - spec = Spec{mir_connection_create_spec_for_tip(connection, width, height, pixelFormat, parent, - &location, mir_edge_attachment_any)}; -#endif - break; - case mir_surface_type_inputmethod: - spec = Spec{mir_connection_create_spec_for_input_method(connection, width, height, pixelFormat)}; - break; - default: - spec = Spec{mir_connection_create_spec_for_normal_surface(connection, width, height, pixelFormat)}; - break; - } - - qCDebug(mirclient, "makeSurfaceSpec(window=%p): %s spec (type=0x%x, position=(%d, %d)px, size=(%dx%d)px)", - window, mirSurfaceTypeToStr(type), window->type(), location.left, location.top, width, height); - - return std::move(spec); -} - -void setSizingConstraints(MirSurfaceSpec *spec, const QSize& minSize, const QSize& maxSize, const QSize& increment) -{ - mir_surface_spec_set_min_width(spec, minSize.width()); - mir_surface_spec_set_min_height(spec, minSize.height()); - if (maxSize.width() >= minSize.width()) { - mir_surface_spec_set_max_width(spec, maxSize.width()); - } - if (maxSize.height() >= minSize.height()) { - mir_surface_spec_set_max_height(spec, maxSize.height()); - } - if (increment.width() > 0) { - mir_surface_spec_set_width_increment(spec, increment.width()); - } - if (increment.height() > 0) { - mir_surface_spec_set_height_increment(spec, increment.height()); - } -} - -MirSurface *createMirSurface(QWindow *window, int mirOutputId, QMirClientWindow *parentWindowHandle, - MirPixelFormat pixelFormat, MirConnection *connection, - mir_surface_event_callback inputCallback, void *inputContext) -{ - auto spec = makeSurfaceSpec(window, pixelFormat, parentWindowHandle, connection); - - // Install event handler as early as possible - mir_surface_spec_set_event_handler(spec.get(), inputCallback, inputContext); - - const auto title = window->title().toUtf8(); - mir_surface_spec_set_name(spec.get(), title.constData()); - - setSizingConstraints(spec.get(), window->minimumSize(), window->maximumSize(), window->sizeIncrement()); - - if (window->windowState() == Qt::WindowFullScreen) { - mir_surface_spec_set_fullscreen_on_output(spec.get(), mirOutputId); - } - - if (window->flags() & LowChromeWindowHint) { - mir_surface_spec_set_shell_chrome(spec.get(), mir_shell_chrome_low); - } - - if (!window->isVisible()) { - mir_surface_spec_set_state(spec.get(), mir_surface_state_hidden); - } - - auto surface = mir_surface_create_sync(spec.get()); - Q_ASSERT(mir_surface_is_valid(surface)); - return surface; -} - -QMirClientWindow *getParentIfNecessary(QWindow *window, QMirClientInput *input) -{ - QMirClientWindow *parentWindowHandle = nullptr; - if (requiresParent(window->type())) { - parentWindowHandle = transientParentFor(window); - if (parentWindowHandle == nullptr) { - // NOTE: Mir requires this surface have a parent. Try using the last surface to receive input as that will - // most likely be the one that caused this surface to be created - parentWindowHandle = input->lastInputWindow(); - } - } - return parentWindowHandle; -} - -MirPixelFormat disableAlphaBufferIfPossible(MirPixelFormat pixelFormat) -{ - switch (pixelFormat) { - case mir_pixel_format_abgr_8888: - return mir_pixel_format_xbgr_8888; - case mir_pixel_format_argb_8888: - return mir_pixel_format_xrgb_8888; - default: // can do nothing, leave it alone - return pixelFormat; - } -} -} //namespace - - - -class UbuntuSurface -{ -public: - UbuntuSurface(QMirClientWindow *platformWindow, EGLDisplay display, QMirClientInput *input, MirConnection *connection); - ~UbuntuSurface(); - - UbuntuSurface(const UbuntuSurface &) = delete; - UbuntuSurface& operator=(const UbuntuSurface &) = delete; - - void updateGeometry(const QRect &newGeometry); - void updateTitle(const QString& title); - void setSizingConstraints(const QSize& minSize, const QSize& maxSize, const QSize& increment); - - void onSwapBuffersDone(); - void handleSurfaceResized(int width, int height); - int needsRepaint() const; - - MirSurfaceState state() const { return mir_surface_get_state(mMirSurface); } - void setState(MirSurfaceState state); - - MirSurfaceType type() const { return mir_surface_get_type(mMirSurface); } - - void setShellChrome(MirShellChrome shellChrome); - - EGLSurface eglSurface() const { return mEglSurface; } - MirSurface *mirSurface() const { return mMirSurface; } - - void setSurfaceParent(MirSurface*); - bool hasParent() const { return mParented; } - - QSurfaceFormat format() const { return mFormat; } - - bool mNeedsExposeCatchup; - - QString persistentSurfaceId(); - -private: - static void surfaceEventCallback(MirSurface* surface, const MirEvent *event, void* context); - void postEvent(const MirEvent *event); - - QWindow * const mWindow; - QMirClientWindow * const mPlatformWindow; - QMirClientInput * const mInput; - MirConnection * const mConnection; - QMirClientWindow * mParentWindowHandle{nullptr}; - - MirSurface* mMirSurface; - const EGLDisplay mEglDisplay; - EGLSurface mEglSurface; - - bool mNeedsRepaint; - bool mParented; - QSize mBufferSize; - QSurfaceFormat mFormat; - MirPixelFormat mPixelFormat; - - QMutex mTargetSizeMutex; - QSize mTargetSize; - MirShellChrome mShellChrome; - QString mPersistentIdStr; -}; - -UbuntuSurface::UbuntuSurface(QMirClientWindow *platformWindow, EGLDisplay display, QMirClientInput *input, MirConnection *connection) - : mWindow(platformWindow->window()) - , mPlatformWindow(platformWindow) - , mInput(input) - , mConnection(connection) - , mEglDisplay(display) - , mNeedsRepaint(false) - , mParented(mWindow->transientParent() || mWindow->parent()) - , mFormat(mWindow->requestedFormat()) - , mShellChrome(mWindow->flags() & LowChromeWindowHint ? mir_shell_chrome_low : mir_shell_chrome_normal) -{ - // Have Qt choose most suitable EGLConfig for the requested surface format, and update format to reflect it - EGLConfig config = q_configFromGLFormat(display, mFormat, true); - if (config == 0) { - // Older Intel Atom-based devices only support OpenGL 1.4 compatibility profile but by default - // QML asks for at least OpenGL 2.0. The XCB GLX backend ignores this request and returns a - // 1.4 context, but the XCB EGL backend tries to honor it, and fails. The 1.4 context appears to - // have sufficient capabilities on MESA (i915) to render correctly however. So reduce the default - // requested OpenGL version to 1.0 to ensure EGL will give us a working context (lp:1549455). - static const bool isMesa = QString(eglQueryString(display, EGL_VENDOR)).contains(QStringLiteral("Mesa")); - if (isMesa) { - qCDebug(mirclientGraphics, "Attempting to choose OpenGL 1.4 context which may suit Mesa"); - mFormat.setMajorVersion(1); - mFormat.setMinorVersion(4); - config = q_configFromGLFormat(display, mFormat, true); - } - } - if (config == 0) { - qCritical() << "Qt failed to choose a suitable EGLConfig to suit the surface format" << mFormat; - } - - mFormat = q_glFormatFromConfig(display, config, mFormat); - - // Have Mir decide the pixel format most suited to the chosen EGLConfig. This is the only way - // Mir will know what EGLConfig has been chosen - it cannot deduce it from the buffers. - mPixelFormat = mir_connection_get_egl_pixel_format(connection, display, config); - // But the chosen EGLConfig might have an alpha buffer enabled, even if not requested by the client. - // If that's the case, try to edit the chosen pixel format in order to disable the alpha buffer. - // This is an optimization for the compositor, as it can avoid blending this surface. - if (mWindow->requestedFormat().alphaBufferSize() < 0) { - mPixelFormat = disableAlphaBufferIfPossible(mPixelFormat); - } - - const auto outputId = static_cast<QMirClientScreen *>(mWindow->screen()->handle())->mirOutputId(); - - mParentWindowHandle = getParentIfNecessary(mWindow, input); - - mMirSurface = createMirSurface(mWindow, outputId, mParentWindowHandle, mPixelFormat, connection, surfaceEventCallback, this); - mEglSurface = eglCreateWindowSurface(mEglDisplay, config, nativeWindowFor(mMirSurface), nullptr); - - mNeedsExposeCatchup = mir_surface_get_visibility(mMirSurface) == mir_surface_visibility_occluded; - - // Window manager can give us a final size different from what we asked for - // so let's check what we ended up getting - MirSurfaceParameters parameters; - mir_surface_get_parameters(mMirSurface, ¶meters); - - auto geom = mWindow->geometry(); - geom.setWidth(parameters.width); - geom.setHeight(parameters.height); - - // Assume that the buffer size matches the surface size at creation time - mBufferSize = geom.size(); - QWindowSystemInterface::handleGeometryChange(mWindow, geom); - - qCDebug(mirclient) << "Created surface with geometry:" << geom << "title:" << mWindow->title() - << "role:" << roleFor(mWindow); - qCDebug(mirclientGraphics) - << "Requested format:" << mWindow->requestedFormat() - << "\nActual format:" << mFormat - << "with associated Mir pixel format:" << mirPixelFormatToStr(mPixelFormat); -} - -UbuntuSurface::~UbuntuSurface() -{ - if (mEglSurface != EGL_NO_SURFACE) - eglDestroySurface(mEglDisplay, mEglSurface); - if (mMirSurface) { - mir_surface_release_sync(mMirSurface); - } -} - -void UbuntuSurface::updateGeometry(const QRect &newGeometry) -{ - qCDebug(mirclient,"updateGeometry(window=%p, width=%d, height=%d)", mWindow, - newGeometry.width(), newGeometry.height()); - - Spec spec; - if (isMovable(mWindow->type())) { - spec = Spec{makeSurfaceSpec(mWindow, mPixelFormat, mParentWindowHandle, mConnection)}; - } else { - spec = Spec{mir_connection_create_spec_for_changes(mConnection)}; - mir_surface_spec_set_width(spec.get(), newGeometry.width()); - mir_surface_spec_set_height(spec.get(), newGeometry.height()); - } - mir_surface_apply_spec(mMirSurface, spec.get()); -} - -void UbuntuSurface::updateTitle(const QString& newTitle) -{ - const auto title = newTitle.toUtf8(); - Spec spec{mir_connection_create_spec_for_changes(mConnection)}; - mir_surface_spec_set_name(spec.get(), title.constData()); - mir_surface_apply_spec(mMirSurface, spec.get()); -} - -void UbuntuSurface::setSizingConstraints(const QSize& minSize, const QSize& maxSize, const QSize& increment) -{ - Spec spec{mir_connection_create_spec_for_changes(mConnection)}; - ::setSizingConstraints(spec.get(), minSize, maxSize, increment); - mir_surface_apply_spec(mMirSurface, spec.get()); -} - -void UbuntuSurface::handleSurfaceResized(int width, int height) -{ - QMutexLocker lock(&mTargetSizeMutex); - - // mir's resize event is mainly a signal that we need to redraw our content. We use the - // width/height as identifiers to figure out if this is the latest surface resize event - // that has posted, discarding any old ones. This avoids issuing too many redraw events. - // see TODO in postEvent as the ideal way we should handle this. - // The actual buffer size may or may have not changed at this point, so let the rendering - // thread drive the window geometry updates. - mNeedsRepaint = mTargetSize.width() == width && mTargetSize.height() == height; -} - -int UbuntuSurface::needsRepaint() const -{ - if (mNeedsRepaint) { - if (mTargetSize != mBufferSize) { - //If the buffer hasn't changed yet, we need at least two redraws, - //once to get the new buffer size and propagate the geometry changes - //and the second to redraw the content at the new size - return 2; - } else { - // The buffer size has already been updated so we only need one redraw - // to render at the new size - return 1; - } - } - return 0; -} - -void UbuntuSurface::setState(MirSurfaceState state) -{ - mir_wait_for(mir_surface_set_state(mMirSurface, state)); -} - -void UbuntuSurface::setShellChrome(MirShellChrome chrome) -{ - if (chrome != mShellChrome) { - auto spec = Spec{mir_connection_create_spec_for_changes(mConnection)}; - mir_surface_spec_set_shell_chrome(spec.get(), chrome); - mir_surface_apply_spec(mMirSurface, spec.get()); - - mShellChrome = chrome; - } -} - -void UbuntuSurface::onSwapBuffersDone() -{ - static int sFrameNumber = 0; - ++sFrameNumber; - - EGLint eglSurfaceWidth = -1; - EGLint eglSurfaceHeight = -1; - eglQuerySurface(mEglDisplay, mEglSurface, EGL_WIDTH, &eglSurfaceWidth); - eglQuerySurface(mEglDisplay, mEglSurface, EGL_HEIGHT, &eglSurfaceHeight); - - const bool validSize = eglSurfaceWidth > 0 && eglSurfaceHeight > 0; - - if (validSize && (mBufferSize.width() != eglSurfaceWidth || mBufferSize.height() != eglSurfaceHeight)) { - - qCDebug(mirclientBufferSwap, "onSwapBuffersDone(window=%p) [%d] - size changed (%d, %d) => (%d, %d)", - mWindow, sFrameNumber, mBufferSize.width(), mBufferSize.height(), eglSurfaceWidth, eglSurfaceHeight); - - mBufferSize.rwidth() = eglSurfaceWidth; - mBufferSize.rheight() = eglSurfaceHeight; - - QRect newGeometry = mPlatformWindow->geometry(); - newGeometry.setSize(mBufferSize); - - QWindowSystemInterface::handleGeometryChange(mWindow, newGeometry); - } else { - qCDebug(mirclientBufferSwap, "onSwapBuffersDone(window=%p) [%d] - buffer size (%d,%d)", - mWindow, sFrameNumber, mBufferSize.width(), mBufferSize.height()); - } -} - -void UbuntuSurface::surfaceEventCallback(MirSurface *surface, const MirEvent *event, void* context) -{ - Q_UNUSED(surface); - Q_ASSERT(context != nullptr); - - auto s = static_cast<UbuntuSurface *>(context); - s->postEvent(event); -} - -void UbuntuSurface::postEvent(const MirEvent *event) -{ - if (mir_event_type_resize == mir_event_get_type(event)) { - // TODO: The current event queue just accumulates all resize events; - // It would be nicer if we could update just one event if that event has not been dispatched. - // As a workaround, we use the width/height as an identifier of this latest event - // so the event handler (handleSurfaceResized) can discard/ignore old ones. - const auto resizeEvent = mir_event_get_resize_event(event); - const auto width = mir_resize_event_get_width(resizeEvent); - const auto height = mir_resize_event_get_height(resizeEvent); - qCDebug(mirclient, "resizeEvent(window=%p, width=%d, height=%d)", mWindow, width, height); - - QMutexLocker lock(&mTargetSizeMutex); - mTargetSize.rwidth() = width; - mTargetSize.rheight() = height; - } - - mInput->postEvent(mPlatformWindow, event); -} - -void UbuntuSurface::setSurfaceParent(MirSurface* parent) -{ - qCDebug(mirclient, "setSurfaceParent(window=%p)", mWindow); - - mParented = true; - Spec spec{mir_connection_create_spec_for_changes(mConnection)}; - mir_surface_spec_set_parent(spec.get(), parent); - mir_surface_apply_spec(mMirSurface, spec.get()); -} - -QString UbuntuSurface::persistentSurfaceId() -{ - if (mPersistentIdStr.isEmpty()) { - MirPersistentId* mirPermaId = mir_surface_request_persistent_id_sync(mMirSurface); - mPersistentIdStr = mir_persistent_id_as_string(mirPermaId); - mir_persistent_id_release(mirPermaId); - } - return mPersistentIdStr; -} - -QMirClientWindow::QMirClientWindow(QWindow *w, QMirClientInput *input, QMirClientNativeInterface *native, - QMirClientAppStateController *appState, EGLDisplay eglDisplay, - MirConnection *mirConnection, QMirClientDebugExtension *debugExt) - : QObject(nullptr) - , QPlatformWindow(w) - , mId(makeId()) - , mWindowState(w->windowState()) - , mWindowFlags(w->flags()) - , mWindowVisible(false) - , mAppStateController(appState) - , mDebugExtention(debugExt) - , mNativeInterface(native) - , mSurface(new UbuntuSurface{this, eglDisplay, input, mirConnection}) - , mScale(1.0) - , mFormFactor(mir_form_factor_unknown) -{ - mWindowExposed = mSurface->mNeedsExposeCatchup == false; - - qCDebug(mirclient, "QMirClientWindow(window=%p, screen=%p, input=%p, surf=%p) with title '%s', role: '%d'", - w, w->screen()->handle(), input, mSurface.get(), qPrintable(window()->title()), roleFor(window())); -} - -QMirClientWindow::~QMirClientWindow() -{ - qCDebug(mirclient, "~QMirClientWindow(window=%p)", this); -} - -void QMirClientWindow::handleSurfaceResized(int width, int height) -{ - QMutexLocker lock(&mMutex); - qCDebug(mirclient, "handleSurfaceResize(window=%p, size=(%dx%d)px", window(), width, height); - - mSurface->handleSurfaceResized(width, height); - - // This resize event could have occurred just after the last buffer swap for this window. - // This means the client may still be holding a buffer with the older size. The first redraw call - // will then render at the old size. After swapping the client now will get a new buffer with the - // updated size but it still needs re-rendering so another redraw may be needed. - // A mir API to drop the currently held buffer would help here, so that we wouldn't have to redraw twice - auto const numRepaints = mSurface->needsRepaint(); - lock.unlock(); - qCDebug(mirclient, "handleSurfaceResize(window=%p) redraw %d times", window(), numRepaints); - for (int i = 0; i < numRepaints; i++) { - qCDebug(mirclient, "handleSurfaceResize(window=%p) repainting size=(%dx%d)dp", window(), geometry().size().width(), geometry().size().height()); - QWindowSystemInterface::handleExposeEvent(window(), QRect(QPoint(), geometry().size())); - } -} - -void QMirClientWindow::handleSurfaceExposeChange(bool exposed) -{ - QMutexLocker lock(&mMutex); - qCDebug(mirclient, "handleSurfaceExposeChange(window=%p, exposed=%s)", window(), exposed ? "true" : "false"); - - mSurface->mNeedsExposeCatchup = false; - if (mWindowExposed == exposed) return; - mWindowExposed = exposed; - - lock.unlock(); - QWindowSystemInterface::handleExposeEvent(window(), QRect(QPoint(), geometry().size())); -} - -void QMirClientWindow::handleSurfaceFocusChanged(bool focused) -{ - qCDebug(mirclient, "handleSurfaceFocusChanged(window=%p, focused=%d)", window(), focused); - if (focused) { - mAppStateController->setWindowFocused(true); - QWindowSystemInterface::handleWindowActivated(window(), Qt::ActiveWindowFocusReason); - } else { - mAppStateController->setWindowFocused(false); - } -} - -void QMirClientWindow::handleSurfaceVisibilityChanged(bool visible) -{ - qCDebug(mirclient, "handleSurfaceVisibilityChanged(window=%p, visible=%d)", window(), visible); - - if (mWindowVisible == visible) return; - mWindowVisible = visible; - - QWindowSystemInterface::handleExposeEvent(window(), QRect(QPoint(), geometry().size())); -} - -void QMirClientWindow::handleSurfaceStateChanged(Qt::WindowState state) -{ - qCDebug(mirclient, "handleSurfaceStateChanged(window=%p, %s)", window(), qtWindowStateToStr(state)); - - if (mWindowState == state) return; - mWindowState = state; - - QWindowSystemInterface::handleWindowStateChanged(window(), state); -} - -void QMirClientWindow::setWindowState(Qt::WindowStates states) -{ - Qt::WindowState state = Qt::WindowNoState; - if (states & Qt::WindowMinimized) - state = Qt::WindowMinimized; - else if (states & Qt::WindowFullScreen) - state = Qt::WindowFullScreen; - else if (states & Qt::WindowMaximized) - state = Qt::WindowMaximized; - - QMutexLocker lock(&mMutex); - qCDebug(mirclient, "setWindowState(window=%p, %s)", this, qtWindowStateToStr(state)); - - if (mWindowState == state) return; - mWindowState = state; - - lock.unlock(); - updateSurfaceState(); -} - -void QMirClientWindow::setWindowFlags(Qt::WindowFlags flags) -{ - QMutexLocker lock(&mMutex); - qCDebug(mirclient, "setWindowFlags(window=%p, 0x%x)", this, (int)flags); - - if (mWindowFlags == flags) return; - mWindowFlags = flags; - - mSurface->setShellChrome(mWindowFlags & LowChromeWindowHint ? mir_shell_chrome_low : mir_shell_chrome_normal); -} - -QRect QMirClientWindow::geometry() const -{ - if (mDebugExtention) { - auto geom = QPlatformWindow::geometry(); - geom.moveTopLeft(mDebugExtention->mapSurfacePointToScreen(mSurface->mirSurface(), QPoint(0,0))); - return geom; - } else { - return QPlatformWindow::geometry(); - } -} - -void QMirClientWindow::setGeometry(const QRect& rect) -{ - QMutexLocker lock(&mMutex); - - if (window()->windowState() == Qt::WindowFullScreen || window()->windowState() == Qt::WindowMaximized) { - qCDebug(mirclient, "setGeometry(window=%p) - not resizing, window is maximized or fullscreen", window()); - return; - } - - qCDebug(mirclient, "setGeometry (window=%p, position=(%d, %d)dp, size=(%dx%d)dp)", - window(), rect.x(), rect.y(), rect.width(), rect.height()); - // Immediately update internal geometry so Qt believes position updated - QRect newPosition(geometry()); - newPosition.moveTo(rect.topLeft()); - QPlatformWindow::setGeometry(newPosition); - - mSurface->updateGeometry(rect); - // Note: don't call handleGeometryChange here, wait to see what Mir replies with. -} - -void QMirClientWindow::setVisible(bool visible) -{ - QMutexLocker lock(&mMutex); - qCDebug(mirclient, "setVisible (window=%p, visible=%s)", window(), visible ? "true" : "false"); - - if (mWindowVisible == visible) return; - mWindowVisible = visible; - - if (visible) { - if (!mSurface->hasParent() && window()->type() == Qt::Dialog) { - // The dialog may have been parented after creation time - // so morph it into a modal dialog - auto parent = transientParentFor(window()); - if (parent) { - mSurface->setSurfaceParent(parent->mirSurface()); - } - } - } - - lock.unlock(); - updateSurfaceState(); - QWindowSystemInterface::handleExposeEvent(window(), QRect(QPoint(), geometry().size())); -} - -void QMirClientWindow::setWindowTitle(const QString& title) -{ - QMutexLocker lock(&mMutex); - qCDebug(mirclient, "setWindowTitle(window=%p) title=%s)", window(), title.toUtf8().constData()); - mSurface->updateTitle(title); -} - -void QMirClientWindow::propagateSizeHints() -{ - QMutexLocker lock(&mMutex); - const auto win = window(); - qCDebug(mirclient, "propagateSizeHints(window=%p) min(%d,%d), max(%d,%d) increment(%d, %d)", - win, win->minimumSize().width(), win->minimumSize().height(), - win->maximumSize().width(), win->maximumSize().height(), - win->sizeIncrement().width(), win->sizeIncrement().height()); - mSurface->setSizingConstraints(win->minimumSize(), win->maximumSize(), win->sizeIncrement()); -} - -bool QMirClientWindow::isExposed() const -{ - // mNeedsExposeCatchup because we need to render a frame to get the expose surface event from mir. - return mWindowVisible && (mWindowExposed || (mSurface && mSurface->mNeedsExposeCatchup)); -} - -QSurfaceFormat QMirClientWindow::format() const -{ - return mSurface->format(); -} - -QPoint QMirClientWindow::mapToGlobal(const QPoint &pos) const -{ - if (mDebugExtention) { - return mDebugExtention->mapSurfacePointToScreen(mSurface->mirSurface(), pos); - } else { - return pos; - } -} - -void* QMirClientWindow::eglSurface() const -{ - return mSurface->eglSurface(); -} - -MirSurface *QMirClientWindow::mirSurface() const -{ - return mSurface->mirSurface(); -} - -WId QMirClientWindow::winId() const -{ - return mId; -} - -void QMirClientWindow::onSwapBuffersDone() -{ - QMutexLocker lock(&mMutex); - mSurface->onSwapBuffersDone(); - - if (mSurface->mNeedsExposeCatchup) { - mSurface->mNeedsExposeCatchup = false; - mWindowExposed = false; - - lock.unlock(); - QWindowSystemInterface::handleExposeEvent(window(), QRect(QPoint(), geometry().size())); - } -} - -void QMirClientWindow::handleScreenPropertiesChange(MirFormFactor formFactor, float scale) -{ - // Update the scale & form factor native-interface properties for the windows affected - // as there is no convenient way to emit signals for those custom properties on a QScreen - if (formFactor != mFormFactor) { - mFormFactor = formFactor; - Q_EMIT mNativeInterface->windowPropertyChanged(this, QStringLiteral("formFactor")); - } - - if (!qFuzzyCompare(scale, mScale)) { - mScale = scale; - Q_EMIT mNativeInterface->windowPropertyChanged(this, QStringLiteral("scale")); - } -} - -void QMirClientWindow::updateSurfaceState() -{ - QMutexLocker lock(&mMutex); - MirSurfaceState newState = mWindowVisible ? qtWindowStateToMirSurfaceState(mWindowState) : - mir_surface_state_hidden; - qCDebug(mirclient, "updateSurfaceState (window=%p, surfaceState=%s)", window(), mirSurfaceStateToStr(newState)); - if (newState != mSurface->state()) { - mSurface->setState(newState); - } -} - -QString QMirClientWindow::persistentSurfaceId() -{ - return mSurface->persistentSurfaceId(); -} diff --git a/src/plugins/platforms/mirclient/qmirclientwindow.h b/src/plugins/platforms/mirclient/qmirclientwindow.h deleted file mode 100644 index 6c5695d62f..0000000000 --- a/src/plugins/platforms/mirclient/qmirclientwindow.h +++ /dev/null @@ -1,118 +0,0 @@ -/**************************************************************************** -** -** Copyright (C) 2014-2016 Canonical, Ltd. -** Contact: https://www.qt.io/licensing/ -** -** This file is part of the plugins of the Qt Toolkit. -** -** $QT_BEGIN_LICENSE:LGPL$ -** Commercial License Usage -** Licensees holding valid commercial Qt licenses may use this file in -** accordance with the commercial license agreement provided with the -** Software or, alternatively, in accordance with the terms contained in -** a written agreement between you and The Qt Company. For licensing terms -** and conditions see https://www.qt.io/terms-conditions. For further -** information use the contact form at https://www.qt.io/contact-us. -** -** GNU Lesser General Public License Usage -** Alternatively, this file may be used under the terms of the GNU Lesser -** General Public License version 3 as published by the Free Software -** Foundation and appearing in the file LICENSE.LGPL3 included in the -** packaging of this file. Please review the following information to -** ensure the GNU Lesser General Public License version 3 requirements -** will be met: https://www.gnu.org/licenses/lgpl-3.0.html. -** -** GNU General Public License Usage -** Alternatively, this file may be used under the terms of the GNU -** General Public License version 2.0 or (at your option) the GNU General -** Public license version 3 or any later version approved by the KDE Free -** Qt Foundation. The licenses are as published by the Free Software -** Foundation and appearing in the file LICENSE.GPL2 and LICENSE.GPL3 -** included in the packaging of this file. Please review the following -** information to ensure the GNU General Public License requirements will -** be met: https://www.gnu.org/licenses/gpl-2.0.html and -** https://www.gnu.org/licenses/gpl-3.0.html. -** -** $QT_END_LICENSE$ -** -****************************************************************************/ - - -#ifndef QMIRCLIENTWINDOW_H -#define QMIRCLIENTWINDOW_H - -#include <qpa/qplatformwindow.h> -#include <QSharedPointer> -#include <QMutex> - -#include <mir_toolkit/common.h> // needed only for MirFormFactor enum - -#include <memory> - -#include <EGL/egl.h> - -class QMirClientAppStateController; -class QMirClientDebugExtension; -class QMirClientNativeInterface; -class QMirClientInput; -class QMirClientScreen; -class UbuntuSurface; -struct MirSurface; -class MirConnection; - -class QMirClientWindow : public QObject, public QPlatformWindow -{ - Q_OBJECT -public: - QMirClientWindow(QWindow *w, QMirClientInput *input, QMirClientNativeInterface* native, - QMirClientAppStateController *appState, EGLDisplay eglDisplay, - MirConnection *mirConnection, QMirClientDebugExtension *debugExt); - virtual ~QMirClientWindow(); - - // QPlatformWindow methods. - WId winId() const override; - QRect geometry() const override; - void setGeometry(const QRect&) override; - void setWindowState(Qt::WindowStates state) override; - void setWindowFlags(Qt::WindowFlags flags) override; - void setVisible(bool visible) override; - void setWindowTitle(const QString &title) override; - void propagateSizeHints() override; - bool isExposed() const override; - - QPoint mapToGlobal(const QPoint &pos) const override; - QSurfaceFormat format() const override; - - // Additional Window properties exposed by NativeInterface - MirFormFactor formFactor() const { return mFormFactor; } - float scale() const { return mScale; } - - // New methods. - void *eglSurface() const; - MirSurface *mirSurface() const; - void handleSurfaceResized(int width, int height); - void handleSurfaceExposeChange(bool exposed); - void handleSurfaceFocusChanged(bool focused); - void handleSurfaceVisibilityChanged(bool visible); - void handleSurfaceStateChanged(Qt::WindowState state); - void onSwapBuffersDone(); - void handleScreenPropertiesChange(MirFormFactor formFactor, float scale); - QString persistentSurfaceId(); - -private: - void updateSurfaceState(); - mutable QMutex mMutex; - const WId mId; - Qt::WindowState mWindowState; - Qt::WindowFlags mWindowFlags; - bool mWindowVisible; - bool mWindowExposed; - QMirClientAppStateController *mAppStateController; - QMirClientDebugExtension *mDebugExtention; - QMirClientNativeInterface *mNativeInterface; - std::unique_ptr<UbuntuSurface> mSurface; - float mScale; - MirFormFactor mFormFactor; -}; - -#endif // QMIRCLIENTWINDOW_H diff --git a/src/plugins/platforms/platforms.pro b/src/plugins/platforms/platforms.pro index acc55adf6f..c4f2b30965 100644 --- a/src/plugins/platforms/platforms.pro +++ b/src/plugins/platforms/platforms.pro @@ -48,6 +48,4 @@ haiku { wasm: SUBDIRS += wasm -qtConfig(mirclient): SUBDIRS += mirclient - qtConfig(integrityfb): SUBDIRS += integrity diff --git a/src/plugins/platforms/qnx/qqnxscreeneventhandler.cpp b/src/plugins/platforms/qnx/qqnxscreeneventhandler.cpp index f29e11489b..c2471751f5 100644 --- a/src/plugins/platforms/qnx/qqnxscreeneventhandler.cpp +++ b/src/plugins/platforms/qnx/qqnxscreeneventhandler.cpp @@ -242,7 +242,11 @@ void QQnxScreenEventHandler::processEvents() break; ++count; +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + qintptr result = 0; +#else long result = 0; +#endif QAbstractEventDispatcher* dispatcher = QAbstractEventDispatcher::instance(); bool handled = dispatcher && dispatcher->filterNativeEvent(QByteArrayLiteral("screen_event_t"), event, &result); if (!handled) diff --git a/src/plugins/platforms/vnc/qvnc_p.h b/src/plugins/platforms/vnc/qvnc_p.h index 338fae9f87..f7f2f74ddb 100644 --- a/src/plugins/platforms/vnc/qvnc_p.h +++ b/src/plugins/platforms/vnc/qvnc_p.h @@ -139,7 +139,7 @@ public: class QRfbServerInit { public: - QRfbServerInit() { name = 0; } + QRfbServerInit() { name = nullptr; } ~QRfbServerInit() { delete[] name; } int size() const { return QRfbPixelFormat::size() + 8 + strlen(name); } diff --git a/src/plugins/platforms/vnc/qvncscreen.h b/src/plugins/platforms/vnc/qvncscreen.h index e69aa90d41..db658d4ecc 100644 --- a/src/plugins/platforms/vnc/qvncscreen.h +++ b/src/plugins/platforms/vnc/qvncscreen.h @@ -82,12 +82,12 @@ public: qreal dpiX = 96; qreal dpiY = 96; - QVncDirtyMap *dirty = 0; + QVncDirtyMap *dirty = nullptr; QRegion dirtyRegion; int refreshRate = 30; - QVncServer *vncServer = 0; + QVncServer *vncServer = nullptr; #if QT_CONFIG(cursor) - QVncClientCursor *clientCursor = 0; + QVncClientCursor *clientCursor = nullptr; #endif }; diff --git a/src/plugins/platforms/windows/qwindowscontext.cpp b/src/plugins/platforms/windows/qwindowscontext.cpp index 80517ffe69..073d6da536 100644 --- a/src/plugins/platforms/windows/qwindowscontext.cpp +++ b/src/plugins/platforms/windows/qwindowscontext.cpp @@ -1605,7 +1605,11 @@ static inline QByteArray nativeEventType() { return QByteArrayLiteral("windows_g bool QWindowsContext::filterNativeEvent(MSG *msg, LRESULT *result) { QAbstractEventDispatcher *dispatcher = QAbstractEventDispatcher::instance(); +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + qintptr filterResult = 0; +#else long filterResult = 0; +#endif if (dispatcher && dispatcher->filterNativeEvent(nativeEventType(), msg, &filterResult)) { *result = LRESULT(filterResult); return true; @@ -1616,7 +1620,11 @@ bool QWindowsContext::filterNativeEvent(MSG *msg, LRESULT *result) // Send to QWindowSystemInterface bool QWindowsContext::filterNativeEvent(QWindow *window, MSG *msg, LRESULT *result) { +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + qintptr filterResult = 0; +#else long filterResult = 0; +#endif if (QWindowSystemInterface::handleNativeEvent(window, nativeEventType(), msg, &filterResult)) { *result = LRESULT(filterResult); return true; diff --git a/src/plugins/platforms/xcb/gl_integrations/qxcbglintegrationplugin.h b/src/plugins/platforms/xcb/gl_integrations/qxcbglintegrationplugin.h index d5a0af97b0..b18248570f 100644 --- a/src/plugins/platforms/xcb/gl_integrations/qxcbglintegrationplugin.h +++ b/src/plugins/platforms/xcb/gl_integrations/qxcbglintegrationplugin.h @@ -54,7 +54,7 @@ class Q_XCB_EXPORT QXcbGlIntegrationPlugin : public QObject { Q_OBJECT public: - explicit QXcbGlIntegrationPlugin(QObject *parent = 0) + explicit QXcbGlIntegrationPlugin(QObject *parent = nullptr) : QObject(parent) { } diff --git a/src/plugins/platforms/xcb/gl_integrations/xcb_glx/qxcbglxintegration.cpp b/src/plugins/platforms/xcb/gl_integrations/xcb_glx/qxcbglxintegration.cpp index b751aaf8a3..34895caaa2 100644 --- a/src/plugins/platforms/xcb/gl_integrations/xcb_glx/qxcbglxintegration.cpp +++ b/src/plugins/platforms/xcb/gl_integrations/xcb_glx/qxcbglxintegration.cpp @@ -164,7 +164,11 @@ bool QXcbGlxIntegration::handleXcbEvent(xcb_generic_event_t *event, uint respons XUnlockDisplay(xdisplay); locked = false; auto eventType = m_connection->nativeInterface()->nativeEventType(); +# if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + qintptr result = 0; +# else long result = 0; +# endif handled = dispatcher->filterNativeEvent(eventType, &ev, &result); } #endif diff --git a/src/plugins/platforms/xcb/qxcbconnection.cpp b/src/plugins/platforms/xcb/qxcbconnection.cpp index 06d1000993..d27a288feb 100644 --- a/src/plugins/platforms/xcb/qxcbconnection.cpp +++ b/src/plugins/platforms/xcb/qxcbconnection.cpp @@ -438,7 +438,11 @@ const char *xcb_protocol_request_codes[] = void QXcbConnection::handleXcbError(xcb_generic_error_t *error) { +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + qintptr result = 0; +#else long result = 0; +#endif QAbstractEventDispatcher* dispatcher = QAbstractEventDispatcher::instance(); if (dispatcher && dispatcher->filterNativeEvent(m_nativeInterface->nativeEventType(), error, &result)) return; @@ -535,7 +539,11 @@ void QXcbConnection::handleXcbEvent(xcb_generic_event_t *event) if (Q_UNLIKELY(lcQpaEvents().isDebugEnabled())) printXcbEvent(lcQpaEvents(), "Event", event); +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + qintptr result = 0; // Used only by MS Windows +#else long result = 0; // Used only by MS Windows +#endif if (QAbstractEventDispatcher *dispatcher = QAbstractEventDispatcher::instance()) { if (dispatcher->filterNativeEvent(m_nativeInterface->nativeEventType(), event, &result)) return; diff --git a/src/plugins/platforms/xcb/qxcbconnection.h b/src/plugins/platforms/xcb/qxcbconnection.h index bbfa252881..7cf25d41a6 100644 --- a/src/plugins/platforms/xcb/qxcbconnection.h +++ b/src/plugins/platforms/xcb/qxcbconnection.h @@ -108,7 +108,7 @@ public: virtual void handleXIMouseEvent(xcb_ge_event_t *, Qt::MouseEventSource = Qt::MouseEventNotSynthesized) {} virtual void handleXIEnterLeave(xcb_ge_event_t *) {} #endif - virtual QXcbWindow *toWindow() { return 0; } + virtual QXcbWindow *toWindow() { return nullptr; } }; typedef QHash<xcb_window_t, QXcbWindowEventListener *> WindowMapper; @@ -366,7 +366,7 @@ private: WindowMapper m_mapper; - Qt::MouseButtons m_buttonState = 0; + Qt::MouseButtons m_buttonState = nullptr; Qt::MouseButton m_button = Qt::NoButton; QXcbWindow *m_focusWindow = nullptr; diff --git a/src/plugins/platforms/xcb/qxcbcursor.h b/src/plugins/platforms/xcb/qxcbcursor.h index 5bc806381c..488988cbe9 100644 --- a/src/plugins/platforms/xcb/qxcbcursor.h +++ b/src/plugins/platforms/xcb/qxcbcursor.h @@ -83,7 +83,7 @@ public: QPoint pos() const override; void setPos(const QPoint &pos) override; - static void queryPointer(QXcbConnection *c, QXcbVirtualDesktop **virtualDesktop, QPoint *pos, int *keybMask = 0); + static void queryPointer(QXcbConnection *c, QXcbVirtualDesktop **virtualDesktop, QPoint *pos, int *keybMask = nullptr); #ifndef QT_NO_CURSOR xcb_cursor_t xcbCursor(const QCursor &c) const diff --git a/src/plugins/platforms/xcb/qxcbdrag.h b/src/plugins/platforms/xcb/qxcbdrag.h index c19008c04b..1388e68acc 100644 --- a/src/plugins/platforms/xcb/qxcbdrag.h +++ b/src/plugins/platforms/xcb/qxcbdrag.h @@ -86,7 +86,7 @@ public: void handlePosition(QPlatformWindow *w, const xcb_client_message_event_t *event); void handleLeave(QPlatformWindow *w, const xcb_client_message_event_t *event); void handleDrop(QPlatformWindow *, const xcb_client_message_event_t *event, - Qt::MouseButtons b = 0, Qt::KeyboardModifiers mods = 0); + Qt::MouseButtons b = nullptr, Qt::KeyboardModifiers mods = nullptr); void handleStatus(const xcb_client_message_event_t *event); void handleSelectionRequest(const xcb_selection_request_event_t *event); @@ -109,7 +109,7 @@ private: void init(); void handle_xdnd_position(QPlatformWindow *w, const xcb_client_message_event_t *event, - Qt::MouseButtons b = 0, Qt::KeyboardModifiers mods = 0); + Qt::MouseButtons b = nullptr, Qt::KeyboardModifiers mods = nullptr); void handle_xdnd_status(const xcb_client_message_event_t *event); void send_leave(); diff --git a/src/plugins/platforms/xcb/qxcbobject.h b/src/plugins/platforms/xcb/qxcbobject.h index 1b98d9346b..931bed9ec1 100644 --- a/src/plugins/platforms/xcb/qxcbobject.h +++ b/src/plugins/platforms/xcb/qxcbobject.h @@ -47,7 +47,7 @@ QT_BEGIN_NAMESPACE class QXcbObject { public: - QXcbObject(QXcbConnection *connection = 0) : m_connection(connection) {} + QXcbObject(QXcbConnection *connection = nullptr) : m_connection(connection) {} void setConnection(QXcbConnection *connection) { m_connection = connection; } QXcbConnection *connection() const { return m_connection; } diff --git a/src/plugins/platforms/xcb/qxcbwindow.cpp b/src/plugins/platforms/xcb/qxcbwindow.cpp index 9382488b74..396b47001d 100644 --- a/src/plugins/platforms/xcb/qxcbwindow.cpp +++ b/src/plugins/platforms/xcb/qxcbwindow.cpp @@ -1657,7 +1657,11 @@ bool QXcbWindow::requestSystemTrayWindowDock() bool QXcbWindow::handleNativeEvent(xcb_generic_event_t *event) { auto eventType = connection()->nativeInterface()->nativeEventType(); +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + qintptr result = 0; // Used only by MS Windows +#else long result = 0; // Used only by MS Windows +#endif return QWindowSystemInterface::handleNativeEvent(window(), eventType, event, &result); } diff --git a/src/plugins/platforms/xcb/qxcbwindow.h b/src/plugins/platforms/xcb/qxcbwindow.h index f98cd8a74d..e4a04f5308 100644 --- a/src/plugins/platforms/xcb/qxcbwindow.h +++ b/src/plugins/platforms/xcb/qxcbwindow.h @@ -166,7 +166,7 @@ public: bool needsSync() const; void postSyncWindowRequest(); - void clearSyncWindowRequest() { m_pendingSyncRequest = 0; } + void clearSyncWindowRequest() { m_pendingSyncRequest = nullptr; } QXcbScreen *xcbScreen() const; diff --git a/src/plugins/platformthemes/xdgdesktopportal/qxdgdesktopportaltheme.h b/src/plugins/platformthemes/xdgdesktopportal/qxdgdesktopportaltheme.h index 3497c6a6f1..5cfc4df0d0 100644 --- a/src/plugins/platformthemes/xdgdesktopportal/qxdgdesktopportaltheme.h +++ b/src/plugins/platformthemes/xdgdesktopportal/qxdgdesktopportaltheme.h @@ -72,7 +72,7 @@ public: QPixmap standardPixmap(StandardPixmap sp, const QSizeF &size) const override; QIcon fileIcon(const QFileInfo &fileInfo, - QPlatformTheme::IconOptions iconOptions = 0) const override; + QPlatformTheme::IconOptions iconOptions = nullptr) const override; QIconEngine *createIconEngine(const QString &iconName) const override; diff --git a/src/plugins/sqldrivers/odbc/qsql_odbc_p.h b/src/plugins/sqldrivers/odbc/qsql_odbc_p.h index ea0aa6fc8b..ccd0206f38 100644 --- a/src/plugins/sqldrivers/odbc/qsql_odbc_p.h +++ b/src/plugins/sqldrivers/odbc/qsql_odbc_p.h @@ -89,8 +89,8 @@ class Q_EXPORT_SQLDRIVER_ODBC QODBCDriver : public QSqlDriver friend class QODBCResultPrivate; public: - explicit QODBCDriver(QObject *parent=0); - QODBCDriver(SQLHANDLE env, SQLHANDLE con, QObject * parent=0); + explicit QODBCDriver(QObject *parent=nullptr); + QODBCDriver(SQLHANDLE env, SQLHANDLE con, QObject * parent=nullptr); virtual ~QODBCDriver(); bool hasFeature(DriverFeature f) const override; void close() override; diff --git a/src/plugins/sqldrivers/sqlite/qsql_sqlite_p.h b/src/plugins/sqldrivers/sqlite/qsql_sqlite_p.h index 61be4c937f..c7952bca9a 100644 --- a/src/plugins/sqldrivers/sqlite/qsql_sqlite_p.h +++ b/src/plugins/sqldrivers/sqlite/qsql_sqlite_p.h @@ -72,8 +72,8 @@ class Q_EXPORT_SQLDRIVER_SQLITE QSQLiteDriver : public QSqlDriver Q_OBJECT friend class QSQLiteResultPrivate; public: - explicit QSQLiteDriver(QObject *parent = 0); - explicit QSQLiteDriver(sqlite3 *connection, QObject *parent = 0); + explicit QSQLiteDriver(QObject *parent = nullptr); + explicit QSQLiteDriver(sqlite3 *connection, QObject *parent = nullptr); ~QSQLiteDriver(); bool hasFeature(DriverFeature f) const override; bool open(const QString & db, diff --git a/src/printsupport/dialogs/qpagesetupdialog_unix.cpp b/src/printsupport/dialogs/qpagesetupdialog_unix.cpp index d9b4a84aa9..1d8af9dbf0 100644 --- a/src/printsupport/dialogs/qpagesetupdialog_unix.cpp +++ b/src/printsupport/dialogs/qpagesetupdialog_unix.cpp @@ -361,13 +361,21 @@ void QPageSetupWidget::initPageSizes() QPlatformPrinterSupport *ps = QPlatformPrinterSupportPlugin::get(); if (ps) { QPrintDevice printDevice = ps->createPrintDevice(m_printerName); + const QPageSize defaultSize = printDevice.defaultPageSize(); const auto pageSizes = printDevice.supportedPageSizes(); for (const QPageSize &pageSize : pageSizes) m_ui.pageSizeCombo->addItem(pageSize.name(), QVariant::fromValue(pageSize)); - if (m_ui.pageSizeCombo->count() > 0 && printDevice.supportsCustomPageSizes()) { - m_ui.pageSizeCombo->addItem(tr("Custom")); - m_realCustomPageSizeIndex = m_ui.pageSizeCombo->count() - 1; + if (m_ui.pageSizeCombo->count() > 0) { + if (printDevice.supportsCustomPageSizes()) { + m_ui.pageSizeCombo->addItem(tr("Custom")); + m_realCustomPageSizeIndex = m_ui.pageSizeCombo->count() - 1; + } m_blockSignals = false; + + // If the defaultSize is index 0, setCurrentIndex won't emit the currentIndexChanged + // signal; workaround the issue by initially setting the currentIndex to -1 + m_ui.pageSizeCombo->setCurrentIndex(-1); + m_ui.pageSizeCombo->setCurrentIndex(m_ui.pageSizeCombo->findData(QVariant::fromValue(defaultSize))); return; } } @@ -403,12 +411,6 @@ void QPageSetupWidget::setPrinter(QPrinter *printer, QPrintDevice *printDevice, // Initialize the layout to the current QPrinter layout m_pageLayout = m_printer->pageLayout(); - if (printDevice) { - const QPageSize pageSize = printDevice->defaultPageSize(); - const QMarginsF printable = printDevice->printableMargins(pageSize, m_pageLayout.orientation(), m_printer->resolution()); - m_pageLayout.setPageSize(pageSize, qt_convertMargins(printable, QPageLayout::Point, m_pageLayout.units())); - } - // Assume if margins are Points then is by default, so set to locale default units if (m_pageLayout.units() == QPageLayout::Point) { if (QLocale().measurementSystem() == QLocale::MetricSystem) @@ -735,8 +737,12 @@ int QPageSetupDialog::exec() Q_D(QPageSetupDialog); int ret = QDialog::exec(); - if (ret == Accepted) + if (ret == Accepted) { static_cast <QUnixPageSetupDialogPrivate*>(d)->widget->setupPrinter(); + static_cast <QUnixPageSetupDialogPrivate*>(d)->widget->updateSavedValues(); + } else { + static_cast <QUnixPageSetupDialogPrivate*>(d)->widget->revertToSavedValues(); + } return ret; } diff --git a/src/printsupport/dialogs/qprintpreviewdialog.cpp b/src/printsupport/dialogs/qprintpreviewdialog.cpp index e6b665f82c..39575d5f57 100644 --- a/src/printsupport/dialogs/qprintpreviewdialog.cpp +++ b/src/printsupport/dialogs/qprintpreviewdialog.cpp @@ -152,8 +152,8 @@ class QPrintPreviewDialogPrivate : public QDialogPrivate Q_DECLARE_PUBLIC(QPrintPreviewDialog) public: QPrintPreviewDialogPrivate() - : printDialog(nullptr), ownPrinter(false), - initialized(false) {} + : printDialog(nullptr), pageSetupDialog(nullptr), + ownPrinter(false), initialized(false) {} // private slots void _q_fit(QAction *action); @@ -178,6 +178,7 @@ public: void updateZoomFactor(); QPrintDialog *printDialog; + QPageSetupDialog *pageSetupDialog; QPrintPreviewWidget *preview; QPrinter *printer; bool ownPrinter; @@ -494,7 +495,7 @@ void QPrintPreviewDialogPrivate::updatePageNumLabel() void QPrintPreviewDialogPrivate::updateZoomFactor() { - zoomFactor->lineEdit()->setText(QString().sprintf("%.1f%%", preview->zoomFactor()*100)); + zoomFactor->lineEdit()->setText(QString::asprintf("%.1f%%", preview->zoomFactor()*100)); } void QPrintPreviewDialogPrivate::_q_fit(QAction* action) @@ -602,8 +603,10 @@ void QPrintPreviewDialogPrivate::_q_pageSetup() { Q_Q(QPrintPreviewDialog); - QPageSetupDialog pageSetup(printer, q); - if (pageSetup.exec() == QDialog::Accepted) { + if (!pageSetupDialog) + pageSetupDialog = new QPageSetupDialog(printer, q); + + if (pageSetupDialog->exec() == QDialog::Accepted) { // update possible orientation changes if (preview->orientation() == QPrinter::Portrait) { portraitAction->setChecked(true); @@ -713,6 +716,7 @@ QPrintPreviewDialog::~QPrintPreviewDialog() if (d->ownPrinter) delete d->printer; delete d->printDialog; + delete d->pageSetupDialog; } /*! diff --git a/src/sql/kernel/qsqlerror.cpp b/src/sql/kernel/qsqlerror.cpp index 41ea497ad7..7a1a91948c 100644 --- a/src/sql/kernel/qsqlerror.cpp +++ b/src/sql/kernel/qsqlerror.cpp @@ -365,7 +365,7 @@ QString QSqlError::nativeErrorCode() const QString QSqlError::text() const { QString result = d->databaseError; - if (!d->databaseError.endsWith(QLatin1String("\n"))) + if (!d->databaseError.isEmpty() && !d->driverError.isEmpty() && !d->databaseError.endsWith(QLatin1String("\n"))) result += QLatin1Char(' '); result += d->driverError; return result; diff --git a/src/sql/models/qsqlquerymodel_p.h b/src/sql/models/qsqlquerymodel_p.h index d5ca2f89cb..64e9aeb3db 100644 --- a/src/sql/models/qsqlquerymodel_p.h +++ b/src/sql/models/qsqlquerymodel_p.h @@ -75,7 +75,7 @@ public: void initColOffsets(int size); int columnInQuery(int modelColumn) const; - mutable QSqlQuery query = { QSqlQuery(0) }; + mutable QSqlQuery query = { QSqlQuery(nullptr) }; mutable QSqlError error; QModelIndex bottom; QSqlRecord rec; diff --git a/src/sql/models/qsqltablemodel_p.h b/src/sql/models/qsqltablemodel_p.h index bb568ab444..9ac34e7259 100644 --- a/src/sql/models/qsqltablemodel_p.h +++ b/src/sql/models/qsqltablemodel_p.h @@ -93,7 +93,7 @@ public: QSqlTableModel::EditStrategy strategy; bool busyInsertingRows; - QSqlQuery editQuery = { QSqlQuery(0) }; + QSqlQuery editQuery = { QSqlQuery(nullptr) }; QSqlIndex primaryIndex; QString tableName; QString filter; diff --git a/src/testlib/qabstracttestlogger_p.h b/src/testlib/qabstracttestlogger_p.h index a64e7ea96f..9bb1d1e80c 100644 --- a/src/testlib/qabstracttestlogger_p.h +++ b/src/testlib/qabstracttestlogger_p.h @@ -97,14 +97,14 @@ public: virtual void enterTestData(QTestData *) {} virtual void addIncident(IncidentTypes type, const char *description, - const char *file = 0, int line = 0) = 0; + const char *file = nullptr, int line = 0) = 0; virtual void addBenchmarkResult(const QBenchmarkResult &result) = 0; virtual void addMessage(QtMsgType, const QMessageLogContext &, const QString &); virtual void addMessage(MessageTypes type, const QString &message, - const char *file = 0, int line = 0) = 0; + const char *file = nullptr, int line = 0) = 0; void outputString(const char *msg); @@ -151,7 +151,7 @@ struct QTestCharBuffer inline bool reset(int newSize) { - char *newBuf = 0; + char *newBuf = nullptr; if (buf == staticBuf) { // if we point to our internal buffer, we need to malloc first newBuf = reinterpret_cast<char *>(malloc(newSize)); diff --git a/src/testlib/qbenchmarkevent.cpp b/src/testlib/qbenchmarkevent.cpp index f696f8b1eb..a8270219e4 100644 --- a/src/testlib/qbenchmarkevent.cpp +++ b/src/testlib/qbenchmarkevent.cpp @@ -96,7 +96,11 @@ QTest::QBenchmarkMetric QBenchmarkEvent::metricType() } // This could be done in a much better way, this is just the beginning. +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QBenchmarkEvent::nativeEventFilter(const QByteArray &eventType, void *message, qintptr *result) +#else bool QBenchmarkEvent::nativeEventFilter(const QByteArray &eventType, void *message, long *result) +#endif { Q_UNUSED(eventType); Q_UNUSED(message); diff --git a/src/testlib/qbenchmarkevent_p.h b/src/testlib/qbenchmarkevent_p.h index af42a17141..0f47aa475c 100644 --- a/src/testlib/qbenchmarkevent_p.h +++ b/src/testlib/qbenchmarkevent_p.h @@ -71,7 +71,11 @@ public: int adjustMedianCount(int suggestion) override; bool repeatCount() override { return 1; } QTest::QBenchmarkMetric metricType() override; +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + bool nativeEventFilter(const QByteArray &eventType, void *message, qintptr *result) override; +#else bool nativeEventFilter(const QByteArray &eventType, void *message, long *result) override; +#endif qint64 eventCounter; }; diff --git a/src/testlib/qcsvbenchmarklogger_p.h b/src/testlib/qcsvbenchmarklogger_p.h index 5840aee0f5..83e465c859 100644 --- a/src/testlib/qcsvbenchmarklogger_p.h +++ b/src/testlib/qcsvbenchmarklogger_p.h @@ -68,11 +68,11 @@ public: void leaveTestFunction() override; void addIncident(IncidentTypes type, const char *description, - const char *file = 0, int line = 0) override; + const char *file = nullptr, int line = 0) override; void addBenchmarkResult(const QBenchmarkResult &result) override; void addMessage(MessageTypes type, const QString &message, - const char *file = 0, int line = 0) override; + const char *file = nullptr, int line = 0) override; }; QT_END_NAMESPACE diff --git a/src/testlib/qplaintestlogger_p.h b/src/testlib/qplaintestlogger_p.h index 55755830b2..80ef4864c1 100644 --- a/src/testlib/qplaintestlogger_p.h +++ b/src/testlib/qplaintestlogger_p.h @@ -68,17 +68,17 @@ public: void leaveTestFunction() override; void addIncident(IncidentTypes type, const char *description, - const char *file = 0, int line = 0) override; + const char *file = nullptr, int line = 0) override; void addBenchmarkResult(const QBenchmarkResult &result) override; void addMessage(QtMsgType, const QMessageLogContext &, const QString &) override; void addMessage(MessageTypes type, const QString &message, - const char *file = 0, int line = 0) override; + const char *file = nullptr, int line = 0) override; private: - void printMessage(const char *type, const char *msg, const char *file = 0, int line = 0); + void printMessage(const char *type, const char *msg, const char *file = nullptr, int line = 0); void outputMessage(const char *str); void printBenchmarkResult(const QBenchmarkResult &result); }; diff --git a/src/testlib/qsignaldumper.cpp b/src/testlib/qsignaldumper.cpp index 8305c5d424..d0b6d0dd3f 100644 --- a/src/testlib/qsignaldumper.cpp +++ b/src/testlib/qsignaldumper.cpp @@ -87,7 +87,7 @@ static void qSignalDumperCallback(QObject *caller, int signal_index, void **argv str += objname.toLocal8Bit(); if (!objname.isEmpty()) str += ' '; - str += QByteArray::number(quintptr(caller), 16); + str += QByteArray::number(quintptr(caller), 16).rightJustified(8, '0'); str += ") "; str += member.name(); @@ -105,7 +105,7 @@ static void qSignalDumperCallback(QObject *caller, int signal_index, void **argv str += '@'; quintptr addr = quintptr(*reinterpret_cast<void **>(argv[i + 1])); - str.append(QByteArray::number(addr, 16)); + str.append(QByteArray::number(addr, 16).rightJustified(8, '0')); } else if (typeId != QMetaType::UnknownType) { Q_ASSERT(typeId != QMetaType::Void); // void parameter => metaobject is corrupt str.append(arg) @@ -144,7 +144,7 @@ static void qSignalDumperCallbackSlot(QObject *caller, int method_index, void ** str += objname.toLocal8Bit(); if (!objname.isEmpty()) str += ' '; - str += QByteArray::number(quintptr(caller), 16); + str += QByteArray::number(quintptr(caller), 16).rightJustified(8, '0'); str += ") "; str += member.methodSignature(); @@ -170,13 +170,12 @@ void QSignalDumper::startDump() { static QSignalSpyCallbackSet set = { QTest::qSignalDumperCallback, QTest::qSignalDumperCallbackSlot, QTest::qSignalDumperCallbackEndSignal, 0 }; - qt_register_signal_spy_callbacks(set); + qt_register_signal_spy_callbacks(&set); } void QSignalDumper::endDump() { - static QSignalSpyCallbackSet nset = { 0, 0, 0 ,0 }; - qt_register_signal_spy_callbacks(nset); + qt_register_signal_spy_callbacks(nullptr); } void QSignalDumper::ignoreClass(const QByteArray &klass) diff --git a/src/testlib/qsignalspy.h b/src/testlib/qsignalspy.h index 218a26ec5c..0285080662 100644 --- a/src/testlib/qsignalspy.h +++ b/src/testlib/qsignalspy.h @@ -122,7 +122,7 @@ public: } if (!QMetaObject::connect(obj, sigIndex, this, memberOffset, - Qt::DirectConnection, 0)) { + Qt::DirectConnection, nullptr)) { qWarning("QSignalSpy: QMetaObject::connect returned false. Unable to connect."); return; } diff --git a/src/testlib/qtaptestlogger_p.h b/src/testlib/qtaptestlogger_p.h index b51343e4fe..967c724b51 100644 --- a/src/testlib/qtaptestlogger_p.h +++ b/src/testlib/qtaptestlogger_p.h @@ -70,9 +70,9 @@ public: void enterTestData(QTestData *data) override; void addIncident(IncidentTypes type, const char *description, - const char *file = 0, int line = 0) override; + const char *file = nullptr, int line = 0) override; void addMessage(MessageTypes type, const QString &message, - const char *file = 0, int line = 0) override; + const char *file = nullptr, int line = 0) override; void addBenchmarkResult(const QBenchmarkResult &) override {}; private: diff --git a/src/testlib/qteamcitylogger_p.h b/src/testlib/qteamcitylogger_p.h index 80f2454724..dd7c0cdcf0 100644 --- a/src/testlib/qteamcitylogger_p.h +++ b/src/testlib/qteamcitylogger_p.h @@ -70,11 +70,11 @@ public: void leaveTestFunction() override; void addIncident(IncidentTypes type, const char *description, - const char *file = 0, int line = 0) override; + const char *file = nullptr, int line = 0) override; void addBenchmarkResult(const QBenchmarkResult &result) override; void addMessage(MessageTypes type, const QString &message, - const char *file = 0, int line = 0) override; + const char *file = nullptr, int line = 0) override; private: QString currTestFuncName; diff --git a/src/testlib/qtestcase.cpp b/src/testlib/qtestcase.cpp index 1f69429053..a202add2ae 100644 --- a/src/testlib/qtestcase.cpp +++ b/src/testlib/qtestcase.cpp @@ -1,6 +1,6 @@ /**************************************************************************** ** -** Copyright (C) 2016 The Qt Company Ltd. +** Copyright (C) 2019 The Qt Company Ltd. ** Copyright (C) 2016 Intel Corporation. ** Contact: https://www.qt.io/licensing/ ** @@ -1095,7 +1095,7 @@ bool TestMethods::invokeTest(int index, const char *data, WatchDog *watchDog) co const int globalDataCount = gTable->dataCount(); int curGlobalDataIndex = 0; - /* For each test function that has a *_data() table/function, do: */ + /* For each entry in the global data table, do: */ do { if (!gTable->isEmpty()) QTestResult::setCurrentGlobalTestData(gTable->testData(curGlobalDataIndex)); @@ -1103,50 +1103,50 @@ bool TestMethods::invokeTest(int index, const char *data, WatchDog *watchDog) co if (curGlobalDataIndex == 0) { qsnprintf(member, 512, "%s_data()", name.constData()); invokeMethod(QTest::currentTestObject, member); + if (QTestResult::skipCurrentTest()) + break; } bool foundFunction = false; - if (!QTestResult::skipCurrentTest()) { - int curDataIndex = 0; - const int dataCount = table.dataCount(); - - // Data tag requested but none available? - if (data && !dataCount) { - // Let empty data tag through. - if (!*data) - data = 0; - else { - fprintf(stderr, "Unknown testdata for function %s(): '%s'\n", name.constData(), data); - fprintf(stderr, "Function has no testdata.\n"); - return false; - } + int curDataIndex = 0; + const int dataCount = table.dataCount(); + + // Data tag requested but none available? + if (data && !dataCount) { + // Let empty data tag through. + if (!*data) + data = 0; + else { + fprintf(stderr, "Unknown testdata for function %s(): '%s'\n", name.constData(), data); + fprintf(stderr, "Function has no testdata.\n"); + return false; } + } - /* For each entry in the data table, do: */ - do { - QTestResult::setSkipCurrentTest(false); - QTestResult::setBlacklistCurrentTest(false); - if (!data || !qstrcmp(data, table.testData(curDataIndex)->dataTag())) { - foundFunction = true; + /* For each entry in this test's data table, do: */ + do { + QTestResult::setSkipCurrentTest(false); + QTestResult::setBlacklistCurrentTest(false); + if (!data || !qstrcmp(data, table.testData(curDataIndex)->dataTag())) { + foundFunction = true; - QTestPrivate::checkBlackLists(name.constData(), dataCount ? table.testData(curDataIndex)->dataTag() : 0); + QTestPrivate::checkBlackLists(name.constData(), dataCount ? table.testData(curDataIndex)->dataTag() : 0); - QTestDataSetter s(curDataIndex >= dataCount ? static_cast<QTestData *>(0) - : table.testData(curDataIndex)); + QTestDataSetter s(curDataIndex >= dataCount ? static_cast<QTestData *>(0) + : table.testData(curDataIndex)); - QTestPrivate::qtestMouseButtons = Qt::NoButton; - if (watchDog) - watchDog->beginTest(); - invokeTestOnData(index); - if (watchDog) - watchDog->testFinished(); + QTestPrivate::qtestMouseButtons = Qt::NoButton; + if (watchDog) + watchDog->beginTest(); + invokeTestOnData(index); + if (watchDog) + watchDog->testFinished(); - if (data) - break; - } - ++curDataIndex; - } while (curDataIndex < dataCount); - } + if (data) + break; + } + ++curDataIndex; + } while (curDataIndex < dataCount); if (data && !foundFunction) { fprintf(stderr, "Unknown testdata for function %s: '%s()'\n", name.constData(), data); @@ -2519,6 +2519,20 @@ bool QTest::compare_helper(bool success, const char *failureMsg, return QTestResult::compare(success, failureMsg, val1, val2, actual, expected, file, line); } +template <typename T> +static bool floatingCompare(const T &t1, const T &t2) +{ + switch (qFpClassify(t1)) + { + case FP_INFINITE: + return (t1 < 0) == (t2 < 0) && qFpClassify(t2) == FP_INFINITE; + case FP_NAN: + return qFpClassify(t2) == FP_NAN; + default: + return qFuzzyCompare(t1, t2); + } +} + /*! \fn bool QTest::qCompare(const qfloat16 &t1, const qfloat16 &t2, const char *actual, const char *expected, const char *file, int line) \internal */ @@ -2535,16 +2549,8 @@ bool QTest::qCompare(qfloat16 const &t1, qfloat16 const &t2, const char *actual, bool QTest::qCompare(float const &t1, float const &t2, const char *actual, const char *expected, const char *file, int line) { - bool equal = false; - int cl1 = std::fpclassify(t1); - int cl2 = std::fpclassify(t2); - if (cl1 == FP_INFINITE) - equal = ((t1 < 0) == (t2 < 0)) && cl2 == FP_INFINITE; - else if (cl1 == FP_NAN) - equal = (cl2 == FP_NAN); - else - equal = qFuzzyCompare(t1, t2); - return compare_helper(equal, "Compared floats are not the same (fuzzy compare)", + return compare_helper(floatingCompare(t1, t2), + "Compared floats are not the same (fuzzy compare)", toString(t1), toString(t2), actual, expected, file, line); } @@ -2554,16 +2560,8 @@ bool QTest::qCompare(float const &t1, float const &t2, const char *actual, const bool QTest::qCompare(double const &t1, double const &t2, const char *actual, const char *expected, const char *file, int line) { - bool equal = false; - int cl1 = std::fpclassify(t1); - int cl2 = std::fpclassify(t2); - if (cl1 == FP_INFINITE) - equal = ((t1 < 0) == (t2 < 0)) && cl2 == FP_INFINITE; - else if (cl1 == FP_NAN) - equal = (cl2 == FP_NAN); - else - equal = qFuzzyCompare(t1, t2); - return compare_helper(equal, "Compared doubles are not the same (fuzzy compare)", + return compare_helper(floatingCompare(t1, t2), + "Compared doubles are not the same (fuzzy compare)", toString(t1), toString(t2), actual, expected, file, line); } @@ -2633,7 +2631,7 @@ static void massageExponent(char *text) template <> Q_TESTLIB_EXPORT char *QTest::toString<TYPE>(const TYPE &t) \ { \ char *msg = new char[128]; \ - switch (std::fpclassify(t)) { \ + switch (qFpClassify(t)) { \ case FP_INFINITE: \ qstrncpy(msg, (t < 0 ? "-inf" : "inf"), 128); \ break; \ @@ -2641,7 +2639,7 @@ template <> Q_TESTLIB_EXPORT char *QTest::toString<TYPE>(const TYPE &t) \ qstrncpy(msg, "nan", 128); \ break; \ default: \ - qsnprintf(msg, 128, #FORMAT, t); \ + qsnprintf(msg, 128, #FORMAT, double(t)); \ massageExponent(msg); \ break; \ } \ @@ -2649,7 +2647,7 @@ template <> Q_TESTLIB_EXPORT char *QTest::toString<TYPE>(const TYPE &t) \ } TO_STRING_FLOAT(float, %g) -TO_STRING_FLOAT(double, %.12lg) +TO_STRING_FLOAT(double, %.12g) template <> Q_TESTLIB_EXPORT char *QTest::toString<qfloat16>(const qfloat16 &t) { diff --git a/src/testlib/qtestcoreelement_p.h b/src/testlib/qtestcoreelement_p.h index e79efdd87f..84406fed85 100644 --- a/src/testlib/qtestcoreelement_p.h +++ b/src/testlib/qtestcoreelement_p.h @@ -80,7 +80,7 @@ class QTestCoreElement: public QTestCoreList<ElementType> template<class ElementType> QTestCoreElement<ElementType>::QTestCoreElement(int t) - :listOfAttributes(0), type(QTest::LogElementType(t)) + :listOfAttributes(nullptr), type(QTest::LogElementType(t)) { } @@ -114,7 +114,7 @@ const char *QTestCoreElement<ElementType>::attributeValue(QTest::AttributeIndex if (attrb) return attrb->value(); - return 0; + return nullptr; } template <class ElementType> @@ -124,7 +124,7 @@ const char *QTestCoreElement<ElementType>::attributeName(QTest::AttributeIndex i if (attrb) return attrb->name(); - return 0; + return nullptr; } template <class ElementType> @@ -145,7 +145,7 @@ const char *QTestCoreElement<ElementType>::elementName() const if (type != QTest::LET_Undefined) return xmlElementNames[type]; - return 0; + return nullptr; } template <class ElementType> @@ -165,7 +165,7 @@ const QTestElementAttribute *QTestCoreElement<ElementType>::attribute(QTest::Att iterator = iterator->nextElement(); } - return 0; + return nullptr; } QT_END_NAMESPACE diff --git a/src/testlib/qtestcorelist_p.h b/src/testlib/qtestcorelist_p.h index 4d080f6758..daeb293644 100644 --- a/src/testlib/qtestcorelist_p.h +++ b/src/testlib/qtestcorelist_p.h @@ -73,8 +73,8 @@ class QTestCoreList template <class T> QTestCoreList<T>::QTestCoreList() - : next(0) - , prev(0) + : next(nullptr) + , prev(nullptr) { } @@ -82,12 +82,12 @@ template <class T> QTestCoreList<T>::~QTestCoreList() { if (prev) { - prev->next = 0; + prev->next = nullptr; } delete prev; if (next) { - next->prev = 0; + next->prev = nullptr; } delete next; } diff --git a/src/testlib/qxmltestlogger_p.h b/src/testlib/qxmltestlogger_p.h index b85742f939..04ed57d587 100644 --- a/src/testlib/qxmltestlogger_p.h +++ b/src/testlib/qxmltestlogger_p.h @@ -71,11 +71,11 @@ public: void leaveTestFunction() override; void addIncident(IncidentTypes type, const char *description, - const char *file = 0, int line = 0) override; + const char *file = nullptr, int line = 0) override; void addBenchmarkResult(const QBenchmarkResult &result) override; void addMessage(MessageTypes type, const QString &message, - const char *file = 0, int line = 0) override; + const char *file = nullptr, int line = 0) override; static int xmlCdata(QTestCharBuffer *dest, char const* src); static int xmlQuote(QTestCharBuffer *dest, char const* src); diff --git a/src/testlib/qxunittestlogger_p.h b/src/testlib/qxunittestlogger_p.h index 8fb01fbe61..48f07ddcf2 100644 --- a/src/testlib/qxunittestlogger_p.h +++ b/src/testlib/qxunittestlogger_p.h @@ -71,12 +71,12 @@ class QXunitTestLogger : public QAbstractTestLogger void leaveTestFunction() override; void addIncident(IncidentTypes type, const char *description, - const char *file = 0, int line = 0) override; + const char *file = nullptr, int line = 0) override; void addBenchmarkResult(const QBenchmarkResult &result) override; void addTag(QTestElement* element); void addMessage(MessageTypes type, const QString &message, - const char *file = 0, int line = 0) override; + const char *file = nullptr, int line = 0) override; private: QTestElement *listOfTestcases; diff --git a/src/tools/bootstrap/bootstrap.pro b/src/tools/bootstrap/bootstrap.pro index 83e44ff9a4..1662e99674 100644 --- a/src/tools/bootstrap/bootstrap.pro +++ b/src/tools/bootstrap/bootstrap.pro @@ -19,8 +19,6 @@ DEFINES += \ QT_NO_FOREACH \ QT_NO_CAST_FROM_ASCII -DEFINES -= QT_EVAL - SOURCES += \ ../../corelib/codecs/qlatincodec.cpp \ ../../corelib/codecs/qtextcodec.cpp \ @@ -93,6 +91,7 @@ SOURCES += \ ../../corelib/tools/qstringbuilder.cpp \ ../../corelib/tools/qstring_compat.cpp \ ../../corelib/tools/qstringlist.cpp \ + ../../corelib/tools/qstringview.cpp \ ../../corelib/tools/qversionnumber.cpp \ ../../corelib/tools/qvsnprintf.cpp \ ../../xml/dom/qdom.cpp \ diff --git a/src/tools/moc/generator.h b/src/tools/moc/generator.h index 134166580b..eae0353199 100644 --- a/src/tools/moc/generator.h +++ b/src/tools/moc/generator.h @@ -39,7 +39,7 @@ class Generator ClassDef *cdef; QVector<uint> meta_data; public: - Generator(ClassDef *classDef, const QVector<QByteArray> &metaTypes, const QHash<QByteArray, QByteArray> &knownQObjectClasses, const QHash<QByteArray, QByteArray> &knownGadgets, FILE *outfile = 0); + Generator(ClassDef *classDef, const QVector<QByteArray> &metaTypes, const QHash<QByteArray, QByteArray> &knownQObjectClasses, const QHash<QByteArray, QByteArray> &knownGadgets, FILE *outfile = nullptr); void generateCode(); private: bool registerableMetaType(const QByteArray &propertyType); diff --git a/src/tools/moc/moc.cpp b/src/tools/moc/moc.cpp index 5d777ece2e..2f52dd6ca0 100644 --- a/src/tools/moc/moc.cpp +++ b/src/tools/moc/moc.cpp @@ -159,6 +159,7 @@ Type Moc::parseType() bool isVoid = false; type.firstToken = lookup(); for (;;) { + skipCxxAttributes(); switch (next()) { case SIGNED: case UNSIGNED: @@ -188,8 +189,11 @@ Type Moc::parseType() } break; } + + skipCxxAttributes(); test(ENUM) || test(CLASS) || test(STRUCT); for(;;) { + skipCxxAttributes(); switch (next()) { case IDENTIFIER: // void mySlot(unsigned myArg) @@ -281,6 +285,7 @@ bool Moc::parseEnum(EnumDef *def) break; next(IDENTIFIER); def->values += lexem(); + skipCxxAttributes(); } while (test(EQ) ? until(COMMA) : test(COMMA)); next(RBRACE); if (isTypdefEnum) { @@ -356,6 +361,15 @@ bool Moc::testFunctionAttribute(Token tok, FunctionDef *def) return false; } +bool Moc::skipCxxAttributes() +{ + auto rewind = index; + if (test(LBRACK) && test(LBRACK) && until(RBRACK) && test(RBRACK)) + return true; + index = rewind; + return false; +} + bool Moc::testFunctionRevision(FunctionDef *def) { if (test(Q_REVISION_TOKEN)) { @@ -381,7 +395,7 @@ bool Moc::parseFunction(FunctionDef *def, bool inMacro) //skip modifiers and attributes while (test(INLINE) || (test(STATIC) && (def->isStatic = true) == true) || (test(VIRTUAL) && (def->isVirtual = true) == true) //mark as virtual - || testFunctionAttribute(def) || testFunctionRevision(def)) {} + || skipCxxAttributes() || testFunctionAttribute(def) || testFunctionRevision(def)) {} bool templateFunction = (lookup() == TEMPLATE); def->type = parseType(); if (def->type.name.isEmpty()) { @@ -454,10 +468,11 @@ bool Moc::parseFunction(FunctionDef *def, bool inMacro) until(RBRACE); else if ((def->isAbstract = test(EQ))) until(SEMIC); + else if (skipCxxAttributes()) + until(SEMIC); else error(); } - if (scopedFunctionName) { const QByteArray msg = "Function declaration " + def->name + " contains extra qualification. Ignoring as signal or slot."; @@ -475,7 +490,7 @@ bool Moc::parseMaybeFunction(const ClassDef *cdef, FunctionDef *def) //skip modifiers and attributes while (test(EXPLICIT) || test(INLINE) || (test(STATIC) && (def->isStatic = true) == true) || (test(VIRTUAL) && (def->isVirtual = true) == true) //mark as virtual - || testFunctionAttribute(def) || testFunctionRevision(def)) {} + || skipCxxAttributes() || testFunctionAttribute(def) || testFunctionRevision(def)) {} bool tilde = test(TILDE); def->type = parseType(); if (def->type.name.isEmpty()) @@ -565,6 +580,7 @@ void Moc::parse() } else if (!test(SEMIC)) { NamespaceDef def; def.classname = nsName; + def.doGenerate = currentFilenames.size() <= 1; next(LBRACE); def.begin = index - 1; @@ -572,25 +588,22 @@ void Moc::parse() def.end = index; index = def.begin + 1; - const bool parseNamespace = currentFilenames.size() <= 1; - if (parseNamespace) { - for (int i = namespaceList.size() - 1; i >= 0; --i) { - if (inNamespace(&namespaceList.at(i))) { - def.qualified.prepend(namespaceList.at(i).classname + "::"); - } - } - for (const QByteArray &ns : nested) { - NamespaceDef parentNs; - parentNs.classname = ns; - parentNs.qualified = def.qualified; - def.qualified += ns + "::"; - parentNs.begin = def.begin; - parentNs.end = def.end; - namespaceList += parentNs; + for (int i = namespaceList.size() - 1; i >= 0; --i) { + if (inNamespace(&namespaceList.at(i))) { + def.qualified.prepend(namespaceList.at(i).classname + "::"); } } + for (const QByteArray &ns : nested) { + NamespaceDef parentNs; + parentNs.classname = ns; + parentNs.qualified = def.qualified; + def.qualified += ns + "::"; + parentNs.begin = def.begin; + parentNs.end = def.end; + namespaceList += parentNs; + } - while (parseNamespace && inNamespace(&def) && hasNext()) { + while (inNamespace(&def) && hasNext()) { switch (next()) { case NAMESPACE: if (test(IDENTIFIER)) { @@ -915,7 +928,8 @@ void Moc::parse() } else { knownGadgets.insert(def.classname, def.qualified); knownGadgets.insert(def.qualified, def.qualified); - classList += def; + if (n.doGenerate) + classList += def; } } } diff --git a/src/tools/moc/moc.h b/src/tools/moc/moc.h index d6482f4e44..2bba8a5bb9 100644 --- a/src/tools/moc/moc.h +++ b/src/tools/moc/moc.h @@ -188,6 +188,7 @@ Q_DECLARE_TYPEINFO(ClassDef::Interface, Q_MOVABLE_TYPE); struct NamespaceDef : BaseDef { bool hasQNamespace = false; + bool doGenerate = false; }; Q_DECLARE_TYPEINFO(NamespaceDef, Q_MOVABLE_TYPE); @@ -256,6 +257,8 @@ public: bool testFunctionAttribute(Token tok, FunctionDef *def); bool testFunctionRevision(FunctionDef *def); + bool skipCxxAttributes(); + void checkSuperClasses(ClassDef *def); void checkProperties(ClassDef* cdef); }; diff --git a/src/tools/moc/parser.h b/src/tools/moc/parser.h index bedcbbf7e2..63f4cf0d9a 100644 --- a/src/tools/moc/parser.h +++ b/src/tools/moc/parser.h @@ -69,9 +69,9 @@ public: inline const Symbol &symbol() { return symbols.at(index-1);} Q_NORETURN void error(int rollback); - Q_NORETURN void error(const char *msg = 0); - void warning(const char * = 0); - void note(const char * = 0); + Q_NORETURN void error(const char *msg = nullptr); + void warning(const char * = nullptr); + void note(const char * = nullptr); }; diff --git a/src/tools/qvkgen/qvkgen.cpp b/src/tools/qvkgen/qvkgen.cpp index 059f9413cb..4db3f26161 100644 --- a/src/tools/qvkgen/qvkgen.cpp +++ b/src/tools/qvkgen/qvkgen.cpp @@ -192,22 +192,20 @@ QString VkSpecParser::parseName() QString funcSig(const VkSpecParser::Command &c, const char *className = nullptr) { - QString s; - s.sprintf("%s %s%s%s", qPrintable(c.cmd.type), - (className ? className : ""), (className ? "::" : ""), - qPrintable(c.cmd.name)); + QString s(QString::asprintf("%s %s%s%s", qPrintable(c.cmd.type), + (className ? className : ""), (className ? "::" : ""), + qPrintable(c.cmd.name))); if (!c.args.isEmpty()) { s += QLatin1Char('('); bool first = true; for (const VkSpecParser::TypedName &a : c.args) { - QString argStr; - argStr.sprintf("%s%s%s%s", qPrintable(a.type), (a.type.endsWith(QLatin1Char('*')) ? "" : " "), - qPrintable(a.name), qPrintable(a.typeSuffix)); if (!first) s += QStringLiteral(", "); else first = false; - s += argStr; + s += QString::asprintf("%s%s%s%s", qPrintable(a.type), + (a.type.endsWith(QLatin1Char('*')) ? "" : " "), + qPrintable(a.name), qPrintable(a.typeSuffix)); } s += QLatin1Char(')'); } @@ -216,13 +214,12 @@ QString funcSig(const VkSpecParser::Command &c, const char *className = nullptr) QString funcCall(const VkSpecParser::Command &c, int idx) { - QString s; // template: // [return] reinterpret_cast<PFN_vkEnumeratePhysicalDevices>(d_ptr->m_funcs[0])(instance, pPhysicalDeviceCount, pPhysicalDevices); - s.sprintf("%sreinterpret_cast<PFN_%s>(d_ptr->m_funcs[%d])", - (c.cmd.type == QStringLiteral("void") ? "" : "return "), - qPrintable(c.cmd.name), - idx); + QString s = QString::asprintf("%sreinterpret_cast<PFN_%s>(d_ptr->m_funcs[%d])", + (c.cmd.type == QStringLiteral("void") ? "" : "return "), + qPrintable(c.cmd.name), + idx); if (!c.args.isEmpty()) { s += QLatin1Char('('); bool first = true; @@ -338,10 +335,9 @@ bool genVulkanFunctionsH(const QVector<VkSpecParser::Command> &commands, const Q *dst += QStringLiteral(";\n"); } - QString str; - str.sprintf(s, preamble.get(licHeaderFn).constData(), instCmdStr.toUtf8().constData(), devCmdStr.toUtf8().constData()); - - f.write(str.toUtf8()); + f.write(QString::asprintf(s, preamble.get(licHeaderFn).constData(), + instCmdStr.toUtf8().constData(), + devCmdStr.toUtf8().constData()).toUtf8()); return true; } @@ -400,10 +396,7 @@ bool genVulkanFunctionsPH(const QVector<VkSpecParser::Command> &commands, const [](const VkSpecParser::Command &c) { return c.deviceLevel; }); const int instLevelCount = commands.count() - devLevelCount; - QString str; - str.sprintf(s, preamble.get(licHeaderFn).constData(), instLevelCount, devLevelCount); - - f.write(str.toUtf8()); + f.write(QString::asprintf(s, preamble.get(licHeaderFn).constData(), instLevelCount, devLevelCount).toUtf8()); return true; } @@ -478,10 +471,12 @@ bool genVulkanFunctionsPC(const QVector<VkSpecParser::Command> &commands, const if (instCmdNamesStr.count() > 2) instCmdNamesStr = instCmdNamesStr.left(instCmdNamesStr.count() - 2); - QString str; - str.sprintf(s, preamble.get(licHeaderFn).constData(), - instCmdWrapperStr.toUtf8().constData(), instCmdNamesStr.toUtf8().constData(), instIdx, - devCmdWrapperStr.toUtf8().constData(), devCmdNamesStr.toUtf8().constData(), commands.count() - instIdx); + const QString str = + QString::asprintf(s, preamble.get(licHeaderFn).constData(), + instCmdWrapperStr.toUtf8().constData(), + instCmdNamesStr.toUtf8().constData(), instIdx, + devCmdWrapperStr.toUtf8().constData(), + devCmdNamesStr.toUtf8().constData(), commands.count() - instIdx); f.write(str.toUtf8()); diff --git a/src/tools/rcc/main.cpp b/src/tools/rcc/main.cpp index 6e8c13be15..0eb6766b5a 100644 --- a/src/tools/rcc/main.cpp +++ b/src/tools/rcc/main.cpp @@ -155,6 +155,11 @@ int runRcc(int argc, char *argv[]) QCommandLineOption binaryOption(QStringLiteral("binary"), QStringLiteral("Output a binary file for use as a dynamic resource.")); parser.addOption(binaryOption); + QCommandLineOption generatorOption(QStringList{QStringLiteral("g"), QStringLiteral("generator")}); + generatorOption.setDescription(QStringLiteral("Select generator.")); + generatorOption.setValueName(QStringLiteral("cpp|python|python2")); + parser.addOption(generatorOption); + QCommandLineOption passOption(QStringLiteral("pass"), QStringLiteral("Pass number for big resources"), QStringLiteral("number")); parser.addOption(passOption); @@ -220,6 +225,18 @@ int runRcc(int argc, char *argv[]) library.setCompressThreshold(parser.value(thresholdOption).toInt()); if (parser.isSet(binaryOption)) library.setFormat(RCCResourceLibrary::Binary); + if (parser.isSet(generatorOption)) { + auto value = parser.value(generatorOption); + if (value == QLatin1String("cpp")) + library.setFormat(RCCResourceLibrary::C_Code); + else if (value == QLatin1String("python")) + library.setFormat(RCCResourceLibrary::Python3_Code); + else if (value == QLatin1String("python2")) + library.setFormat(RCCResourceLibrary::Python2_Code); + else + errorMsg = QLatin1String("Invalid generator: ") + value; + } + if (parser.isSet(passOption)) { if (parser.value(passOption) == QLatin1String("1")) library.setFormat(RCCResourceLibrary::Pass1); @@ -280,6 +297,8 @@ int runRcc(int argc, char *argv[]) switch (library.format()) { case RCCResourceLibrary::C_Code: case RCCResourceLibrary::Pass1: + case RCCResourceLibrary::Python3_Code: + case RCCResourceLibrary::Python2_Code: mode = QIODevice::WriteOnly | QIODevice::Text; break; case RCCResourceLibrary::Pass2: diff --git a/src/tools/rcc/rcc.cpp b/src/tools/rcc/rcc.cpp index 862e574f2d..bb4e6e3615 100644 --- a/src/tools/rcc/rcc.cpp +++ b/src/tools/rcc/rcc.cpp @@ -176,6 +176,8 @@ void RCCFileInfo::writeDataInfo(RCCResourceLibrary &lib) { const bool text = lib.m_format == RCCResourceLibrary::C_Code; const bool pass1 = lib.m_format == RCCResourceLibrary::Pass1; + const bool python = lib.m_format == RCCResourceLibrary::Python3_Code + || lib.m_format == RCCResourceLibrary::Python2_Code; //some info if (text || pass1) { if (m_language != QLocale::C) { @@ -222,6 +224,8 @@ void RCCFileInfo::writeDataInfo(RCCResourceLibrary &lib) } if (text || pass1) lib.writeChar('\n'); + else if (python) + lib.writeString("\\\n"); if (lib.formatVersion() >= 2) { // last modified time stamp @@ -236,6 +240,8 @@ void RCCFileInfo::writeDataInfo(RCCResourceLibrary &lib) lib.writeNumber8(lastmod); if (text || pass1) lib.writeChar('\n'); + else if (python) + lib.writeString("\\\n"); } } @@ -246,6 +252,8 @@ qint64 RCCFileInfo::writeDataBlob(RCCResourceLibrary &lib, qint64 offset, const bool pass1 = lib.m_format == RCCResourceLibrary::Pass1; const bool pass2 = lib.m_format == RCCResourceLibrary::Pass2; const bool binary = lib.m_format == RCCResourceLibrary::Binary; + const bool python = lib.m_format == RCCResourceLibrary::Python3_Code + || lib.m_format == RCCResourceLibrary::Python2_Code; //capture the offset m_dataOffset = offset; @@ -343,20 +351,24 @@ qint64 RCCFileInfo::writeDataBlob(RCCResourceLibrary &lib, qint64 offset, } // write the length - - if (text || binary || pass2) + if (text || binary || pass2 || python) lib.writeNumber4(data.size()); if (text || pass1) lib.writeString("\n "); + else if (python) + lib.writeString("\\\n"); offset += 4; // write the payload const char *p = data.constData(); - if (text) { + if (text || python) { for (int i = data.size(), j = 0; --i >= 0; --j) { lib.writeHex(*p++); if (j == 0) { - lib.writeString("\n "); + if (text) + lib.writeString("\n "); + else + lib.writeString("\\\n"); j = 16; } } @@ -368,6 +380,9 @@ qint64 RCCFileInfo::writeDataBlob(RCCResourceLibrary &lib, qint64 offset, // done if (text || pass1) lib.writeString("\n "); + else if (python) + lib.writeString("\\\n"); + return offset; } @@ -375,6 +390,8 @@ qint64 RCCFileInfo::writeDataName(RCCResourceLibrary &lib, qint64 offset) { const bool text = lib.m_format == RCCResourceLibrary::C_Code; const bool pass1 = lib.m_format == RCCResourceLibrary::Pass1; + const bool python = lib.m_format == RCCResourceLibrary::Python3_Code + || lib.m_format == RCCResourceLibrary::Python2_Code; // capture the offset m_nameOffset = offset; @@ -390,12 +407,16 @@ qint64 RCCFileInfo::writeDataName(RCCResourceLibrary &lib, qint64 offset) lib.writeNumber2(m_name.length()); if (text || pass1) lib.writeString("\n "); + else if (python) + lib.writeString("\\\n"); offset += 2; // write the hash lib.writeNumber4(qt_hash(m_name)); if (text || pass1) lib.writeString("\n "); + else if (python) + lib.writeString("\\\n"); offset += 4; // write the m_name @@ -404,12 +425,17 @@ qint64 RCCFileInfo::writeDataName(RCCResourceLibrary &lib, qint64 offset) lib.writeNumber2(unicode[i].unicode()); if ((text || pass1) && i % 16 == 0) lib.writeString("\n "); + else if (python && i % 16 == 0) + lib.writeString("\\\n"); } offset += m_name.length()*2; // done if (text || pass1) lib.writeString("\n "); + else if (python) + lib.writeString("\\\n"); + return offset; } @@ -959,18 +985,37 @@ void RCCResourceLibrary::writeDecimal(int value) write(buf, n + 1); // write() takes a size including terminating NUL } +static const char hexDigits[] = "0123456789abcdef"; + +inline void RCCResourceLibrary::write2HexDigits(quint8 number) +{ + writeChar(hexDigits[number >> 4]); + writeChar(hexDigits[number & 0xf]); +} + void RCCResourceLibrary::writeHex(quint8 tmp) { - const char digits[] = "0123456789abcdef"; - writeChar('0'); - writeChar('x'); - if (tmp < 16) { - writeChar(digits[tmp]); - } else { - writeChar(digits[tmp >> 4]); - writeChar(digits[tmp & 0xf]); + switch (m_format) { + case RCCResourceLibrary::Python3_Code: + case RCCResourceLibrary::Python2_Code: + if (tmp >= 32 && tmp < 127 && tmp != '"' && tmp != '\\') { + writeChar(char(tmp)); + } else { + writeChar('\\'); + writeChar('x'); + write2HexDigits(tmp); + } + break; + default: + writeChar('0'); + writeChar('x'); + if (tmp < 16) + writeChar(hexDigits[tmp]); + else + write2HexDigits(tmp); + writeChar(','); + break; } - writeChar(','); } void RCCResourceLibrary::writeNumber2(quint16 number) @@ -1038,7 +1083,9 @@ void RCCResourceLibrary::writeNumber8(quint64 number) bool RCCResourceLibrary::writeHeader() { - if (m_format == C_Code || m_format == Pass1) { + switch (m_format) { + case C_Code: + case Pass1: writeString("/****************************************************************************\n"); writeString("** Resource object code\n"); writeString("**\n"); @@ -1047,7 +1094,20 @@ bool RCCResourceLibrary::writeHeader() writeString("\n**\n"); writeString("** WARNING! All changes made in this file will be lost!\n"); writeString( "*****************************************************************************/\n\n"); - } else if (m_format == Binary) { + break; + case Python3_Code: + case Python2_Code: + writeString("# Resource object code (Python "); + writeChar(m_format == Python3_Code ? '3' : '2'); + writeString(")\n"); + writeString("# Created by: object code\n"); + writeString("# Created by: The Resource Compiler for Qt version "); + writeByteArray(QT_VERSION_STR); + writeString("\n"); + writeString("# WARNING! All changes made in this file will be lost!\n\n"); + writeString("from PySide2 import QtCore\n\n"); + break; + case Binary: writeString("qres"); writeNumber4(0); writeNumber4(0); @@ -1055,6 +1115,9 @@ bool RCCResourceLibrary::writeHeader() writeNumber4(0); if (m_formatVersion >= 3) writeNumber4(m_overallFlags); + break; + default: + break; } return true; } @@ -1062,10 +1125,21 @@ bool RCCResourceLibrary::writeHeader() bool RCCResourceLibrary::writeDataBlobs() { Q_ASSERT(m_errorDevice); - if (m_format == C_Code) { + switch (m_format) { + case C_Code: writeString("static const unsigned char qt_resource_data[] = {\n"); - } else if (m_format == Binary) { + break; + case Python3_Code: + writeString("qt_resource_data = b\"\\\n"); + break; + case Python2_Code: + writeString("qt_resource_data = \"\\\n"); + break; + case Binary: m_dataOffset = m_out.size(); + break; + default: + break; } if (!m_root) @@ -1091,24 +1165,46 @@ bool RCCResourceLibrary::writeDataBlobs() } } } - if (m_format == C_Code) + switch (m_format) { + case C_Code: writeString("\n};\n\n"); - else if (m_format == Pass1) { + break; + case Python3_Code: + case Python2_Code: + writeString("\"\n\n"); + break; + case Pass1: if (offset < 8) offset = 8; writeString("\nstatic const unsigned char qt_resource_data["); writeByteArray(QByteArray::number(offset)); writeString("] = { 'Q', 'R', 'C', '_', 'D', 'A', 'T', 'A' };\n\n"); + break; + default: + break; } return true; } bool RCCResourceLibrary::writeDataNames() { - if (m_format == C_Code || m_format == Pass1) + switch (m_format) { + case C_Code: + case Pass1: writeString("static const unsigned char qt_resource_name[] = {\n"); - else if (m_format == Binary) + break; + case Python3_Code: + writeString("qt_resource_name = b\"\\\n"); + break; + case Python2_Code: + writeString("qt_resource_name = \"\\\n"); + break; + case Binary: m_namesOffset = m_out.size(); + break; + default: + break; + } QHash<QString, int> names; QStack<RCCFileInfo*> pending; @@ -1133,8 +1229,18 @@ bool RCCResourceLibrary::writeDataNames() } } } - if (m_format == C_Code || m_format == Pass1) + switch (m_format) { + case C_Code: + case Pass1: writeString("\n};\n\n"); + break; + case Python3_Code: + case Python2_Code: + writeString("\"\n\n"); + break; + default: + break; + } return true; } @@ -1149,10 +1255,24 @@ struct qt_rcc_compare_hash bool RCCResourceLibrary::writeDataStructure() { - if (m_format == C_Code || m_format == Pass1) + switch (m_format) { + case C_Code: + case Pass1: writeString("static const unsigned char qt_resource_struct[] = {\n"); - else if (m_format == Binary) + break; + case Python3_Code: + writeString("qt_resource_struct = b\"\\\n"); + break; + case Python2_Code: + writeString("qt_resource_struct = \"\\\n"); + break; + case Binary: m_treeOffset = m_out.size(); + break; + default: + break; + } + QStack<RCCFileInfo*> pending; if (!m_root) @@ -1196,8 +1316,18 @@ bool RCCResourceLibrary::writeDataStructure() pending.push(child); } } - if (m_format == C_Code || m_format == Pass1) + switch (m_format) { + case C_Code: + case Pass1: writeString("\n};\n\n"); + break; + case Python3_Code: + case Python2_Code: + writeString("\"\n\n"); + break; + default: + break; + } return true; } @@ -1387,6 +1517,16 @@ bool RCCResourceLibrary::writeInitializer() p[i++] = (m_overallFlags >> 8) & 0xff; p[i++] = (m_overallFlags >> 0) & 0xff; } + } else if (m_format == Python3_Code || m_format == Python2_Code) { + writeString("def qInitResources():\n"); + writeString(" QtCore.qRegisterResourceData(0x"); + write2HexDigits(m_formatVersion); + writeString(", qt_resource_struct, qt_resource_name, qt_resource_data)\n\n"); + writeString("def qCleanupResources():\n"); + writeString(" QtCore.qUnregisterResourceData(0x"); + write2HexDigits(m_formatVersion); + writeString(", qt_resource_struct, qt_resource_name, qt_resource_data)\n\n"); + writeString("qInitResources()\n"); } return true; } diff --git a/src/tools/rcc/rcc.h b/src/tools/rcc/rcc.h index ad1c5cd166..b301355e4f 100644 --- a/src/tools/rcc/rcc.h +++ b/src/tools/rcc/rcc.h @@ -58,7 +58,7 @@ public: bool readFiles(bool listMode, QIODevice &errorDevice); - enum Format { Binary, C_Code, Pass1, Pass2 }; + enum Format { Binary, C_Code, Pass1, Pass2, Python3_Code, Python2_Code }; void setFormat(Format f) { m_format = f; } Format format() const { return m_format; } @@ -136,6 +136,7 @@ private: void writeAddNamespaceFunction(const QByteArray &name); void writeDecimal(int value); void writeHex(quint8 number); + void write2HexDigits(quint8 number); void writeNumber2(quint16 number); void writeNumber4(quint32 number); void writeNumber8(quint64 number); diff --git a/src/tools/uic/driver.h b/src/tools/uic/driver.h index 1303d0bf8a..69206e1608 100644 --- a/src/tools/uic/driver.h +++ b/src/tools/uic/driver.h @@ -56,8 +56,8 @@ public: // tools bool printDependencies(const QString &fileName); - bool uic(const QString &fileName, QTextStream *output = 0); - bool uic(const QString &fileName, DomUI *ui, QTextStream *output = 0); + bool uic(const QString &fileName, QTextStream *output = nullptr); + bool uic(const QString &fileName, DomUI *ui, QTextStream *output = nullptr); // configuration inline QTextStream &output() const { return *m_output; } diff --git a/src/widgets/dialogs/qdialog.cpp b/src/widgets/dialogs/qdialog.cpp index caab6c16ba..5692a16bce 100644 --- a/src/widgets/dialogs/qdialog.cpp +++ b/src/widgets/dialogs/qdialog.cpp @@ -270,12 +270,11 @@ void QDialogPrivate::deletePlatformHelper() The most common way to display a modal dialog is to call its exec() function. When the user closes the dialog, exec() will - provide a useful \l{#return}{return value}. Typically, - to get the dialog to close and return the appropriate value, we - connect a default button, e.g. \uicontrol OK, to the accept() slot and a - \uicontrol Cancel button to the reject() slot. - Alternatively you can call the done() slot with \c Accepted or - \c Rejected. + provide a useful \l{#return}{return value}. To close the dialog + and return the appropriate value, you must connect a default button, + e.g. an \uicontrol OK button to the accept() slot and a + \uicontrol Cancel button to the reject() slot. Alternatively, you + can call the done() slot with \c Accepted or \c Rejected. An alternative is to call setModal(true) or setWindowModality(), then show(). Unlike exec(), show() returns control to the caller diff --git a/src/widgets/dialogs/qdialog_p.h b/src/widgets/dialogs/qdialog_p.h index 92634f6793..77f9fae09a 100644 --- a/src/widgets/dialogs/qdialog_p.h +++ b/src/widgets/dialogs/qdialog_p.h @@ -75,15 +75,15 @@ public: QDialogPrivate() : #if QT_CONFIG(pushbutton) - mainDef(0), + mainDef(nullptr), #endif - orientation(Qt::Horizontal),extension(0), doShowExtension(false), + orientation(Qt::Horizontal),extension(nullptr), doShowExtension(false), #if QT_CONFIG(sizegrip) - resizer(0), + resizer(nullptr), sizeGripEnabled(false), #endif - rescode(0), resetModalityTo(-1), wasModalitySet(true), eventLoop(0), - nativeDialogInUse(false), m_platformHelper(0), m_platformHelperCreated(false) + rescode(0), resetModalityTo(-1), wasModalitySet(true), eventLoop(nullptr), + nativeDialogInUse(false), m_platformHelper(nullptr), m_platformHelperCreated(false) {} ~QDialogPrivate(); diff --git a/src/widgets/dialogs/qfiledialog_p.h b/src/widgets/dialogs/qfiledialog_p.h index 463c77aa23..7e53b61031 100644 --- a/src/widgets/dialogs/qfiledialog_p.h +++ b/src/widgets/dialogs/qfiledialog_p.h @@ -98,7 +98,7 @@ class QPlatformDialogHelper; struct QFileDialogArgs { - QFileDialogArgs() : parent(0), mode(QFileDialog::AnyFile) {} + QFileDialogArgs() : parent(nullptr), mode(QFileDialog::AnyFile) {} QWidget *parent; QString caption; @@ -292,7 +292,7 @@ private: class QFileDialogLineEdit : public QLineEdit { public: - QFileDialogLineEdit(QWidget *parent = 0) : QLineEdit(parent), d_ptr(0){} + QFileDialogLineEdit(QWidget *parent = nullptr) : QLineEdit(parent), d_ptr(nullptr){} void setFileDialogPrivate(QFileDialogPrivate *d_pointer) {d_ptr = d_pointer; } void keyPressEvent(QKeyEvent *e) override; bool hideOnEsc; @@ -303,7 +303,7 @@ private: class QFileDialogComboBox : public QComboBox { public: - QFileDialogComboBox(QWidget *parent = 0) : QComboBox(parent), urlModel(0) {} + QFileDialogComboBox(QWidget *parent = nullptr) : QComboBox(parent), urlModel(nullptr) {} void setFileDialogPrivate(QFileDialogPrivate *d_pointer); void showPopup() override; void setHistory(const QStringList &paths); @@ -319,7 +319,7 @@ private: class QFileDialogListView : public QListView { public: - QFileDialogListView(QWidget *parent = 0); + QFileDialogListView(QWidget *parent = nullptr); void setFileDialogPrivate(QFileDialogPrivate *d_pointer); QSize sizeHint() const override; protected: diff --git a/src/widgets/dialogs/qfileinfogatherer_p.h b/src/widgets/dialogs/qfileinfogatherer_p.h index 134a14b7ce..795f60249f 100644 --- a/src/widgets/dialogs/qfileinfogatherer_p.h +++ b/src/widgets/dialogs/qfileinfogatherer_p.h @@ -166,7 +166,7 @@ Q_SIGNALS: void directoryLoaded(const QString &path); public: - explicit QFileInfoGatherer(QObject *parent = 0); + explicit QFileInfoGatherer(QObject *parent = nullptr); ~QFileInfoGatherer(); #if QT_CONFIG(filesystemwatcher) && defined(Q_OS_WIN) diff --git a/src/widgets/dialogs/qfilesystemmodel_p.h b/src/widgets/dialogs/qfilesystemmodel_p.h index 9c432e1ae6..d8f9f2b076 100644 --- a/src/widgets/dialogs/qfilesystemmodel_p.h +++ b/src/widgets/dialogs/qfilesystemmodel_p.h @@ -99,13 +99,13 @@ public: class QFileSystemNode { public: - explicit QFileSystemNode(const QString &filename = QString(), QFileSystemNode *p = 0) - : fileName(filename), populatedChildren(false), isVisible(false), dirtyChildrenIndex(-1), parent(p), info(0) {} + explicit QFileSystemNode(const QString &filename = QString(), QFileSystemNode *p = nullptr) + : fileName(filename), populatedChildren(false), isVisible(false), dirtyChildrenIndex(-1), parent(p), info(nullptr) {} ~QFileSystemNode() { qDeleteAll(children); delete info; - info = 0; - parent = 0; + info = nullptr; + parent = nullptr; } QString fileName; @@ -116,7 +116,7 @@ public: inline qint64 size() const { if (info && !info->isDir()) return info->size(); return 0; } inline QString type() const { if (info) return info->displayType; return QLatin1String(""); } inline QDateTime lastModified() const { if (info) return info->lastModified(); return QDateTime(); } - inline QFile::Permissions permissions() const { if (info) return info->permissions(); return 0; } + inline QFile::Permissions permissions() const { if (info) return info->permissions(); return nullptr; } inline bool isReadable() const { return ((permissions() & QFile::ReadUser) != 0); } inline bool isWritable() const { return ((permissions() & QFile::WriteUser) != 0); } inline bool isExecutable() const { return ((permissions() & QFile::ExeUser) != 0); } @@ -162,7 +162,7 @@ public: return info && (*info == fileInfo); } - inline bool hasInformation() const { return info != 0; } + inline bool hasInformation() const { return info != nullptr; } void populate(const QExtendedInformation &fileInfo) { if (!info) diff --git a/src/widgets/dialogs/qfscompleter_p.h b/src/widgets/dialogs/qfscompleter_p.h index 3b829d4a52..f5110a7622 100644 --- a/src/widgets/dialogs/qfscompleter_p.h +++ b/src/widgets/dialogs/qfscompleter_p.h @@ -64,8 +64,8 @@ QT_BEGIN_NAMESPACE */ class Q_WIDGETS_EXPORT QFSCompleter : public QCompleter { public: - explicit QFSCompleter(QFileSystemModel *model, QObject *parent = 0) - : QCompleter(model, parent), proxyModel(0), sourceModel(model) + explicit QFSCompleter(QFileSystemModel *model, QObject *parent = nullptr) + : QCompleter(model, parent), proxyModel(nullptr), sourceModel(model) { #if defined(Q_OS_WIN) setCaseSensitivity(Qt::CaseInsensitive); diff --git a/src/widgets/dialogs/qsidebar_p.h b/src/widgets/dialogs/qsidebar_p.h index 4a82f88878..6056f19452 100644 --- a/src/widgets/dialogs/qsidebar_p.h +++ b/src/widgets/dialogs/qsidebar_p.h @@ -67,7 +67,7 @@ class QFileSystemModel; class QSideBarDelegate : public QStyledItemDelegate { public: - QSideBarDelegate(QWidget *parent = 0) : QStyledItemDelegate(parent) {} + QSideBarDelegate(QWidget *parent = nullptr) : QStyledItemDelegate(parent) {} void initStyleOption(QStyleOptionViewItem *option, const QModelIndex &index) const override; }; @@ -82,7 +82,7 @@ public: EnabledRole = Qt::UserRole + 2 }; - QUrlModel(QObject *parent = 0); + QUrlModel(QObject *parent = nullptr); QStringList mimeTypes() const override; QMimeData *mimeData(const QModelIndexList &indexes) const override; @@ -127,7 +127,7 @@ Q_SIGNALS: void goToUrl(const QUrl &url); public: - QSidebar(QWidget *parent = 0); + QSidebar(QWidget *parent = nullptr); void setModelAndUrls(QFileSystemModel *model, const QList<QUrl> &newUrls); ~QSidebar(); diff --git a/src/widgets/dialogs/qwizard.cpp b/src/widgets/dialogs/qwizard.cpp index 88b187cd7f..c692a0f8db 100644 --- a/src/widgets/dialogs/qwizard.cpp +++ b/src/widgets/dialogs/qwizard.cpp @@ -3257,7 +3257,11 @@ void QWizard::paintEvent(QPaintEvent * event) /*! \reimp */ +# if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QWizard::nativeEvent(const QByteArray &eventType, void *message, qintptr *result) +# else bool QWizard::nativeEvent(const QByteArray &eventType, void *message, long *result) +# endif { #if QT_CONFIG(style_windowsvista) Q_D(QWizard); diff --git a/src/widgets/dialogs/qwizard.h b/src/widgets/dialogs/qwizard.h index 0dd837b197..ef71efa0cb 100644 --- a/src/widgets/dialogs/qwizard.h +++ b/src/widgets/dialogs/qwizard.h @@ -188,7 +188,11 @@ protected: void resizeEvent(QResizeEvent *event) override; void paintEvent(QPaintEvent *event) override; #if defined(Q_OS_WIN) || defined(Q_CLANG_QDOC) +# if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + bool nativeEvent(const QByteArray &eventType, void *message, qintptr *result) override; +# else bool nativeEvent(const QByteArray &eventType, void *message, long *result) override; +# endif #endif void done(int result) override; virtual void initializePage(int id); diff --git a/src/widgets/dialogs/qwizard_win.cpp b/src/widgets/dialogs/qwizard_win.cpp index aa9ad7f290..62738f732c 100644 --- a/src/widgets/dialogs/qwizard_win.cpp +++ b/src/widgets/dialogs/qwizard_win.cpp @@ -339,7 +339,11 @@ void QVistaHelper::setTitleBarIconAndCaptionVisible(bool visible) SetWindowThemeAttribute(handle, WTA_NONCLIENT, &opt, sizeof(WTA_OPTIONS)); } +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QVistaHelper::winEvent(MSG* msg, qintptr *result) +#else bool QVistaHelper::winEvent(MSG* msg, long* result) +#endif { switch (msg->message) { case WM_NCHITTEST: { @@ -401,7 +405,11 @@ void QVistaHelper::mouseEvent(QEvent *event) } } +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QVistaHelper::handleWinEvent(MSG *message, qintptr *result) +#else bool QVistaHelper::handleWinEvent(MSG *message, long *result) +#endif { if (message->message == WM_THEMECHANGED || message->message == WM_DWMCOMPOSITIONCHANGED) cachedVistaState = Dirty; @@ -509,7 +517,11 @@ bool QVistaHelper::eventFilter(QObject *obj, QEvent *event) if (event->type() == QEvent::MouseMove) { QMouseEvent *mouseEvent = static_cast<QMouseEvent*>(event); +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + qintptr result; +#else long result; +#endif MSG msg; msg.message = WM_NCHITTEST; msg.wParam = 0; @@ -523,7 +535,11 @@ bool QVistaHelper::eventFilter(QObject *obj, QEvent *event) QMouseEvent *mouseEvent = static_cast<QMouseEvent*>(event); if (mouseEvent->button() == Qt::LeftButton) { +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + qintptr result; +#else long result; +#endif MSG msg; msg.message = WM_NCHITTEST; msg.wParam = 0; @@ -538,7 +554,11 @@ bool QVistaHelper::eventFilter(QObject *obj, QEvent *event) QMouseEvent *mouseEvent = static_cast<QMouseEvent*>(event); if (mouseEvent->button() == Qt::LeftButton) { +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + qintptr result; +#else long result; +#endif MSG msg; msg.message = WM_NCHITTEST; msg.wParam = 0; diff --git a/src/widgets/dialogs/qwizard_win_p.h b/src/widgets/dialogs/qwizard_win_p.h index 02c5e52c2c..b3796e3f48 100644 --- a/src/widgets/dialogs/qwizard_win_p.h +++ b/src/widgets/dialogs/qwizard_win_p.h @@ -93,7 +93,11 @@ public: bool setDWMTitleBar(TitleBarChangeType type); void setTitleBarIconAndCaptionVisible(bool visible); void mouseEvent(QEvent *event); +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + bool handleWinEvent(MSG *message, qintptr *result); +#else bool handleWinEvent(MSG *message, long *result); +#endif void resizeEvent(QResizeEvent *event); void paintEvent(QPaintEvent *event); QVistaBackButton *backButton() const { return backButton_; } @@ -130,7 +134,11 @@ private: void drawTitleBar(QPainter *painter); void setMouseCursor(QPoint pos); void collapseTopFrameStrut(); +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + bool winEvent(MSG *message, qintptr *result); +#else bool winEvent(MSG *message, long *result); +#endif void mouseMoveEvent(QMouseEvent *event); void mousePressEvent(QMouseEvent *event); void mouseReleaseEvent(QMouseEvent *event); diff --git a/src/widgets/doc/snippets/timeline/main.cpp b/src/widgets/doc/snippets/timeline/main.cpp index 74aa749254..4dfa2400d0 100644 --- a/src/widgets/doc/snippets/timeline/main.cpp +++ b/src/widgets/doc/snippets/timeline/main.cpp @@ -48,7 +48,7 @@ ** ****************************************************************************/ -#include <QtGui> +#include <QtWidgets> #include <math.h> int main(int argv, char *args[]) @@ -68,7 +68,7 @@ int main(int argv, char *args[]) for (int i = 0; i < 200; ++i) animation->setPosAt(i / 200.0, QPointF(i, i)); - QGraphicsScene *scene = new QGraphicsScene(); + QGraphicsScene *scene = new QGraphicsScene; scene->setSceneRect(0, 0, 250, 250); scene->addItem(ball); diff --git a/src/widgets/effects/qgraphicseffect_p.h b/src/widgets/effects/qgraphicseffect_p.h index 2f3bd2f7fd..7e342a9f3c 100644 --- a/src/widgets/effects/qgraphicseffect_p.h +++ b/src/widgets/effects/qgraphicseffect_p.h @@ -80,11 +80,11 @@ public: QRectF boundingRect(Qt::CoordinateSystem coordinateSystem = Qt::LogicalCoordinates) const; QRect deviceRect() const; QPixmap pixmap(Qt::CoordinateSystem system = Qt::LogicalCoordinates, - QPoint *offset = 0, + QPoint *offset = nullptr, QGraphicsEffect::PixmapPadMode mode = QGraphicsEffect::PadToEffectiveBoundingRect) const; protected: - QGraphicsEffectSource(QGraphicsEffectSourcePrivate &dd, QObject *parent = 0); + QGraphicsEffectSource(QGraphicsEffectSourcePrivate &dd, QObject *parent = nullptr); private: Q_DECLARE_PRIVATE(QGraphicsEffectSource) @@ -125,7 +125,7 @@ public: virtual void draw(QPainter *p) = 0; virtual void update() = 0; virtual bool isPixmap() const = 0; - virtual QPixmap pixmap(Qt::CoordinateSystem system, QPoint *offset = 0, + virtual QPixmap pixmap(Qt::CoordinateSystem system, QPoint *offset = nullptr, QGraphicsEffect::PixmapPadMode mode = QGraphicsEffect::PadToTransparentBorder) const = 0; virtual void effectBoundingRectChanged() = 0; @@ -149,7 +149,7 @@ class Q_WIDGETS_EXPORT QGraphicsEffectPrivate : public QObjectPrivate { Q_DECLARE_PUBLIC(QGraphicsEffect) public: - QGraphicsEffectPrivate() : source(0), isEnabled(1) {} + QGraphicsEffectPrivate() : source(nullptr), isEnabled(1) {} ~QGraphicsEffectPrivate(); inline void setGraphicsEffectSource(QGraphicsEffectSource *newSource) diff --git a/src/widgets/effects/qpixmapfilter_p.h b/src/widgets/effects/qpixmapfilter_p.h index 0f582bde60..c56acb8a24 100644 --- a/src/widgets/effects/qpixmapfilter_p.h +++ b/src/widgets/effects/qpixmapfilter_p.h @@ -100,7 +100,7 @@ class Q_WIDGETS_EXPORT QPixmapConvolutionFilter : public QPixmapFilter Q_DECLARE_PRIVATE(QPixmapConvolutionFilter) public: - QPixmapConvolutionFilter(QObject *parent = 0); + QPixmapConvolutionFilter(QObject *parent = nullptr); ~QPixmapConvolutionFilter(); void setConvolutionKernel(const qreal *matrix, int rows, int columns); @@ -124,7 +124,7 @@ class Q_WIDGETS_EXPORT QPixmapBlurFilter : public QPixmapFilter Q_DECLARE_PRIVATE(QPixmapBlurFilter) public: - QPixmapBlurFilter(QObject *parent = 0); + QPixmapBlurFilter(QObject *parent = nullptr); ~QPixmapBlurFilter(); void setRadius(qreal radius); @@ -148,7 +148,7 @@ class Q_WIDGETS_EXPORT QPixmapColorizeFilter : public QPixmapFilter Q_DECLARE_PRIVATE(QPixmapColorizeFilter) public: - QPixmapColorizeFilter(QObject *parent = 0); + QPixmapColorizeFilter(QObject *parent = nullptr); ~QPixmapColorizeFilter(); void setColor(const QColor& color); @@ -168,7 +168,7 @@ class Q_WIDGETS_EXPORT QPixmapDropShadowFilter : public QPixmapFilter Q_DECLARE_PRIVATE(QPixmapDropShadowFilter) public: - QPixmapDropShadowFilter(QObject *parent = 0); + QPixmapDropShadowFilter(QObject *parent = nullptr); ~QPixmapDropShadowFilter(); QRectF boundingRectFor(const QRectF &rect) const override; diff --git a/src/widgets/graphicsview/qgraphicsanchorlayout_p.h b/src/widgets/graphicsview/qgraphicsanchorlayout_p.h index 699ca32bfe..b5f14948ac 100644 --- a/src/widgets/graphicsview/qgraphicsanchorlayout_p.h +++ b/src/widgets/graphicsview/qgraphicsanchorlayout_p.h @@ -89,7 +89,7 @@ struct AnchorVertex { : m_item(item), m_edge(edge), m_type(Normal) {} AnchorVertex() - : m_item(0), m_edge(Qt::AnchorPoint(0)), m_type(Normal) {} + : m_item(nullptr), m_edge(Qt::AnchorPoint(0)), m_type(Normal) {} #ifdef QT_DEBUG inline QString toString() const; @@ -123,18 +123,18 @@ struct AnchorData : public QSimplexVariable { }; AnchorData() - : QSimplexVariable(), from(0), to(0), + : QSimplexVariable(), from(nullptr), to(nullptr), minSize(0), prefSize(0), maxSize(0), minPrefSize(0), maxPrefSize(0), sizeAtMinimum(0), sizeAtPreferred(0), - sizeAtMaximum(0), item(0), graphicsAnchor(0), + sizeAtMaximum(0), item(nullptr), graphicsAnchor(nullptr), type(Normal), isLayoutAnchor(false), isCenterAnchor(false), orientation(0), dependency(Independent) {} virtual ~AnchorData(); virtual void updateChildrenSizes() {} - void refreshSizeHints(const QLayoutStyleInfo *styleInfo = 0); + void refreshSizeHints(const QLayoutStyleInfo *styleInfo = nullptr); #ifdef QT_DEBUG void dump(int indent = 2); @@ -402,7 +402,7 @@ public: static QGraphicsAnchorLayoutPrivate *get(QGraphicsAnchorLayout *q) { - return q ? q->d_func() : 0; + return q ? q->d_func() : nullptr; } static Qt::AnchorPoint oppositeEdge( @@ -443,7 +443,7 @@ public: Qt::AnchorPoint firstEdge, QGraphicsLayoutItem *secondItem, Qt::AnchorPoint secondEdge, - qreal *spacing = 0); + qreal *spacing = nullptr); // Helper for Anchor Manipulation methods void addAnchor_helper(QGraphicsLayoutItem *firstItem, diff --git a/src/widgets/graphicsview/qgraphicsgridlayoutengine_p.h b/src/widgets/graphicsview/qgraphicsgridlayoutengine_p.h index 370df9eed7..e98160e40f 100644 --- a/src/widgets/graphicsview/qgraphicsgridlayoutengine_p.h +++ b/src/widgets/graphicsview/qgraphicsgridlayoutengine_p.h @@ -68,7 +68,7 @@ class QGraphicsLayoutPrivate; class QGraphicsGridLayoutEngineItem : public QGridLayoutItem { public: QGraphicsGridLayoutEngineItem(QGraphicsLayoutItem *item, int row, int columns, int rowSpan = 1, int columnSpan = 1, - Qt::Alignment alignment = 0) + Qt::Alignment alignment = nullptr) : QGridLayoutItem(row, columns, rowSpan, columnSpan, alignment), q_layoutItem(item) {} virtual QLayoutPolicy::Policy sizePolicy(Qt::Orientation orientation) const override @@ -115,7 +115,7 @@ public: { const int index = indexOf(layoutItem); if (index < 0) - return 0; + return nullptr; return static_cast<QGraphicsGridLayoutEngineItem*>(q_items.at(index)); } diff --git a/src/widgets/graphicsview/qgraphicsitem_p.h b/src/widgets/graphicsview/qgraphicsitem_p.h index d586a22544..a2c3774f65 100644 --- a/src/widgets/graphicsview/qgraphicsitem_p.h +++ b/src/widgets/graphicsview/qgraphicsitem_p.h @@ -78,13 +78,13 @@ public: typedef void (*ClearFunction)(QDeclarativeListProperty<T> *); QDeclarativeListProperty() - : object(0), data(0), append(0), count(0), at(0), clear(0), dummy1(0), dummy2(0) {} + : object(nullptr), data(nullptr), append(nullptr), count(nullptr), at(nullptr), clear(nullptr), dummy1(nullptr), dummy2(nullptr) {} QDeclarativeListProperty(QObject *o, QList<T *> &list) : object(o), data(&list), append(qlist_append), count(qlist_count), at(qlist_at), - clear(qlist_clear), dummy1(0), dummy2(0) {} + clear(qlist_clear), dummy1(nullptr), dummy2(nullptr) {} QDeclarativeListProperty(QObject *o, void *d, AppendFunction a, CountFunction c = 0, AtFunction t = 0, ClearFunction r = 0) - : object(o), data(d), append(a), count(c), at(t), clear(r), dummy1(0), dummy2(0) {} + : object(o), data(d), append(a), count(c), at(t), clear(r), dummy1(nullptr), dummy2(nullptr) {} bool operator==(const QDeclarativeListProperty &o) const { return object == o.object && @@ -198,8 +198,8 @@ public: || (ancestorFlags & AncestorIgnoresTransformations); } - void combineTransformToParent(QTransform *x, const QTransform *viewTransform = 0) const; - void combineTransformFromParent(QTransform *x, const QTransform *viewTransform = 0) const; + void combineTransformToParent(QTransform *x, const QTransform *viewTransform = nullptr) const; + void combineTransformFromParent(QTransform *x, const QTransform *viewTransform = nullptr) const; virtual void updateSceneTransformFromParent(); static bool movableAncestorIsSelected(const QGraphicsItem *item); @@ -232,7 +232,7 @@ public: void childrenBoundingRectHelper(QTransform *x, QRectF *rect, QGraphicsItem *topMostEffectItem); void initStyleOption(QStyleOptionGraphicsItem *option, const QTransform &worldTransform, const QRegion &exposedRegion, bool allItems = false) const; - QRectF effectiveBoundingRect(QGraphicsItem *topMostEffectItem = 0) const; + QRectF effectiveBoundingRect(QGraphicsItem *topMostEffectItem = nullptr) const; QRectF sceneEffectiveBoundingRect() const; QRectF effectiveBoundingRect(const QRectF &rect) const; @@ -408,8 +408,8 @@ public: void setFocusHelper(Qt::FocusReason focusReason, bool climb, bool focusFromHide); void clearFocusHelper(bool giveFocusToParent, bool hiddenByParentPanel); - void setSubFocus(QGraphicsItem *rootItem = 0, QGraphicsItem *stopItem = 0); - void clearSubFocus(QGraphicsItem *rootItem = 0, QGraphicsItem *stopItem = 0); + void setSubFocus(QGraphicsItem *rootItem = nullptr, QGraphicsItem *stopItem = nullptr); + void clearSubFocus(QGraphicsItem *rootItem = nullptr, QGraphicsItem *stopItem = nullptr); void resetFocusProxy(); virtual void subFocusItemChange(); virtual void focusScopeItemChange(bool isSubFocusItem); @@ -541,7 +541,7 @@ struct QGraphicsItemPrivate::TransformData onlyTransform(true) { } - QTransform computedFullTransform(QTransform *postmultiplyTransform = 0) const + QTransform computedFullTransform(QTransform *postmultiplyTransform = nullptr) const { if (onlyTransform) { if (!postmultiplyTransform || postmultiplyTransform->isIdentity()) @@ -595,12 +595,12 @@ class QGraphicsItemEffectSourcePrivate : public QGraphicsEffectSourcePrivate { public: QGraphicsItemEffectSourcePrivate(QGraphicsItem *i) - : QGraphicsEffectSourcePrivate(), item(i), info(0) + : QGraphicsEffectSourcePrivate(), item(i), info(nullptr) {} void detach() override { - item->d_ptr->graphicsEffect = 0; + item->d_ptr->graphicsEffect = nullptr; item->prepareGeometryChange(); } @@ -608,7 +608,7 @@ public: { return item; } const QWidget *widget() const override - { return 0; } + { return nullptr; } void update() override { item->d_ptr->updateDueToGraphicsEffect = true; @@ -628,7 +628,7 @@ public: } const QStyleOption *styleOption() const override - { return info ? info->option : 0; } + { return info ? info->option : nullptr; } QRect deviceRect() const override { @@ -644,7 +644,7 @@ public: QPixmap pixmap(Qt::CoordinateSystem system, QPoint *offset, QGraphicsEffect::PixmapPadMode mode) const override; - QRect paddedEffectRect(Qt::CoordinateSystem system, QGraphicsEffect::PixmapPadMode mode, const QRectF &sourceRect, bool *unpadded = 0) const; + QRect paddedEffectRect(Qt::CoordinateSystem system, QGraphicsEffect::PixmapPadMode mode, const QRectF &sourceRect, bool *unpadded = nullptr) const; QGraphicsItem *item; QGraphicsItemPaintInfo *info; diff --git a/src/widgets/graphicsview/qgraphicsitemanimation.cpp b/src/widgets/graphicsview/qgraphicsitemanimation.cpp index 78b91d5c39..ad77e2f260 100644 --- a/src/widgets/graphicsview/qgraphicsitemanimation.cpp +++ b/src/widgets/graphicsview/qgraphicsitemanimation.cpp @@ -115,7 +115,7 @@ public: QGraphicsItem *item; QPointF startPos; - QMatrix startMatrix; + QTransform startTransform; qreal step; @@ -294,23 +294,38 @@ QList<QPair<qreal, QPointF> > QGraphicsItemAnimation::posList() const return list; } +#if QT_DEPRECATED_SINCE(5, 14) /*! Returns the matrix used to transform the item at the specified \a step value. + + \obsolete Use transformAt() instead */ QMatrix QGraphicsItemAnimation::matrixAt(qreal step) const { check_step_valid(step, "matrixAt"); + return transformAt(step).toAffine(); +} +#endif + +/*! + Returns the transform used for the item at the specified \a step value. + + \since 5.14 +*/ +QTransform QGraphicsItemAnimation::transformAt(qreal step) const +{ + check_step_valid(step, "transformAt"); - QMatrix matrix; + QTransform transform; if (!d->rotation.isEmpty()) - matrix.rotate(rotationAt(step)); + transform.rotate(rotationAt(step)); if (!d->verticalScale.isEmpty()) - matrix.scale(horizontalScaleAt(step), verticalScaleAt(step)); + transform.scale(horizontalScaleAt(step), verticalScaleAt(step)); if (!d->verticalShear.isEmpty()) - matrix.shear(horizontalShearAt(step), verticalShearAt(step)); + transform.shear(horizontalShearAt(step), verticalShearAt(step)); if (!d->xTranslation.isEmpty()) - matrix.translate(xTranslationAt(step), yTranslationAt(step)); - return matrix; + transform.translate(xTranslationAt(step), yTranslationAt(step)); + return transform; } /*! @@ -542,7 +557,7 @@ void QGraphicsItemAnimation::setStep(qreal step) || !d->horizontalShear.isEmpty() || !d->xTranslation.isEmpty() || !d->yTranslation.isEmpty()) { - d->item->setMatrix(d->startMatrix * matrixAt(step)); + d->item->setTransform(d->startTransform * transformAt(step)); } } @@ -562,7 +577,7 @@ void QGraphicsItemAnimation::reset() if (!d->item) return; d->startPos = d->item->pos(); - d->startMatrix = d->item->matrix(); + d->startTransform = d->item->transform(); } #endif diff --git a/src/widgets/graphicsview/qgraphicsitemanimation.h b/src/widgets/graphicsview/qgraphicsitemanimation.h index f983bd8026..3051fb2e2b 100644 --- a/src/widgets/graphicsview/qgraphicsitemanimation.h +++ b/src/widgets/graphicsview/qgraphicsitemanimation.h @@ -51,6 +51,7 @@ class QGraphicsItem; class QMatrix; class QPointF; class QTimeLine; +class QTransform; template <class T1, class T2> struct QPair; class QGraphicsItemAnimationPrivate; @@ -71,7 +72,11 @@ public: QList<QPair<qreal, QPointF> > posList() const; void setPosAt(qreal step, const QPointF &pos); +#if QT_DEPRECATED_SINCE(5, 14) + QT_DEPRECATED_X("Use transformAt() instead") QMatrix matrixAt(qreal step) const; +#endif + QTransform transformAt(qreal step) const; qreal rotationAt(qreal step) const; QList<QPair<qreal, qreal> > rotationList() const; diff --git a/src/widgets/graphicsview/qgraphicslayout_p.h b/src/widgets/graphicsview/qgraphicslayout_p.h index 302ad1e116..0d91151e22 100644 --- a/src/widgets/graphicsview/qgraphicslayout_p.h +++ b/src/widgets/graphicsview/qgraphicslayout_p.h @@ -91,7 +91,7 @@ public: m_defaultSpacing[1] = style->pixelMetric(QStyle::PM_LayoutVerticalSpacing); } - inline void invalidate() { m_valid = false; m_style = 0; m_widget = 0; } + inline void invalidate() { m_valid = false; m_style = nullptr; m_widget = nullptr; } inline QStyle *style() const { return m_style; } inline QWidget *widget() const { return m_widget; } @@ -130,7 +130,7 @@ class Q_AUTOTEST_EXPORT QGraphicsLayoutPrivate : public QGraphicsLayoutItemPriva Q_DECLARE_PUBLIC(QGraphicsLayout) public: - QGraphicsLayoutPrivate() : QGraphicsLayoutItemPrivate(0, true), left(-1.0), top(-1.0), right(-1.0), bottom(-1.0), + QGraphicsLayoutPrivate() : QGraphicsLayoutItemPrivate(nullptr, true), left(-1.0), top(-1.0), right(-1.0), bottom(-1.0), activated(true) { } void reparentChildItems(QGraphicsItem *newParent); diff --git a/src/widgets/graphicsview/qgraphicslayoutstyleinfo_p.h b/src/widgets/graphicsview/qgraphicslayoutstyleinfo_p.h index c3af9f4554..9807efb26e 100644 --- a/src/widgets/graphicsview/qgraphicslayoutstyleinfo_p.h +++ b/src/widgets/graphicsview/qgraphicslayoutstyleinfo_p.h @@ -84,7 +84,7 @@ public: virtual void invalidate() override { - m_style = 0; + m_style = nullptr; QAbstractLayoutStyleInfo::invalidate(); } diff --git a/src/widgets/graphicsview/qgraphicsscene_p.h b/src/widgets/graphicsview/qgraphicsscene_p.h index a2d13436fc..7934359cee 100644 --- a/src/widgets/graphicsview/qgraphicsscene_p.h +++ b/src/widgets/graphicsview/qgraphicsscene_p.h @@ -226,7 +226,7 @@ public: void drawSubtreeRecursive(QGraphicsItem *item, QPainter *painter, const QTransform *const, QRegion *exposedRegion, QWidget *widget, qreal parentOpacity = qreal(1.0), - const QTransform *const effectTransform = 0); + const QTransform *const effectTransform = nullptr); void draw(QGraphicsItem *, QPainter *, const QTransform *const, const QTransform *const, QRegion *, QWidget *, qreal, const QTransform *const, bool, bool); @@ -312,9 +312,9 @@ public: void gestureTargetsAtHotSpots(const QSet<QGesture *> &gestures, Qt::GestureFlag flag, QHash<QGraphicsObject *, QSet<QGesture *> > *targets, - QSet<QGraphicsObject *> *itemsSet = 0, - QSet<QGesture *> *normal = 0, - QSet<QGesture *> *conflicts = 0); + QSet<QGraphicsObject *> *itemsSet = nullptr, + QSet<QGesture *> *normal = nullptr, + QSet<QGesture *> *conflicts = nullptr); void cancelGesturesForChildren(QGesture *original); void grabGesture(QGraphicsItem *, Qt::GestureType gesture); void ungrabGesture(QGraphicsItem *, Qt::GestureType gesture); diff --git a/src/widgets/graphicsview/qgraphicsscenebsptreeindex_p.h b/src/widgets/graphicsview/qgraphicsscenebsptreeindex_p.h index eb6bbbf49b..7e0e525a6b 100644 --- a/src/widgets/graphicsview/qgraphicsscenebsptreeindex_p.h +++ b/src/widgets/graphicsview/qgraphicsscenebsptreeindex_p.h @@ -74,7 +74,7 @@ class Q_AUTOTEST_EXPORT QGraphicsSceneBspTreeIndex : public QGraphicsSceneIndex Q_OBJECT Q_PROPERTY(int bspTreeDepth READ bspTreeDepth WRITE setBspTreeDepth) public: - QGraphicsSceneBspTreeIndex(QGraphicsScene *scene = 0); + QGraphicsSceneBspTreeIndex(QGraphicsScene *scene = nullptr); ~QGraphicsSceneBspTreeIndex(); QList<QGraphicsItem *> estimateItems(const QRectF &rect, Qt::SortOrder order) const override; diff --git a/src/widgets/graphicsview/qgraphicssceneindex_p.h b/src/widgets/graphicsview/qgraphicssceneindex_p.h index 86637e836b..b494c52671 100644 --- a/src/widgets/graphicsview/qgraphicssceneindex_p.h +++ b/src/widgets/graphicsview/qgraphicssceneindex_p.h @@ -77,7 +77,7 @@ class Q_AUTOTEST_EXPORT QGraphicsSceneIndex : public QObject Q_OBJECT public: - QGraphicsSceneIndex(QGraphicsScene *scene = 0); + QGraphicsSceneIndex(QGraphicsScene *scene = nullptr); virtual ~QGraphicsSceneIndex(); QGraphicsScene *scene() const; diff --git a/src/widgets/graphicsview/qgraphicsscenelinearindex_p.h b/src/widgets/graphicsview/qgraphicsscenelinearindex_p.h index 07d5d80ef1..ead52c1fb0 100644 --- a/src/widgets/graphicsview/qgraphicsscenelinearindex_p.h +++ b/src/widgets/graphicsview/qgraphicsscenelinearindex_p.h @@ -67,7 +67,7 @@ class Q_AUTOTEST_EXPORT QGraphicsSceneLinearIndex : public QGraphicsSceneIndex Q_OBJECT public: - QGraphicsSceneLinearIndex(QGraphicsScene *scene = 0) : QGraphicsSceneIndex(scene), m_numSortedElements(0) + QGraphicsSceneLinearIndex(QGraphicsScene *scene = nullptr) : QGraphicsSceneIndex(scene), m_numSortedElements(0) { } QList<QGraphicsItem *> items(Qt::SortOrder order = Qt::DescendingOrder) const override diff --git a/src/widgets/graphicsview/qgraphicstransform_p.h b/src/widgets/graphicsview/qgraphicstransform_p.h index e54ee9fb3c..05e12c3e64 100644 --- a/src/widgets/graphicsview/qgraphicstransform_p.h +++ b/src/widgets/graphicsview/qgraphicstransform_p.h @@ -66,7 +66,7 @@ public: Q_DECLARE_PUBLIC(QGraphicsTransform) QGraphicsTransformPrivate() - : QObjectPrivate(), item(0) {} + : QObjectPrivate(), item(nullptr) {} ~QGraphicsTransformPrivate(); QGraphicsItem *item; diff --git a/src/widgets/graphicsview/qgraphicswidget_p.h b/src/widgets/graphicsview/qgraphicswidget_p.h index 505a2a24c0..821f8c73f1 100644 --- a/src/widgets/graphicsview/qgraphicswidget_p.h +++ b/src/widgets/graphicsview/qgraphicswidget_p.h @@ -82,7 +82,7 @@ public: mutable qreal *margins; void ensureMargins() const; - void fixFocusChainBeforeReparenting(QGraphicsWidget *newParent, QGraphicsScene *oldScene, QGraphicsScene *newScene = 0); + void fixFocusChainBeforeReparenting(QGraphicsWidget *newParent, QGraphicsScene *oldScene, QGraphicsScene *newScene = nullptr); void setLayout_helper(QGraphicsLayout *l); // Layouts diff --git a/src/widgets/graphicsview/qsimplex_p.h b/src/widgets/graphicsview/qsimplex_p.h index 369f2f5f82..a69cef6115 100644 --- a/src/widgets/graphicsview/qsimplex_p.h +++ b/src/widgets/graphicsview/qsimplex_p.h @@ -82,7 +82,7 @@ struct QSimplexVariable */ struct QSimplexConstraint { - QSimplexConstraint() : constant(0), ratio(Equal), artificial(0) {} + QSimplexConstraint() : constant(0), ratio(Equal), artificial(nullptr) {} enum Ratio { LessOrEqual = 0, diff --git a/src/widgets/itemviews/qcolumnview_p.h b/src/widgets/itemviews/qcolumnview_p.h index 7b36b1f3da..c60579255e 100644 --- a/src/widgets/itemviews/qcolumnview_p.h +++ b/src/widgets/itemviews/qcolumnview_p.h @@ -74,7 +74,7 @@ QT_BEGIN_NAMESPACE class QColumnViewPreviewColumn : public QAbstractItemView { public: - explicit QColumnViewPreviewColumn(QWidget *parent) : QAbstractItemView(parent), previewWidget(0) { + explicit QColumnViewPreviewColumn(QWidget *parent) : QAbstractItemView(parent), previewWidget(nullptr) { } void setPreviewWidget(QWidget *widget) { @@ -186,7 +186,7 @@ class QColumnViewDelegate : public QItemDelegate { public: - explicit QColumnViewDelegate(QObject *parent = 0) : QItemDelegate(parent) {} + explicit QColumnViewDelegate(QObject *parent = nullptr) : QItemDelegate(parent) {} ~QColumnViewDelegate() {} void paint(QPainter *painter, diff --git a/src/widgets/itemviews/qcolumnviewgrip_p.h b/src/widgets/itemviews/qcolumnviewgrip_p.h index 5eb8012204..4311edbeb4 100644 --- a/src/widgets/itemviews/qcolumnviewgrip_p.h +++ b/src/widgets/itemviews/qcolumnviewgrip_p.h @@ -68,12 +68,12 @@ Q_SIGNALS: void gripMoved(int offset); public: - explicit QColumnViewGrip(QWidget *parent = 0); + explicit QColumnViewGrip(QWidget *parent = nullptr); ~QColumnViewGrip(); int moveGrip(int offset); protected: - QColumnViewGrip(QColumnViewGripPrivate &, QWidget *parent = 0, Qt::WindowFlags f = 0); + QColumnViewGrip(QColumnViewGripPrivate &, QWidget *parent = nullptr, Qt::WindowFlags f = nullptr); void paintEvent(QPaintEvent *event) override; void mouseDoubleClickEvent(QMouseEvent *event) override; void mouseMoveEvent(QMouseEvent *event) override; diff --git a/src/widgets/itemviews/qheaderview_p.h b/src/widgets/itemviews/qheaderview_p.h index d9fc1baec5..766adef36d 100644 --- a/src/widgets/itemviews/qheaderview_p.h +++ b/src/widgets/itemviews/qheaderview_p.h @@ -102,7 +102,7 @@ public: lastSectionLogicalIdx(-1), // Only trust when we stretch last section sectionIndicatorOffset(0), #if QT_CONFIG(label) - sectionIndicator(0), + sectionIndicator(nullptr), #endif globalResizeMode(QHeaderView::Interactive), sectionStartposRecalc(true), diff --git a/src/widgets/itemviews/qlistview_p.h b/src/widgets/itemviews/qlistview_p.h index c6810f8fdc..86331bb862 100644 --- a/src/widgets/itemviews/qlistview_p.h +++ b/src/widgets/itemviews/qlistview_p.h @@ -248,7 +248,7 @@ private: class QIconModeViewBase : public QCommonListViewBase { public: - QIconModeViewBase(QListView *q, QListViewPrivate *d) : QCommonListViewBase(q, d), interSectingVector(0) {} + QIconModeViewBase(QListView *q, QListViewPrivate *d) : QCommonListViewBase(q, d), interSectingVector(nullptr) {} QBspTree tree; QVector<QListViewItem> items; diff --git a/src/widgets/itemviews/qtableview_p.h b/src/widgets/itemviews/qtableview_p.h index d55462c28b..f629dfcd09 100644 --- a/src/widgets/itemviews/qtableview_p.h +++ b/src/widgets/itemviews/qtableview_p.h @@ -137,7 +137,7 @@ public: : showGrid(true), gridStyle(Qt::SolidLine), rowSectionAnchor(-1), columnSectionAnchor(-1), columnResizeTimerID(0), rowResizeTimerID(0), - horizontalHeader(0), verticalHeader(0), + horizontalHeader(nullptr), verticalHeader(nullptr), sortingEnabled(false), geometryRecursionBlock(false), visualCursor(QPoint()) { diff --git a/src/widgets/itemviews/qtreeview_p.h b/src/widgets/itemviews/qtreeview_p.h index 9666a9f8c2..836d8f0c2d 100644 --- a/src/widgets/itemviews/qtreeview_p.h +++ b/src/widgets/itemviews/qtreeview_p.h @@ -87,7 +87,7 @@ public: QTreeViewPrivate() : QAbstractItemViewPrivate(), - header(0), indent(20), lastViewedItem(0), defaultItemHeight(-1), + header(nullptr), indent(20), lastViewedItem(0), defaultItemHeight(-1), uniformRowHeights(false), rootDecoration(true), itemsExpandable(true), sortingEnabled(false), expandsOnDoubleClick(true), @@ -157,7 +157,7 @@ public: bool checkViewItems() const; #endif - int firstVisibleItem(int *offset = 0) const; + int firstVisibleItem(int *offset = nullptr) const; int lastVisibleItem(int firstVisual = -1, int offset = -1) const; int columnAt(int x) const; bool hasVisibleChildren( const QModelIndex& parent) const; diff --git a/src/widgets/itemviews/qtreewidget_p.h b/src/widgets/itemviews/qtreewidget_p.h index ee4a633468..81e7e86203 100644 --- a/src/widgets/itemviews/qtreewidget_p.h +++ b/src/widgets/itemviews/qtreewidget_p.h @@ -78,7 +78,7 @@ class QTreeModel : public QAbstractItemModel friend class QTreeWidgetItemIteratorPrivate; public: - explicit QTreeModel(int columns = 0, QTreeWidget *parent = 0); + explicit QTreeModel(int columns = 0, QTreeWidget *parent = nullptr); ~QTreeModel(); inline QTreeWidget *view() const @@ -140,7 +140,7 @@ public: { return createIndex(row, col, item); } protected: - QTreeModel(QTreeModelPrivate &, QTreeWidget *parent = 0); + QTreeModel(QTreeModelPrivate &, QTreeWidget *parent = nullptr); void emitDataChanged(QTreeWidgetItem *item, int column, const QVector<int> &roles); void beginInsertItems(QTreeWidgetItem *parent, int row, int count); void endInsertItems(); diff --git a/src/widgets/kernel/qapplication.cpp b/src/widgets/kernel/qapplication.cpp index 7c44bfe39d..9e784b41c6 100644 --- a/src/widgets/kernel/qapplication.cpp +++ b/src/widgets/kernel/qapplication.cpp @@ -575,10 +575,6 @@ void QApplicationPrivate::init() initialize(); eventDispatcher->startingUp(); -#ifdef QT_EVAL - extern void qt_gui_eval_init(QCoreApplicationPrivate::Type); - qt_gui_eval_init(application_type); -#endif #ifndef QT_NO_ACCESSIBILITY // factory for accessible interfaces for widgets shipped with Qt QAccessible::installFactory(&qAccessibleFactory); diff --git a/src/widgets/kernel/qapplication_p.h b/src/widgets/kernel/qapplication_p.h index 133279f977..98eb9b73c6 100644 --- a/src/widgets/kernel/qapplication_p.h +++ b/src/widgets/kernel/qapplication_p.h @@ -128,10 +128,10 @@ public: void notifyWindowIconChanged() override; //modality - bool isWindowBlocked(QWindow *window, QWindow **blockingWindow = 0) const override; + bool isWindowBlocked(QWindow *window, QWindow **blockingWindow = nullptr) const override; static bool isBlockedByModal(QWidget *widget); static bool modalState(); - static bool tryModalHelper(QWidget *widget, QWidget **rettop = 0); + static bool tryModalHelper(QWidget *widget, QWidget **rettop = nullptr); #if 0 // Used to be included in Qt4 for Q_WS_MAC static QWidget *tryModalHelper_sys(QWidget *top); bool canQuit(); @@ -157,7 +157,7 @@ public: void openPopup(QWidget *popup); static void setFocusWidget(QWidget *focus, Qt::FocusReason reason); static QWidget *focusNextPrevChild_helper(QWidget *toplevel, bool next, - bool *wrappingOccurred = 0); + bool *wrappingOccurred = nullptr); #if QT_CONFIG(graphicsview) // Maintain a list of all scenes to ensure font and palette propagation to @@ -238,7 +238,7 @@ public: return window; if (const QWidget *nativeParent = widget->nativeParentWidget()) return nativeParent->windowHandle(); - return 0; + return nullptr; } #ifdef Q_OS_WIN diff --git a/src/widgets/kernel/qformlayout.cpp b/src/widgets/kernel/qformlayout.cpp index bd0ea2598a..9146ba84c8 100644 --- a/src/widgets/kernel/qformlayout.cpp +++ b/src/widgets/kernel/qformlayout.cpp @@ -783,7 +783,7 @@ void QFormLayoutPrivate::setupVerticalLayoutData(int width) vLayouts[vidx].expansive = expanding || (vLayouts[vidx].stretch > 0); vLayouts[vidx].empty = false; - if (vLayouts[vidx].stretch > 0) + if (vLayouts[vidx].expansive) addTopBottomStretch = false; if (vidx > 1) diff --git a/src/widgets/kernel/qgesture_p.h b/src/widgets/kernel/qgesture_p.h index 636103c1e1..cbf8d60892 100644 --- a/src/widgets/kernel/qgesture_p.h +++ b/src/widgets/kernel/qgesture_p.h @@ -111,7 +111,7 @@ class QPinchGesturePrivate : public QGesturePrivate public: QPinchGesturePrivate() - : totalChangeFlags(0), changeFlags(0), + : totalChangeFlags(nullptr), changeFlags(nullptr), totalScaleFactor(1), lastScaleFactor(1), scaleFactor(1), totalRotationAngle(0), lastRotationAngle(0), rotationAngle(0), isNewSequence(true) diff --git a/src/widgets/kernel/qlayout_p.h b/src/widgets/kernel/qlayout_p.h index 8a1b12a6be..8e1d773355 100644 --- a/src/widgets/kernel/qlayout_p.h +++ b/src/widgets/kernel/qlayout_p.h @@ -80,7 +80,7 @@ public: static QWidgetItem *createWidgetItem(const QLayout *layout, QWidget *widget); static QSpacerItem *createSpacerItem(const QLayout *layout, int w, int h, QSizePolicy::Policy hPolicy = QSizePolicy::Minimum, QSizePolicy::Policy vPolicy = QSizePolicy::Minimum); - virtual QLayoutItem* replaceAt(int index, QLayoutItem *newitem) { Q_UNUSED(index); Q_UNUSED(newitem); return 0; } + virtual QLayoutItem* replaceAt(int index, QLayoutItem *newitem) { Q_UNUSED(index); Q_UNUSED(newitem); return nullptr; } static QWidgetItemFactoryMethod widgetItemFactoryMethod; static QSpacerItemFactoryMethod spacerItemFactoryMethod; diff --git a/src/widgets/kernel/qlayoutengine_p.h b/src/widgets/kernel/qlayoutengine_p.h index 812fa7cf3b..948c2424e6 100644 --- a/src/widgets/kernel/qlayoutengine_p.h +++ b/src/widgets/kernel/qlayoutengine_p.h @@ -105,9 +105,9 @@ Q_WIDGETS_EXPORT QSize qSmartMinSize(const QWidgetItem *i); Q_WIDGETS_EXPORT QSize qSmartMinSize(const QWidget *w); Q_WIDGETS_EXPORT QSize qSmartMaxSize(const QSize &sizeHint, const QSize &minSize, const QSize &maxSize, - const QSizePolicy &sizePolicy, Qt::Alignment align = 0); -Q_WIDGETS_EXPORT QSize qSmartMaxSize(const QWidgetItem *i, Qt::Alignment align = 0); -Q_WIDGETS_EXPORT QSize qSmartMaxSize(const QWidget *w, Qt::Alignment align = 0); + const QSizePolicy &sizePolicy, Qt::Alignment align = nullptr); +Q_WIDGETS_EXPORT QSize qSmartMaxSize(const QWidgetItem *i, Qt::Alignment align = nullptr); +Q_WIDGETS_EXPORT QSize qSmartMaxSize(const QWidget *w, Qt::Alignment align = nullptr); Q_WIDGETS_EXPORT int qSmartSpacing(const QLayout *layout, QStyle::PixelMetric pm); diff --git a/src/widgets/kernel/qlayoutitem.cpp b/src/widgets/kernel/qlayoutitem.cpp index 9e6d1c5eac..0aab0bb06d 100644 --- a/src/widgets/kernel/qlayoutitem.cpp +++ b/src/widgets/kernel/qlayoutitem.cpp @@ -502,6 +502,17 @@ void QWidgetItem::setGeometry(const QRect &rect) else if (!(align & Qt::AlignTop)) y = y + (r.height() - s.height()) / 2; + // Make sure we don't move outside of the parent, e.g when styles demand + // surplus space that exceeds the available margins (f.ex macOS with QGroupBox) + if (x < 0) { + s.rwidth() += x; + x = 0; + } + if (y < 0) { + s.rheight() += y; + y = 0; + } + wid->setGeometry(x, y, s.width(), s.height()); } diff --git a/src/widgets/kernel/qwidget.cpp b/src/widgets/kernel/qwidget.cpp index 89a8a7be0f..74b18d9991 100644 --- a/src/widgets/kernel/qwidget.cpp +++ b/src/widgets/kernel/qwidget.cpp @@ -1348,11 +1348,6 @@ void QWidget::create(WId window, bool initializeWindow, bool destroyOldWindow) if (!isWindow() && parentWidget() && parentWidget()->testAttribute(Qt::WA_DropSiteRegistered)) setAttribute(Qt::WA_DropSiteRegistered, true); -#ifdef QT_EVAL - extern void qt_eval_init_widget(QWidget *w); - qt_eval_init_widget(this); -#endif - // need to force the resting of the icon after changing parents if (testAttribute(Qt::WA_SetWindowIcon)) d->setWindowIcon_sys(); @@ -6059,13 +6054,7 @@ QString qt_setWindowTitle_helperHelper(const QString &title, const QWidget *widg { Q_ASSERT(widget); -#ifdef QT_EVAL - extern QString qt_eval_adapt_window_title(const QString &title); - QString cap = qt_eval_adapt_window_title(title); -#else QString cap = title; -#endif - if (cap.isEmpty()) return cap; @@ -10165,7 +10154,11 @@ void QWidget::hideEvent(QHideEvent *) \endtable */ +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QWidget::nativeEvent(const QByteArray &eventType, void *message, qintptr *result) +#else bool QWidget::nativeEvent(const QByteArray &eventType, void *message, long *result) +#endif { Q_UNUSED(eventType); Q_UNUSED(message); diff --git a/src/widgets/kernel/qwidget.h b/src/widgets/kernel/qwidget.h index 4e5ef5a111..aec3eee639 100644 --- a/src/widgets/kernel/qwidget.h +++ b/src/widgets/kernel/qwidget.h @@ -648,7 +648,12 @@ protected: virtual void showEvent(QShowEvent *event); virtual void hideEvent(QHideEvent *event); + +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + virtual bool nativeEvent(const QByteArray &eventType, void *message, qintptr *result); +#else virtual bool nativeEvent(const QByteArray &eventType, void *message, long *result); +#endif // Misc. protected functions virtual void changeEvent(QEvent *); diff --git a/src/widgets/kernel/qwidget_p.h b/src/widgets/kernel/qwidget_p.h index 797963b931..90c4c2a945 100644 --- a/src/widgets/kernel/qwidget_p.h +++ b/src/widgets/kernel/qwidget_p.h @@ -146,7 +146,7 @@ public: inline operator bool() const { - return (0 != m_ptr); + return (nullptr != m_ptr); } private: @@ -411,7 +411,7 @@ public: void render(QPaintDevice *target, const QPoint &targetOffset, const QRegion &sourceRegion, QWidget::RenderFlags renderFlags); void drawWidget(QPaintDevice *pdev, const QRegion &rgn, const QPoint &offset, int flags, - QPainter *sharedPainter = 0, QWidgetBackingStore *backingStore = 0); + QPainter *sharedPainter = nullptr, QWidgetBackingStore *backingStore = nullptr); void sendPaintEvent(const QRegion &toBePainted); @@ -428,7 +428,7 @@ public: QRegion clipRegion() const; void setSystemClip(QPaintEngine *paintEngine, qreal devicePixelRatio, const QRegion ®ion); void subtractOpaqueChildren(QRegion &rgn, const QRect &clipRect) const; - void subtractOpaqueSiblings(QRegion &source, bool *hasDirtySiblingsAbove = 0, + void subtractOpaqueSiblings(QRegion &source, bool *hasDirtySiblingsAbove = nullptr, bool alsoNonOpaque = false) const; void clipToEffectiveMask(QRegion ®ion) const; void updateIsOpaque(); @@ -525,7 +525,7 @@ public: void getLayoutItemMargins(int *left, int *top, int *right, int *bottom) const; void setLayoutItemMargins(int left, int top, int right, int bottom); - void setLayoutItemMargins(QStyle::SubElement element, const QStyleOption *opt = 0); + void setLayoutItemMargins(QStyle::SubElement element, const QStyleOption *opt = nullptr); void updateContentsRect(); QMargins safeAreaMargins() const; @@ -555,7 +555,7 @@ public: QGraphicsProxyWidget *ancestorProxy = widget->d_func()->nearestGraphicsProxyWidget(widget); //It's embedded if it has an ancestor if (ancestorProxy) { - if (!bypassGraphicsProxyWidget(widget) && ancestorProxy->scene() != 0) { + if (!bypassGraphicsProxyWidget(widget) && ancestorProxy->scene() != nullptr) { // One view, let be smart and return the viewport rect then the popup is aligned if (ancestorProxy->scene()->views().size() == 1) { QGraphicsView *view = ancestorProxy->scene()->views().at(0); @@ -586,7 +586,7 @@ public: } inline void restoreRedirected() - { redirectDev = 0; } + { redirectDev = nullptr; } inline void enforceNativeChildren() { @@ -652,7 +652,7 @@ public: QOpenGLContext *shareContext() const; - virtual QObject *focusObject() { return 0; } + virtual QObject *focusObject() { return nullptr; } #ifndef QT_NO_OPENGL virtual GLuint textureId() const { return 0; } @@ -660,7 +660,7 @@ public: Q_Q(QWidget); return q->testAttribute(Qt::WA_AlwaysStackOnTop) ? QPlatformTextureList::StacksOnTop - : QPlatformTextureList::Flags(0); + : QPlatformTextureList::Flags(nullptr); } virtual QImage grabFramebuffer() { return QImage(); } virtual void beginBackingStorePainting() { } @@ -904,7 +904,7 @@ struct QWidgetPaintContext { inline QWidgetPaintContext(QPaintDevice *d, const QRegion &r, const QPoint &o, int f, QPainter *p, QWidgetBackingStore *b) - : pdev(d), rgn(r), offset(o), flags(f), sharedPainter(p), backingStore(b), painter(0) {} + : pdev(d), rgn(r), offset(o), flags(f), sharedPainter(p), backingStore(b), painter(nullptr) {} QPaintDevice *pdev; QRegion rgn; @@ -920,14 +920,14 @@ class QWidgetEffectSourcePrivate : public QGraphicsEffectSourcePrivate { public: QWidgetEffectSourcePrivate(QWidget *widget) - : QGraphicsEffectSourcePrivate(), m_widget(widget), context(0), updateDueToGraphicsEffect(false) + : QGraphicsEffectSourcePrivate(), m_widget(widget), context(nullptr), updateDueToGraphicsEffect(false) {} void detach() override - { m_widget->d_func()->graphicsEffect = 0; } + { m_widget->d_func()->graphicsEffect = nullptr; } const QGraphicsItem *graphicsItem() const override - { return 0; } + { return nullptr; } const QWidget *widget() const override { return m_widget; } @@ -953,7 +953,7 @@ public: } const QStyleOption *styleOption() const override - { return 0; } + { return nullptr; } QRect deviceRect() const override { return m_widget->window()->rect(); } @@ -983,14 +983,14 @@ inline QTLWExtra *QWidgetPrivate::topData() const inline QTLWExtra *QWidgetPrivate::maybeTopData() const { - return extra ? extra->topextra : 0; + return extra ? extra->topextra : nullptr; } inline QPainter *QWidgetPrivate::sharedPainter() const { Q_Q(const QWidget); QTLWExtra *x = q->window()->d_func()->maybeTopData(); - return x ? x->sharedPainter : 0; + return x ? x->sharedPainter : nullptr; } inline void QWidgetPrivate::setSharedPainter(QPainter *painter) @@ -1011,7 +1011,7 @@ inline QWidgetBackingStore *QWidgetPrivate::maybeBackingStore() const { Q_Q(const QWidget); QTLWExtra *x = q->window()->d_func()->maybeTopData(); - return x ? x->backingStoreTracker.data() : 0; + return x ? x->backingStoreTracker.data() : nullptr; } inline QWidgetWindow *QWidgetPrivate::windowHandle() const diff --git a/src/widgets/kernel/qwidgetbackingstore.cpp b/src/widgets/kernel/qwidgetbackingstore.cpp index 0481dffda8..595beeaf47 100644 --- a/src/widgets/kernel/qwidgetbackingstore.cpp +++ b/src/widgets/kernel/qwidgetbackingstore.cpp @@ -310,12 +310,6 @@ bool QWidgetBackingStore::bltRect(const QRect &rect, int dx, int dy, QWidget *wi return store->scroll(tlwRect, dx, dy); } -void QWidgetBackingStore::releaseBuffer() -{ - if (store) - store->resize(QSize()); -} - /*! Prepares the window surface to paint a\ toClean region of the \a widget and updates the BeginPaintInfo struct accordingly. diff --git a/src/widgets/kernel/qwidgetbackingstore_p.h b/src/widgets/kernel/qwidgetbackingstore_p.h index 4d15ab138e..9409ba7832 100644 --- a/src/widgets/kernel/qwidgetbackingstore_p.h +++ b/src/widgets/kernel/qwidgetbackingstore_p.h @@ -109,7 +109,7 @@ public: void sync(QWidget *exposedWidget, const QRegion &exposedRegion); void sync(); - void flush(QWidget *widget = 0); + void flush(QWidget *widget = nullptr); QBackingStore *backingStore() const { return store; } @@ -149,14 +149,13 @@ private: void doSync(); bool bltRect(const QRect &rect, int dx, int dy, QWidget *widget); - void releaseBuffer(); void beginPaint(QRegion &toClean, QWidget *widget, QBackingStore *backingStore, BeginPaintInfo *returnInfo, bool toCleanIsInTopLevelCoordinates = true); void endPaint(const QRegion &cleaned, QBackingStore *backingStore, BeginPaintInfo *beginPaintInfo); - QRegion dirtyRegion(QWidget *widget = 0) const; - QRegion staticContents(QWidget *widget = 0, const QRect &withinClipRect = QRect()) const; + QRegion dirtyRegion(QWidget *widget = nullptr) const; + QRegion staticContents(QWidget *widget = nullptr, const QRect &withinClipRect = QRect()) const; void markDirtyOnScreen(const QRegion &dirtyOnScreen, QWidget *widget, const QPoint &topLevelOffset); diff --git a/src/widgets/kernel/qwidgetwindow.cpp b/src/widgets/kernel/qwidgetwindow.cpp index e9b749d7c2..c6f22aa21a 100644 --- a/src/widgets/kernel/qwidgetwindow.cpp +++ b/src/widgets/kernel/qwidgetwindow.cpp @@ -1020,7 +1020,11 @@ void QWidgetWindow::handleWindowStateChangedEvent(QWindowStateChangeEvent *event } } +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) +bool QWidgetWindow::nativeEvent(const QByteArray &eventType, void *message, qintptr *result) +#else bool QWidgetWindow::nativeEvent(const QByteArray &eventType, void *message, long *result) +#endif { return m_widget->nativeEvent(eventType, message, result); } diff --git a/src/widgets/kernel/qwidgetwindow_p.h b/src/widgets/kernel/qwidgetwindow_p.h index 0728135467..80a345465d 100644 --- a/src/widgets/kernel/qwidgetwindow_p.h +++ b/src/widgets/kernel/qwidgetwindow_p.h @@ -103,7 +103,11 @@ protected: #endif void handleExposeEvent(QExposeEvent *); void handleWindowStateChangedEvent(QWindowStateChangeEvent *event); +#if QT_VERSION >= QT_VERSION_CHECK(6, 0, 0) + bool nativeEvent(const QByteArray &eventType, void *message, qintptr *result) override; +#else bool nativeEvent(const QByteArray &eventType, void *message, long *result) override; +#endif #if QT_CONFIG(tabletevent) void handleTabletEvent(QTabletEvent *); #endif diff --git a/src/widgets/kernel/qwindowcontainer_p.h b/src/widgets/kernel/qwindowcontainer_p.h index a8754232a8..c6de168c10 100644 --- a/src/widgets/kernel/qwindowcontainer_p.h +++ b/src/widgets/kernel/qwindowcontainer_p.h @@ -64,7 +64,7 @@ class Q_WIDGETS_EXPORT QWindowContainer : public QWidget Q_DECLARE_PRIVATE(QWindowContainer) public: - explicit QWindowContainer(QWindow *embeddedWindow, QWidget *parent = 0, Qt::WindowFlags f = 0); + explicit QWindowContainer(QWindow *embeddedWindow, QWidget *parent = nullptr, Qt::WindowFlags f = nullptr); ~QWindowContainer(); QWindow *containedWindow() const; diff --git a/src/widgets/statemachine/qbasickeyeventtransition_p.h b/src/widgets/statemachine/qbasickeyeventtransition_p.h index 7e1b978bba..f23c078570 100644 --- a/src/widgets/statemachine/qbasickeyeventtransition_p.h +++ b/src/widgets/statemachine/qbasickeyeventtransition_p.h @@ -63,11 +63,11 @@ class Q_AUTOTEST_EXPORT QBasicKeyEventTransition : public QAbstractTransition { Q_OBJECT public: - QBasicKeyEventTransition(QState *sourceState = 0); - QBasicKeyEventTransition(QEvent::Type type, int key, QState *sourceState = 0); + QBasicKeyEventTransition(QState *sourceState = nullptr); + QBasicKeyEventTransition(QEvent::Type type, int key, QState *sourceState = nullptr); QBasicKeyEventTransition(QEvent::Type type, int key, Qt::KeyboardModifiers modifierMask, - QState *sourceState = 0); + QState *sourceState = nullptr); ~QBasicKeyEventTransition(); QEvent::Type eventType() const; diff --git a/src/widgets/statemachine/qbasicmouseeventtransition_p.h b/src/widgets/statemachine/qbasicmouseeventtransition_p.h index 132e223535..dd619d189c 100644 --- a/src/widgets/statemachine/qbasicmouseeventtransition_p.h +++ b/src/widgets/statemachine/qbasicmouseeventtransition_p.h @@ -65,9 +65,9 @@ class Q_AUTOTEST_EXPORT QBasicMouseEventTransition : public QAbstractTransition { Q_OBJECT public: - QBasicMouseEventTransition(QState *sourceState = 0); + QBasicMouseEventTransition(QState *sourceState = nullptr); QBasicMouseEventTransition(QEvent::Type type, Qt::MouseButton button, - QState *sourceState = 0); + QState *sourceState = nullptr); ~QBasicMouseEventTransition(); QEvent::Type eventType() const; diff --git a/src/widgets/styles/qcommonstyle_p.h b/src/widgets/styles/qcommonstyle_p.h index 296f89ce5f..4860dfe4c9 100644 --- a/src/widgets/styles/qcommonstyle_p.h +++ b/src/widgets/styles/qcommonstyle_p.h @@ -71,7 +71,7 @@ class Q_WIDGETS_EXPORT QCommonStylePrivate : public QStylePrivate public: inline QCommonStylePrivate() : #if QT_CONFIG(itemviews) - cachedOption(0), + cachedOption(nullptr), #endif animationFps(30) { } diff --git a/src/widgets/styles/qfusionstyle_p.h b/src/widgets/styles/qfusionstyle_p.h index e67e792727..cbefe3e1af 100644 --- a/src/widgets/styles/qfusionstyle_p.h +++ b/src/widgets/styles/qfusionstyle_p.h @@ -72,28 +72,28 @@ public: QPalette standardPalette () const override; void drawPrimitive(PrimitiveElement elem, const QStyleOption *option, - QPainter *painter, const QWidget *widget = 0) const override; + QPainter *painter, const QWidget *widget = nullptr) const override; void drawControl(ControlElement ce, const QStyleOption *option, QPainter *painter, const QWidget *widget) const override; - int pixelMetric(PixelMetric metric, const QStyleOption *option = 0, const QWidget *widget = 0) const override; + int pixelMetric(PixelMetric metric, const QStyleOption *option = nullptr, const QWidget *widget = nullptr) const override; void drawComplexControl(ComplexControl control, const QStyleOptionComplex *option, QPainter *painter, const QWidget *widget) const override; - QRect subElementRect(SubElement r, const QStyleOption *opt, const QWidget *widget = 0) const override; + QRect subElementRect(SubElement r, const QStyleOption *opt, const QWidget *widget = nullptr) const override; QSize sizeFromContents(ContentsType type, const QStyleOption *option, const QSize &size, const QWidget *widget) const override; SubControl hitTestComplexControl(ComplexControl cc, const QStyleOptionComplex *opt, - const QPoint &pt, const QWidget *w = 0) const override; + const QPoint &pt, const QWidget *w = nullptr) const override; QRect subControlRect(ComplexControl cc, const QStyleOptionComplex *opt, SubControl sc, const QWidget *widget) const override; QPixmap generatedIconPixmap(QIcon::Mode iconMode, const QPixmap &pixmap, const QStyleOption *opt) const override; - int styleHint(StyleHint hint, const QStyleOption *option = 0, const QWidget *widget = 0, - QStyleHintReturn *returnData = 0) const override; + int styleHint(StyleHint hint, const QStyleOption *option = nullptr, const QWidget *widget = nullptr, + QStyleHintReturn *returnData = nullptr) const override; QRect itemPixmapRect(const QRect &r, int flags, const QPixmap &pixmap) const override; - QIcon standardIcon(StandardPixmap standardIcon, const QStyleOption *option = 0, - const QWidget *widget = 0) const override; + QIcon standardIcon(StandardPixmap standardIcon, const QStyleOption *option = nullptr, + const QWidget *widget = nullptr) const override; QPixmap standardPixmap(StandardPixmap standardPixmap, const QStyleOption *opt, - const QWidget *widget = 0) const override; + const QWidget *widget = nullptr) const override; void drawItemPixmap(QPainter *painter, const QRect &rect, int alignment, const QPixmap &pixmap) const override; void drawItemText(QPainter *painter, const QRect &rect, diff --git a/src/widgets/styles/qpixmapstyle_p.h b/src/widgets/styles/qpixmapstyle_p.h index 590434d95e..d32631a527 100644 --- a/src/widgets/styles/qpixmapstyle_p.h +++ b/src/widgets/styles/qpixmapstyle_p.h @@ -147,7 +147,7 @@ public: void drawControl(ControlElement element, const QStyleOption *option, QPainter *painter, const QWidget *widget = nullptr) const override; void drawComplexControl(ComplexControl cc, const QStyleOptionComplex *option, - QPainter *painter, const QWidget *widget=0) const override; + QPainter *painter, const QWidget *widget=nullptr) const override; QSize sizeFromContents(ContentsType type, const QStyleOption *option, const QSize &contentsSize, const QWidget *widget = nullptr) const override; diff --git a/src/widgets/styles/qproxystyle_p.h b/src/widgets/styles/qproxystyle_p.h index 2343a03e2a..2321f0fed0 100644 --- a/src/widgets/styles/qproxystyle_p.h +++ b/src/widgets/styles/qproxystyle_p.h @@ -67,7 +67,7 @@ public: void ensureBaseStyle() const; private: QProxyStylePrivate() : - QCommonStylePrivate(), baseStyle(0) {} + QCommonStylePrivate(), baseStyle(nullptr) {} mutable QPointer <QStyle> baseStyle; }; diff --git a/src/widgets/styles/qstyle.h b/src/widgets/styles/qstyle.h index 5ee37bd8e9..ee234457f5 100644 --- a/src/widgets/styles/qstyle.h +++ b/src/widgets/styles/qstyle.h @@ -832,6 +832,13 @@ public: SP_MediaVolume, SP_MediaVolumeMuted, SP_LineEditClearButton, + SP_DialogYesToAllButton, + SP_DialogNoToAllButton, + SP_DialogSaveAllButton, + SP_DialogAbortButton, + SP_DialogRetryButton, + SP_DialogIgnoreButton, + SP_RestoreDefaultsButton, // do not add any values below/greater than this SP_CustomBase = 0xf0000000 }; diff --git a/src/widgets/styles/qstyle_p.h b/src/widgets/styles/qstyle_p.h index cdea29f944..d68bbfd03b 100644 --- a/src/widgets/styles/qstyle_p.h +++ b/src/widgets/styles/qstyle_p.h @@ -66,7 +66,7 @@ class QStylePrivate: public QObjectPrivate Q_DECLARE_PUBLIC(QStyle) public: inline QStylePrivate() - : layoutSpacingIndex(-1), proxyStyle(0) {} + : layoutSpacingIndex(-1), proxyStyle(nullptr) {} mutable int layoutSpacingIndex; QStyle *proxyStyle; }; diff --git a/src/widgets/styles/qstylehelper_p.h b/src/widgets/styles/qstylehelper_p.h index d79dfe4288..fe052b8984 100644 --- a/src/widgets/styles/qstylehelper_p.h +++ b/src/widgets/styles/qstylehelper_p.h @@ -89,11 +89,11 @@ namespace QStyleHelper Q_WIDGETS_EXPORT bool isInstanceOf(QObject *obj, QAccessible::Role role); Q_WIDGETS_EXPORT bool hasAncestor(QObject *obj, QAccessible::Role role); #endif - Q_WIDGETS_EXPORT QColor backgroundColor(const QPalette &pal, const QWidget* widget = 0); + Q_WIDGETS_EXPORT QColor backgroundColor(const QPalette &pal, const QWidget* widget = nullptr); enum WidgetSizePolicy { SizeLarge = 0, SizeSmall = 1, SizeMini = 2, SizeDefault = -1 }; - Q_WIDGETS_EXPORT WidgetSizePolicy widgetSizePolicy(const QWidget *w, const QStyleOption *opt = 0); + Q_WIDGETS_EXPORT WidgetSizePolicy widgetSizePolicy(const QWidget *w, const QStyleOption *opt = nullptr); } diff --git a/src/widgets/styles/qstylesheetstyle.cpp b/src/widgets/styles/qstylesheetstyle.cpp index c104ac2498..25d3755e12 100644 --- a/src/widgets/styles/qstylesheetstyle.cpp +++ b/src/widgets/styles/qstylesheetstyle.cpp @@ -4090,6 +4090,11 @@ void QStyleSheetStyle::drawControl(ControlElement ce, const QStyleOption *opt, Q if (subRule.hasFont) p->setFont(subRule.font); boxCopy.rect = subRule.contentsRect(opt->rect); + if (subRule.hasImage()) { + // the image is already drawn with CE_ToolBoxTabShape, adjust rect here + const int iconExtent = proxy()->pixelMetric(QStyle::PM_SmallIconSize, box, w); + boxCopy.rect.setLeft(boxCopy.rect.left() + iconExtent); + } QWindowsStyle::drawControl(ce, &boxCopy, p , w); if (subRule.hasFont) p->setFont(oldFont); diff --git a/src/widgets/styles/qstylesheetstyle_p.h b/src/widgets/styles/qstylesheetstyle_p.h index 9c4b87fc32..c5266558af 100644 --- a/src/widgets/styles/qstylesheetstyle_p.h +++ b/src/widgets/styles/qstylesheetstyle_p.h @@ -82,40 +82,40 @@ public: ~QStyleSheetStyle(); void drawComplexControl(ComplexControl cc, const QStyleOptionComplex *opt, QPainter *p, - const QWidget *w = 0) const override; + const QWidget *w = nullptr) const override; void drawControl(ControlElement element, const QStyleOption *opt, QPainter *p, - const QWidget *w = 0) const override; + const QWidget *w = nullptr) const override; void drawItemPixmap(QPainter *painter, const QRect &rect, int alignment, const QPixmap &pixmap) const override; void drawItemText(QPainter *painter, const QRect& rect, int alignment, const QPalette &pal, bool enabled, const QString& text, QPalette::ColorRole textRole = QPalette::NoRole) const override; void drawPrimitive(PrimitiveElement pe, const QStyleOption *opt, QPainter *p, - const QWidget *w = 0) const override; + const QWidget *w = nullptr) const override; QPixmap generatedIconPixmap(QIcon::Mode iconMode, const QPixmap &pixmap, const QStyleOption *option) const override; SubControl hitTestComplexControl(ComplexControl cc, const QStyleOptionComplex *opt, - const QPoint &pt, const QWidget *w = 0) const override; + const QPoint &pt, const QWidget *w = nullptr) const override; QRect itemPixmapRect(const QRect &rect, int alignment, const QPixmap &pixmap) const override; QRect itemTextRect(const QFontMetrics &metrics, const QRect &rect, int alignment, bool enabled, const QString &text) const override; - int pixelMetric(PixelMetric metric, const QStyleOption *option = 0, const QWidget *widget = 0) const override; + int pixelMetric(PixelMetric metric, const QStyleOption *option = nullptr, const QWidget *widget = nullptr) const override; void polish(QWidget *widget) override; void polish(QApplication *app) override; void polish(QPalette &pal) override; QSize sizeFromContents(ContentsType ct, const QStyleOption *opt, - const QSize &contentsSize, const QWidget *widget = 0) const override; + const QSize &contentsSize, const QWidget *widget = nullptr) const override; QPalette standardPalette() const override; - QIcon standardIcon(StandardPixmap standardIcon, const QStyleOption *opt = 0, - const QWidget *widget = 0) const override; - QPixmap standardPixmap(StandardPixmap standardPixmap, const QStyleOption *option = 0, - const QWidget *w = 0 ) const override; + QIcon standardIcon(StandardPixmap standardIcon, const QStyleOption *opt = nullptr, + const QWidget *widget = nullptr) const override; + QPixmap standardPixmap(StandardPixmap standardPixmap, const QStyleOption *option = nullptr, + const QWidget *w = nullptr ) const override; int layoutSpacing(QSizePolicy::ControlType control1, QSizePolicy::ControlType control2, - Qt::Orientation orientation, const QStyleOption *option = 0, - const QWidget *widget = 0) const override; - int styleHint(StyleHint sh, const QStyleOption *opt = 0, const QWidget *w = 0, - QStyleHintReturn *shret = 0) const override; - QRect subElementRect(SubElement r, const QStyleOption *opt, const QWidget *widget = 0) const override; + Qt::Orientation orientation, const QStyleOption *option = nullptr, + const QWidget *widget = nullptr) const override; + int styleHint(StyleHint sh, const QStyleOption *opt = nullptr, const QWidget *w = nullptr, + QStyleHintReturn *shret = nullptr) const override; + QRect subElementRect(SubElement r, const QStyleOption *opt, const QWidget *widget = nullptr) const override; QRect subControlRect(ComplexControl cc, const QStyleOptionComplex *opt, SubControl sc, - const QWidget *w = 0) const override; + const QWidget *w = nullptr) const override; // These functions are called from QApplication/QWidget. Be careful. QStyle *baseStyle() const; diff --git a/src/widgets/styles/qwindowsstyle_p.h b/src/widgets/styles/qwindowsstyle_p.h index 47816ff651..b5f0bd68a1 100644 --- a/src/widgets/styles/qwindowsstyle_p.h +++ b/src/widgets/styles/qwindowsstyle_p.h @@ -77,25 +77,25 @@ public: void polish(QPalette &) override; void drawPrimitive(PrimitiveElement pe, const QStyleOption *opt, QPainter *p, - const QWidget *w = 0) const override; + const QWidget *w = nullptr) const override; void drawControl(ControlElement element, const QStyleOption *opt, QPainter *p, - const QWidget *w = 0) const override; - QRect subElementRect(SubElement r, const QStyleOption *opt, const QWidget *widget = 0) const override; + const QWidget *w = nullptr) const override; + QRect subElementRect(SubElement r, const QStyleOption *opt, const QWidget *widget = nullptr) const override; void drawComplexControl(ComplexControl cc, const QStyleOptionComplex *opt, QPainter *p, - const QWidget *w = 0) const override; + const QWidget *w = nullptr) const override; QSize sizeFromContents(ContentsType ct, const QStyleOption *opt, - const QSize &contentsSize, const QWidget *widget = 0) const override; + const QSize &contentsSize, const QWidget *widget = nullptr) const override; - int pixelMetric(PixelMetric pm, const QStyleOption *option = 0, const QWidget *widget = 0) const override; + int pixelMetric(PixelMetric pm, const QStyleOption *option = nullptr, const QWidget *widget = nullptr) const override; - int styleHint(StyleHint hint, const QStyleOption *opt = 0, const QWidget *widget = 0, - QStyleHintReturn *returnData = 0) const override; + int styleHint(StyleHint hint, const QStyleOption *opt = nullptr, const QWidget *widget = nullptr, + QStyleHintReturn *returnData = nullptr) const override; QPixmap standardPixmap(StandardPixmap standardPixmap, const QStyleOption *opt, - const QWidget *widget = 0) const override; + const QWidget *widget = nullptr) const override; - QIcon standardIcon(StandardPixmap standardIcon, const QStyleOption *option = 0, - const QWidget *widget = 0) const override; + QIcon standardIcon(StandardPixmap standardIcon, const QStyleOption *option = nullptr, + const QWidget *widget = nullptr) const override; protected: bool eventFilter(QObject *o, QEvent *e) override; diff --git a/src/widgets/styles/qwindowsstyle_p_p.h b/src/widgets/styles/qwindowsstyle_p_p.h index 67fa6a2f86..e6ea809f11 100644 --- a/src/widgets/styles/qwindowsstyle_p_p.h +++ b/src/widgets/styles/qwindowsstyle_p_p.h @@ -69,9 +69,9 @@ public: enum { InvalidMetric = -23576 }; QWindowsStylePrivate(); - static int pixelMetricFromSystemDp(QStyle::PixelMetric pm, const QStyleOption *option = 0, const QWidget *widget = 0); + static int pixelMetricFromSystemDp(QStyle::PixelMetric pm, const QStyleOption *option = nullptr, const QWidget *widget = nullptr); static int fixedPixelMetric(QStyle::PixelMetric pm); - static qreal devicePixelRatio(const QWidget *widget = 0) + static qreal devicePixelRatio(const QWidget *widget = nullptr) { return widget ? widget->devicePixelRatioF() : QWindowsStylePrivate::appDevicePixelRatio(); } static qreal nativeMetricScaleFactor(const QWidget *widget = nullptr); diff --git a/src/widgets/util/qcompleter_p.h b/src/widgets/util/qcompleter_p.h index 21dddf446e..a52e63a6e2 100644 --- a/src/widgets/util/qcompleter_p.h +++ b/src/widgets/util/qcompleter_p.h @@ -75,7 +75,7 @@ class QCompleterPrivate : public QObjectPrivate public: QCompleterPrivate(); ~QCompleterPrivate() { delete popup; } - void init(QAbstractItemModel *model = 0); + void init(QAbstractItemModel *model = nullptr); QPointer<QWidget> widget; QCompletionModel *proxy; diff --git a/src/widgets/util/qflickgesture_p.h b/src/widgets/util/qflickgesture_p.h index d5ace887ae..0b47516047 100644 --- a/src/widgets/util/qflickgesture_p.h +++ b/src/widgets/util/qflickgesture_p.h @@ -71,7 +71,7 @@ class Q_WIDGETS_EXPORT QFlickGesture : public QGesture Q_DECLARE_PRIVATE(QFlickGesture) public: - QFlickGesture(QObject *receiver, Qt::MouseButton button, QObject *parent = 0); + QFlickGesture(QObject *receiver, Qt::MouseButton button, QObject *parent = nullptr); ~QFlickGesture(); friend class QFlickGestureRecognizer; diff --git a/src/widgets/util/qundostack_p.h b/src/widgets/util/qundostack_p.h index 04bc381114..05c9e0d27e 100644 --- a/src/widgets/util/qundostack_p.h +++ b/src/widgets/util/qundostack_p.h @@ -80,7 +80,7 @@ class QUndoStackPrivate : public QObjectPrivate { Q_DECLARE_PUBLIC(QUndoStack) public: - QUndoStackPrivate() : index(0), clean_index(0), group(0), undo_limit(0) {} + QUndoStackPrivate() : index(0), clean_index(0), group(nullptr), undo_limit(0) {} QList<QUndoCommand*> command_list; QList<QUndoCommand*> macro_stack; @@ -98,7 +98,7 @@ class QUndoAction : public QAction { Q_OBJECT public: - explicit QUndoAction(const QString &prefix, QObject *parent = 0); + explicit QUndoAction(const QString &prefix, QObject *parent = nullptr); void setTextFormat(const QString &textFormat, const QString &defaultText); public Q_SLOTS: void setPrefixedText(const QString &text); diff --git a/src/widgets/widgets.pro b/src/widgets/widgets.pro index e556cb8b10..6f807e1696 100644 --- a/src/widgets/widgets.pro +++ b/src/widgets/widgets.pro @@ -32,8 +32,6 @@ qtConfig(graphicseffect) { QMAKE_LIBS += $$QMAKE_LIBS_GUI -contains(DEFINES,QT_EVAL):include($$QT_SOURCE_TREE/src/corelib/eval.pri) - QMAKE_DYNAMIC_LIST_FILE = $$PWD/QtWidgets.dynlist # Code coverage with TestCocoon diff --git a/src/widgets/widgets/qabstractslider_p.h b/src/widgets/widgets/qabstractslider_p.h index 419ce2ba07..1b8c76c7ec 100644 --- a/src/widgets/widgets/qabstractslider_p.h +++ b/src/widgets/widgets/qabstractslider_p.h @@ -134,7 +134,7 @@ public: inline void setAdjustedSliderPosition(int position) { Q_Q(QAbstractSlider); - if (q->style()->styleHint(QStyle::SH_Slider_StopMouseOverSlider, 0, q)) { + if (q->style()->styleHint(QStyle::SH_Slider_StopMouseOverSlider, nullptr, q)) { if ((position > pressValue - 2 * pageStep) && (position < pressValue + 2 * pageStep)) { repeatAction = QAbstractSlider::SliderNoAction; q->setSliderPosition(pressValue); diff --git a/src/widgets/widgets/qabstractspinbox.cpp b/src/widgets/widgets/qabstractspinbox.cpp index 6edefaa311..54caa26fb6 100644 --- a/src/widgets/widgets/qabstractspinbox.cpp +++ b/src/widgets/widgets/qabstractspinbox.cpp @@ -252,7 +252,7 @@ QString QAbstractSpinBox::text() const All values are displayed with the prefix and suffix (if set), \e except for the special value, which only shows the special value - text. This special text is passed in the QSpinBox::valueChanged() + text. This special text is passed in the QSpinBox::textChanged() signal that passes a QString. To turn off the special-value text display, call this function @@ -342,18 +342,18 @@ void QAbstractSpinBox::setReadOnly(bool enable) \since 4.3 If keyboard tracking is enabled (the default), the spinbox - emits the valueChanged() signal while the new value is being - entered from the keyboard. + emits the valueChanged() and textChanged() signals while the + new value is being entered from the keyboard. E.g. when the user enters the value 600 by typing 6, 0, and 0, the spinbox emits 3 signals with the values 6, 60, and 600 respectively. If keyboard tracking is disabled, the spinbox doesn't emit the - valueChanged() signal while typing. It emits the signal later, - when the return key is pressed, when keyboard focus is lost, or - when other spinbox functionality is used, e.g. pressing an arrow - key. + valueChanged() and textChanged() signals while typing. It emits + the signals later, when the return key is pressed, when keyboard + focus is lost, or when other spinbox functionality is used, e.g. + pressing an arrow key. */ bool QAbstractSpinBox::keyboardTracking() const diff --git a/src/widgets/widgets/qabstractspinbox_p.h b/src/widgets/widgets/qabstractspinbox_p.h index fce88e43f4..ad169fde19 100644 --- a/src/widgets/widgets/qabstractspinbox_p.h +++ b/src/widgets/widgets/qabstractspinbox_p.h @@ -97,7 +97,7 @@ public: void init(); void reset(); void updateState(bool up, bool fromKeyboard = false); - QString stripped(const QString &text, int *pos = 0) const; + QString stripped(const QString &text, int *pos = nullptr) const; bool specialValue() const; virtual QVariant getZeroVariant() const; virtual void setRange(const QVariant &min, const QVariant &max); diff --git a/src/widgets/widgets/qcombobox.cpp b/src/widgets/widgets/qcombobox.cpp index e38e1d7750..932affde07 100644 --- a/src/widgets/widgets/qcombobox.cpp +++ b/src/widgets/widgets/qcombobox.cpp @@ -1364,7 +1364,13 @@ void QComboBoxPrivate::emitActivated(const QModelIndex &index) return; QString text(itemText(index)); emit q->activated(index.row()); + emit q->textActivated(text); +#if QT_DEPRECATED_SINCE(5, 15) +QT_WARNING_PUSH +QT_WARNING_DISABLE_DEPRECATED emit q->activated(text); +QT_WARNING_POP +#endif } void QComboBoxPrivate::_q_emitHighlighted(const QModelIndex &index) @@ -1374,7 +1380,13 @@ void QComboBoxPrivate::_q_emitHighlighted(const QModelIndex &index) return; QString text(itemText(index)); emit q->highlighted(index.row()); + emit q->textHighlighted(text); +#if QT_DEPRECATED_SINCE(5, 15) +QT_WARNING_PUSH +QT_WARNING_DISABLE_DEPRECATED emit q->highlighted(text); +QT_WARNING_POP +#endif } void QComboBoxPrivate::_q_emitCurrentIndexChanged(const QModelIndex &index) diff --git a/src/widgets/widgets/qcombobox.h b/src/widgets/widgets/qcombobox.h index 64fbebb3c5..6a87a675a4 100644 --- a/src/widgets/widgets/qcombobox.h +++ b/src/widgets/widgets/qcombobox.h @@ -220,15 +220,21 @@ public Q_SLOTS: Q_SIGNALS: void editTextChanged(const QString &); void activated(int index); - void activated(const QString &); + void textActivated(const QString &); void highlighted(int index); - void highlighted(const QString &); + void textHighlighted(const QString &); void currentIndexChanged(int index); + void currentTextChanged(const QString &); #if QT_DEPRECATED_SINCE(5, 13) QT_DEPRECATED_X("Use currentTextChanged() instead") void currentIndexChanged(const QString &); #endif - void currentTextChanged(const QString &); +#if QT_DEPRECATED_SINCE(5, 15) + QT_DEPRECATED_X("Use textActivated() instead") + void activated(const QString &); + QT_DEPRECATED_X("Use textHighlighted() instead") + void highlighted(const QString &); +#endif protected: void focusInEvent(QFocusEvent *e) override; diff --git a/src/widgets/widgets/qcombobox_p.h b/src/widgets/widgets/qcombobox_p.h index 71404964da..eadb21628f 100644 --- a/src/widgets/widgets/qcombobox_p.h +++ b/src/widgets/widgets/qcombobox_p.h @@ -86,7 +86,7 @@ class QComboBoxListView : public QListView { Q_OBJECT public: - QComboBoxListView(QComboBox *cmb = 0) : combo(cmb) {} + QComboBoxListView(QComboBox *cmb = nullptr) : combo(cmb) {} protected: void resizeEvent(QResizeEvent *event) override @@ -331,7 +331,7 @@ protected: QSize sizeHint(const QStyleOptionViewItem &option, const QModelIndex &index) const override { if (isSeparator(index)) { - int pm = mCombo->style()->pixelMetric(QStyle::PM_DefaultFrameWidth, 0, mCombo); + int pm = mCombo->style()->pixelMetric(QStyle::PM_DefaultFrameWidth, nullptr, mCombo); return QSize(pm, pm); } return QItemDelegate::sizeHint(option, index); diff --git a/src/widgets/widgets/qdatetimeedit_p.h b/src/widgets/widgets/qdatetimeedit_p.h index 1ebc98dedf..c05e7d9b48 100644 --- a/src/widgets/widgets/qdatetimeedit_p.h +++ b/src/widgets/widgets/qdatetimeedit_p.h @@ -123,7 +123,7 @@ public: static QDateTimeEdit::Sections convertSections(QDateTimeParser::Sections s); static QDateTimeEdit::Section convertToPublic(QDateTimeParser::Section s); - void initCalendarPopup(QCalendarWidget *cw = 0); + void initCalendarPopup(QCalendarWidget *cw = nullptr); void positionCalendarPopup(); QDateTimeEdit::Sections sections; @@ -145,7 +145,7 @@ class QCalendarPopup : public QWidget { Q_OBJECT public: - explicit QCalendarPopup(QWidget *parent = 0, QCalendarWidget *cw = 0); + explicit QCalendarPopup(QWidget *parent = nullptr, QCalendarWidget *cw = nullptr); QDate selectedDate() { return verifyCalendarInstance()->selectedDate(); } void setDate(const QDate &date); void setDateRange(const QDate &min, const QDate &max); diff --git a/src/widgets/widgets/qdialogbuttonbox.cpp b/src/widgets/widgets/qdialogbuttonbox.cpp index 26b86f80be..28f6cdc7bd 100644 --- a/src/widgets/widgets/qdialogbuttonbox.cpp +++ b/src/widgets/widgets/qdialogbuttonbox.cpp @@ -387,12 +387,25 @@ QPushButton *QDialogButtonBoxPrivate::createButton(QDialogButtonBox::StandardBut icon = QStyle::SP_DialogNoButton; break; case QDialogButtonBox::YesToAll: + icon = QStyle::SP_DialogYesToAllButton; + break; case QDialogButtonBox::NoToAll: + icon = QStyle::SP_DialogNoToAllButton; + break; case QDialogButtonBox::SaveAll: + icon = QStyle::SP_DialogSaveAllButton; + break; case QDialogButtonBox::Abort: + icon = QStyle::SP_DialogAbortButton; + break; case QDialogButtonBox::Retry: + icon = QStyle::SP_DialogRetryButton; + break; case QDialogButtonBox::Ignore: + icon = QStyle::SP_DialogIgnoreButton; + break; case QDialogButtonBox::RestoreDefaults: + icon = QStyle::SP_RestoreDefaultsButton; break; case QDialogButtonBox::NoButton: return 0; diff --git a/src/widgets/widgets/qdockarealayout_p.h b/src/widgets/widgets/qdockarealayout_p.h index 49bd157179..ab9c0c476c 100644 --- a/src/widgets/widgets/qdockarealayout_p.h +++ b/src/widgets/widgets/qdockarealayout_p.h @@ -89,7 +89,7 @@ struct QDockAreaLayoutItem { enum ItemFlags { NoFlags = 0, GapItem = 1, KeepSize = 2 }; - explicit QDockAreaLayoutItem(QLayoutItem *_widgetItem = 0); + explicit QDockAreaLayoutItem(QLayoutItem *_widgetItem = nullptr); explicit QDockAreaLayoutItem(QDockAreaLayoutInfo *_subinfo); explicit QDockAreaLayoutItem(QPlaceHolderItem *_placeHolderItem); QDockAreaLayoutItem(const QDockAreaLayoutItem &other); diff --git a/src/widgets/widgets/qdockwidget_p.h b/src/widgets/widgets/qdockwidget_p.h index e224ba7143..bc6ac86c45 100644 --- a/src/widgets/widgets/qdockwidget_p.h +++ b/src/widgets/widgets/qdockwidget_p.h @@ -138,7 +138,7 @@ class Q_WIDGETS_EXPORT QDockWidgetLayout : public QLayout { Q_OBJECT public: - QDockWidgetLayout(QWidget *parent = 0); + QDockWidgetLayout(QWidget *parent = nullptr); ~QDockWidgetLayout(); void addItem(QLayoutItem *item) override; QLayoutItem *itemAt(int index) const override; @@ -196,15 +196,15 @@ inline QLayoutItem *QDockWidgetItem::dockWidgetChildItem() const { if (QDockWidgetLayout *layout = dockWidgetLayout()) return layout->itemForRole(QDockWidgetLayout::Content); - return 0; + return nullptr; } inline QDockWidgetLayout *QDockWidgetItem::dockWidgetLayout() const { QWidget *w = const_cast<QDockWidgetItem*>(this)->widget(); - if (w != 0) + if (w != nullptr) return qobject_cast<QDockWidgetLayout*>(w->layout()); - return 0; + return nullptr; } QT_END_NAMESPACE diff --git a/src/widgets/widgets/qlineedit.cpp b/src/widgets/widgets/qlineedit.cpp index ad3d372bd3..02aa703289 100644 --- a/src/widgets/widgets/qlineedit.cpp +++ b/src/widgets/widgets/qlineedit.cpp @@ -315,7 +315,7 @@ QString QLineEdit::text() const void QLineEdit::setText(const QString& text) { Q_D(QLineEdit); - d->control->setText(text); + d->setText(text); } /*! @@ -1483,8 +1483,11 @@ bool QLineEdit::event(QEvent * e) } else if (e->type() == QEvent::LeaveEditFocus) { d->setCursorVisible(false); d->control->setCursorBlinkEnabled(false); - if (d->control->hasAcceptableInput() || d->control->fixup()) + if (d->edited && (d->control->hasAcceptableInput() + || d->control->fixup())) { emit editingFinished(); + d->edited = false; + } } } #endif @@ -1891,7 +1894,6 @@ void QLineEdit::focusInEvent(QFocusEvent *e) /*!\reimp */ - void QLineEdit::focusOutEvent(QFocusEvent *e) { Q_D(QLineEdit); @@ -1914,8 +1916,10 @@ void QLineEdit::focusOutEvent(QFocusEvent *e) #endif if (reason != Qt::PopupFocusReason || !(QApplication::activePopupWidget() && QApplication::activePopupWidget()->parentWidget() == this)) { - if (hasAcceptableInput() || d->control->fixup()) + if (d->edited && (hasAcceptableInput() || d->control->fixup())) { emit editingFinished(); + d->edited = false; + } } #ifdef QT_KEYPAD_NAVIGATION d->control->setCancelText(QString()); diff --git a/src/widgets/widgets/qlineedit_p.cpp b/src/widgets/widgets/qlineedit_p.cpp index 2a5a0c34dc..21e70db0ac 100644 --- a/src/widgets/widgets/qlineedit_p.cpp +++ b/src/widgets/widgets/qlineedit_p.cpp @@ -127,6 +127,7 @@ void QLineEditPrivate::_q_handleWindowActivate() void QLineEditPrivate::_q_textEdited(const QString &text) { Q_Q(QLineEdit); + edited = true; emit q->textEdited(text); #if QT_CONFIG(completer) if (control->completer() @@ -272,6 +273,12 @@ void QLineEditPrivate::setCursorVisible(bool visible) q->update(); } +void QLineEditPrivate::setText(const QString& text) +{ + edited = true; + control->setText(text); +} + void QLineEditPrivate::updatePasswordEchoEditing(bool editing) { Q_Q(QLineEdit); diff --git a/src/widgets/widgets/qlineedit_p.h b/src/widgets/widgets/qlineedit_p.h index 12a2f1ddfd..3f98aab901 100644 --- a/src/widgets/widgets/qlineedit_p.h +++ b/src/widgets/widgets/qlineedit_p.h @@ -85,7 +85,7 @@ class Q_AUTOTEST_EXPORT QLineEditIconButton : public QToolButton Q_OBJECT Q_PROPERTY(qreal opacity READ opacity WRITE setOpacity) public: - explicit QLineEditIconButton(QWidget *parent = 0); + explicit QLineEditIconButton(QWidget *parent = nullptr); qreal opacity() const { return m_opacity; } void setOpacity(qreal value); @@ -134,7 +134,7 @@ public: }; struct SideWidgetEntry { - explicit SideWidgetEntry(QWidget *w = 0, QAction *a = 0, int _flags = 0) : widget(w), action(a), flags(_flags) {} + explicit SideWidgetEntry(QWidget *w = nullptr, QAction *a = nullptr, int _flags = 0) : widget(w), action(a), flags(_flags) {} QWidget *widget; QAction *action; @@ -151,7 +151,7 @@ public: QLineEditPrivate() : control(0), frame(1), contextMenuEnabled(1), cursorVisible(0), - dragEnabled(0), clickCausedFocus(0), hscroll(0), vscroll(0), + dragEnabled(0), clickCausedFocus(0), edited(0), hscroll(0), vscroll(0), alignment(Qt::AlignLeading | Qt::AlignVCenter), leftTextMargin(0), topTextMargin(0), rightTextMargin(0), bottomTextMargin(0), lastTextSize(0), mouseYThreshold(0) @@ -176,6 +176,7 @@ public: bool inSelection(int x) const; QRect cursorRect() const; void setCursorVisible(bool visible); + void setText(const QString& text); void updatePasswordEchoEditing(bool); @@ -202,6 +203,7 @@ public: uint cursorVisible : 1; uint dragEnabled : 1; uint clickCausedFocus : 1; + uint edited : 1; int hscroll; int vscroll; uint alignment; diff --git a/src/widgets/widgets/qmainwindowlayout_p.h b/src/widgets/widgets/qmainwindowlayout_p.h index a375d856bb..7cdb8ead2f 100644 --- a/src/widgets/widgets/qmainwindowlayout_p.h +++ b/src/widgets/widgets/qmainwindowlayout_p.h @@ -122,7 +122,7 @@ template <typename Layout> QCursor QMainWindowLayoutSeparatorHelper<Layout>::separatorCursor(const QList<int> &path) { const QDockAreaLayoutInfo *info = layout()->dockAreaLayoutInfo()->info(path); - Q_ASSERT(info != 0); + Q_ASSERT(info != nullptr); if (path.size() == 1) { // is this the "top-level" separator which separates a dock area // from the central widget? switch (path.first()) { @@ -334,7 +334,7 @@ class QDockWidgetGroupWindow : public QWidget { Q_OBJECT public: - explicit QDockWidgetGroupWindow(QWidget* parent = 0, Qt::WindowFlags f = 0) + explicit QDockWidgetGroupWindow(QWidget* parent = nullptr, Qt::WindowFlags f = nullptr) : QWidget(parent, f) {} QDockAreaLayoutInfo *layoutInfo() const; const QDockAreaLayoutInfo *tabLayoutInfo() const; @@ -430,7 +430,7 @@ public: bool isValid() const; QLayoutItem *plug(const QList<int> &path); - QLayoutItem *unplug(const QList<int> &path, QMainWindowLayoutState *savedState = 0); + QLayoutItem *unplug(const QList<int> &path, QMainWindowLayoutState *savedState = nullptr); void saveState(QDataStream &stream) const; bool checkFormat(QDataStream &stream); diff --git a/src/widgets/widgets/qmdiarea.cpp b/src/widgets/widgets/qmdiarea.cpp index feea7cd050..0ce561860e 100644 --- a/src/widgets/widgets/qmdiarea.cpp +++ b/src/widgets/widgets/qmdiarea.cpp @@ -1988,9 +1988,11 @@ QMdiSubWindow *QMdiArea::addSubWindow(QWidget *widget, Qt::WindowFlags windowFla Q_ASSERT(child->testAttribute(Qt::WA_DeleteOnClose)); } + d->appendChild(child); + if (childFocus) childFocus->setFocus(); - d->appendChild(child); + return child; } diff --git a/src/widgets/widgets/qmdiarea_p.h b/src/widgets/widgets/qmdiarea_p.h index fd00118ec6..0a6368044a 100644 --- a/src/widgets/widgets/qmdiarea_p.h +++ b/src/widgets/widgets/qmdiarea_p.h @@ -183,7 +183,7 @@ public: int tabToPreviousTimerId; // Slots. - void _q_deactivateAllWindows(QMdiSubWindow *aboutToActivate = 0); + void _q_deactivateAllWindows(QMdiSubWindow *aboutToActivate = nullptr); void _q_processWindowStateChanged(Qt::WindowStates oldState, Qt::WindowStates newState); void _q_currentTabChanged(int index); void _q_closeTab(int index); @@ -198,7 +198,7 @@ public: void activateCurrentWindow(); void activateHighlightedWindow(); void emitWindowActivated(QMdiSubWindow *child); - void resetActiveWindow(QMdiSubWindow *child = 0); + void resetActiveWindow(QMdiSubWindow *child = nullptr); void updateActiveWindow(int removedIndex, bool activeRemoved); void updateScrollBars(); void internalRaise(QMdiSubWindow *child) const; diff --git a/src/widgets/widgets/qmdisubwindow_p.h b/src/widgets/widgets/qmdisubwindow_p.h index 719984c8d4..d3513b6708 100644 --- a/src/widgets/widgets/qmdisubwindow_p.h +++ b/src/widgets/widgets/qmdisubwindow_p.h @@ -78,7 +78,7 @@ template<typename T> class ControlElement : public T { public: - ControlElement(QMdiSubWindow *child) : T(child, 0) + ControlElement(QMdiSubWindow *child) : T(child, nullptr) { Q_ASSERT(child); mdiChild = child; @@ -88,7 +88,7 @@ public: { if (classname && strcmp(classname, "ControlElement") == 0) return this; - return 0; + return nullptr; } QPointer<QMdiSubWindow> mdiChild; @@ -102,7 +102,7 @@ public: #if QT_CONFIG(menubar) void showButtonsInMenuBar(QMenuBar *menuBar); - void removeButtonsFromMenuBar(QMenuBar *menuBar = 0); + void removeButtonsFromMenuBar(QMenuBar *menuBar = nullptr); QMenuBar *menuBar() const { return m_menuBar; } #endif void updateWindowIcon(const QIcon &windowIcon); @@ -331,7 +331,7 @@ public: inline bool autoRaise() const { Q_Q(const QMdiSubWindow); - return q->style()->styleHint(QStyle::SH_TitleBar_AutoRaise, 0, q); + return q->style()->styleHint(QStyle::SH_TitleBar_AutoRaise, nullptr, q); } inline bool isResizeOperation() const diff --git a/src/widgets/widgets/qmenu_p.h b/src/widgets/widgets/qmenu_p.h index 12521e7a36..0fd0f9219c 100644 --- a/src/widgets/widgets/qmenu_p.h +++ b/src/widgets/widgets/qmenu_p.h @@ -135,9 +135,9 @@ public: void initialize(QMenu *menu) { m_menu = menu; - m_uni_directional = menu->style()->styleHint(QStyle::SH_Menu_SubMenuUniDirection, 0, menu); - m_uni_dir_fail_at_count = short(menu->style()->styleHint(QStyle::SH_Menu_SubMenuUniDirectionFailCount, 0, menu)); - m_select_other_actions = menu->style()->styleHint(QStyle::SH_Menu_SubMenuSloppySelectOtherActions, 0 , menu); + m_uni_directional = menu->style()->styleHint(QStyle::SH_Menu_SubMenuUniDirection, nullptr, menu); + m_uni_dir_fail_at_count = short(menu->style()->styleHint(QStyle::SH_Menu_SubMenuUniDirectionFailCount, nullptr, menu)); + m_select_other_actions = menu->style()->styleHint(QStyle::SH_Menu_SubMenuSloppySelectOtherActions, nullptr , menu); m_timeout = short(menu->style()->styleHint(QStyle::SH_Menu_SubMenuSloppyCloseTimeout)); m_discard_state_when_entering_parent = menu->style()->styleHint(QStyle::SH_Menu_SubMenuResetWhenReenteringParent); m_dont_start_time_on_leave = menu->style()->styleHint(QStyle::SH_Menu_SubMenuDontStartSloppyOnLeave); @@ -377,7 +377,7 @@ public: } void stop() { - action = 0; + action = nullptr; timer.stop(); } diff --git a/src/widgets/widgets/qmenubar_p.h b/src/widgets/widgets/qmenubar_p.h index c276a4512d..e3db16d190 100644 --- a/src/widgets/widgets/qmenubar_p.h +++ b/src/widgets/widgets/qmenubar_p.h @@ -65,9 +65,9 @@ class QMenuBarPrivate : public QWidgetPrivate { Q_DECLARE_PUBLIC(QMenuBar) public: - QMenuBarPrivate() : itemsDirty(0), currentAction(0), mouseDown(0), + QMenuBarPrivate() : itemsDirty(0), currentAction(nullptr), mouseDown(0), closePopupMode(0), defaultPopDown(1), popupState(0), keyboardState(0), altPressed(0), - doChildEffects(false), platformMenuBar(0) + doChildEffects(false), platformMenuBar(nullptr) { } ~QMenuBarPrivate() diff --git a/src/widgets/widgets/qscrollarea_p.h b/src/widgets/widgets/qscrollarea_p.h index fa2e0241cf..2bdf9ed596 100644 --- a/src/widgets/widgets/qscrollarea_p.h +++ b/src/widgets/widgets/qscrollarea_p.h @@ -65,7 +65,7 @@ class QScrollAreaPrivate: public QAbstractScrollAreaPrivate Q_DECLARE_PUBLIC(QScrollArea) public: - QScrollAreaPrivate(): resizable(false), alignment(0){} + QScrollAreaPrivate(): resizable(false), alignment(nullptr){} void updateScrollBars(); void updateWidgetPosition(); QPointer<QWidget> widget; diff --git a/src/widgets/widgets/qspinbox.cpp b/src/widgets/widgets/qspinbox.cpp index 7d454c6359..97a3a12336 100644 --- a/src/widgets/widgets/qspinbox.cpp +++ b/src/widgets/widgets/qspinbox.cpp @@ -128,9 +128,10 @@ public: manually. The spin box supports integer values but can be extended to use different strings with validate(), textFromValue() and valueFromText(). - Every time the value changes QSpinBox emits two valueChanged() signals, - one providing an int and the other a QString. The QString overload - provides the value with both prefix() and suffix(). + Every time the value changes QSpinBox emits valueChanged() and + textChanged() signals, the former providing a int and the latter + a QString. The textChanged() signal provides the value with both + prefix() and suffix(). The current value can be fetched with value() and set with setValue(). Clicking the up/down buttons or using the keyboard accelerator's @@ -183,12 +184,23 @@ public: */ /*! + \fn void QSpinBox::textChanged(const QString &text) + \since 5.14 + + This signal is emitted whenever the spin box's text is changed. + The new text is passed in \a text with prefix() and suffix(). +*/ + +#if QT_DEPRECATED_SINCE(5, 14) +/*! \fn void QSpinBox::valueChanged(const QString &text) \overload + \obsolete Use textChanged(QString) instead The new value is passed in \a text with prefix() and suffix(). */ +#endif /*! Constructs a spin box with 0 as minimum value and 99 as maximum value, a @@ -594,9 +606,9 @@ void QSpinBox::fixup(QString &input) const values but can be extended to use different strings with validate(), textFromValue() and valueFromText(). - Every time the value changes QDoubleSpinBox emits two - valueChanged() signals, one taking providing a double and the other - a QString. The QString overload provides the value with both + Every time the value changes QDoubleSpinBox emits valueChanged() and + textChanged() signals, the former providing a double and the latter + a QString. The textChanged() signal provides the value with both prefix() and suffix(). The current value can be fetched with value() and set with setValue(). @@ -644,12 +656,23 @@ void QSpinBox::fixup(QString &input) const */ /*! + \fn void QDoubleSpinBox::textChanged(const QString &text) + \since 5.14 + + This signal is emitted whenever the spin box's text is changed. + The new text is passed in \a text with prefix() and suffix(). +*/ + +#if QT_DEPRECATED_SINCE(5, 14) +/*! \fn void QDoubleSpinBox::valueChanged(const QString &text); \overload + \obsolete Use textChanged(QString) instead The new value is passed in \a text with prefix() and suffix(). */ +#endif /*! Constructs a spin box with 0.0 as minimum value and 99.99 as maximum value, @@ -1072,7 +1095,13 @@ void QSpinBoxPrivate::emitSignals(EmitPolicy ep, const QVariant &old) if (ep != NeverEmit) { pendingEmit = false; if (ep == AlwaysEmit || value != old) { +#if QT_DEPRECATED_SINCE(5, 14) +QT_WARNING_PUSH +QT_WARNING_DISABLE_DEPRECATED emit q->valueChanged(edit->displayText()); +QT_WARNING_POP +#endif + emit q->textChanged(edit->displayText()); emit q->valueChanged(value.toInt()); } } @@ -1223,7 +1252,13 @@ void QDoubleSpinBoxPrivate::emitSignals(EmitPolicy ep, const QVariant &old) if (ep != NeverEmit) { pendingEmit = false; if (ep == AlwaysEmit || value != old) { +#if QT_DEPRECATED_SINCE(5, 14) +QT_WARNING_PUSH +QT_WARNING_DISABLE_DEPRECATED emit q->valueChanged(edit->displayText()); +QT_WARNING_POP +#endif + emit q->textChanged(edit->displayText()); emit q->valueChanged(value.toDouble()); } } diff --git a/src/widgets/widgets/qspinbox.h b/src/widgets/widgets/qspinbox.h index d2eac903fb..762dd4a46a 100644 --- a/src/widgets/widgets/qspinbox.h +++ b/src/widgets/widgets/qspinbox.h @@ -106,7 +106,11 @@ public Q_SLOTS: Q_SIGNALS: void valueChanged(int); + void textChanged(const QString &); +#if QT_DEPRECATED_SINCE(5, 14) + QT_DEPRECATED_X("Use textChanged(QString) instead") void valueChanged(const QString &); +#endif private: Q_DISABLE_COPY(QSpinBox) @@ -168,7 +172,11 @@ public Q_SLOTS: Q_SIGNALS: void valueChanged(double); + void textChanged(const QString &); +#if QT_DEPRECATED_SINCE(5, 14) + QT_DEPRECATED_X("Use textChanged(QString) instead") void valueChanged(const QString &); +#endif private: Q_DISABLE_COPY(QDoubleSpinBox) diff --git a/src/widgets/widgets/qsplitter_p.h b/src/widgets/widgets/qsplitter_p.h index f0d621004f..871406a51d 100644 --- a/src/widgets/widgets/qsplitter_p.h +++ b/src/widgets/widgets/qsplitter_p.h @@ -70,7 +70,7 @@ public: QWidget *widget; QSplitterHandle *handle; - QSplitterLayoutStruct() : sizer(-1), collapsed(false), collapsible(Default), widget(0), handle(0) {} + QSplitterLayoutStruct() : sizer(-1), collapsed(false), collapsible(Default), widget(nullptr), handle(nullptr) {} ~QSplitterLayoutStruct() { delete handle; } int getWidgetSize(Qt::Orientation orient); int getHandleSize(Qt::Orientation orient); @@ -84,7 +84,7 @@ class QSplitterPrivate : public QFramePrivate public: QSplitterPrivate() : #if QT_CONFIG(rubberband) - rubberBand(0), + rubberBand(nullptr), #endif opaque(true), firstShow(true), childrenCollapsible(true), compatMode(false), handleWidth(-1), blockChildAdd(false), opaqueResizeSet(false) {} @@ -140,7 +140,7 @@ class QSplitterHandlePrivate : public QWidgetPrivate { Q_DECLARE_PUBLIC(QSplitterHandle) public: - QSplitterHandlePrivate() : s(0), orient(Qt::Horizontal), mouseOffset(0), opaq(false), hover(false), pressed(false) {} + QSplitterHandlePrivate() : s(nullptr), orient(Qt::Horizontal), mouseOffset(0), opaq(false), hover(false), pressed(false) {} inline int pick(const QPoint &pos) const { return orient == Qt::Horizontal ? pos.x() : pos.y(); } diff --git a/src/widgets/widgets/qtabbar_p.h b/src/widgets/widgets/qtabbar_p.h index 9b798e89c9..458d486b10 100644 --- a/src/widgets/widgets/qtabbar_p.h +++ b/src/widgets/widgets/qtabbar_p.h @@ -92,7 +92,7 @@ public: drawBase(true), scrollOffset(0), hoverIndex(-1), elideModeSetByUser(false), useScrollButtonsSetByUser(false), expanding(true), closeButtonOnTabs(false), selectionBehaviorOnRemove(QTabBar::SelectRightTab), paintWithOffsets(true), movable(false), dragInProgress(false), documentMode(false), autoHide(false), changeCurrentOnDrag(false), - switchTabCurrentIndex(-1), switchTabTimerId(0), movingTab(0) + switchTabCurrentIndex(-1), switchTabTimerId(0), movingTab(nullptr) #if 0 // Used to be included in Qt4 for Q_WS_MAC , previousPressedIndex(-1) #endif @@ -182,7 +182,7 @@ public: int indexAtPos(const QPoint &p) const; - inline bool isAnimated() const { Q_Q(const QTabBar); return q->style()->styleHint(QStyle::SH_Widget_Animation_Duration, 0, q) > 0; } + inline bool isAnimated() const { Q_Q(const QTabBar); return q->style()->styleHint(QStyle::SH_Widget_Animation_Duration, nullptr, q) > 0; } inline bool validIndex(int index) const { return index >= 0 && index < tabList.count(); } void setCurrentNextEnabledIndex(int offset); diff --git a/src/widgets/widgets/qtoolbar_p.h b/src/widgets/widgets/qtoolbar_p.h index 4db75762c8..8cb5850903 100644 --- a/src/widgets/widgets/qtoolbar_p.h +++ b/src/widgets/widgets/qtoolbar_p.h @@ -73,7 +73,7 @@ public: : explicitIconSize(false), explicitToolButtonStyle(false), movable(true), floatable(true), allowedAreas(Qt::AllToolBarAreas), orientation(Qt::Horizontal), toolButtonStyle(Qt::ToolButtonIconOnly), - layout(0), state(0) + layout(nullptr), state(nullptr) #ifdef Q_OS_OSX , macWindowDragging(false) #endif diff --git a/src/widgets/widgets/qtoolbararealayout_p.h b/src/widgets/widgets/qtoolbararealayout_p.h index 17747ef29b..5df95a3038 100644 --- a/src/widgets/widgets/qtoolbararealayout_p.h +++ b/src/widgets/widgets/qtoolbararealayout_p.h @@ -69,7 +69,7 @@ class QStyleOptionToolBar; class QToolBarAreaLayoutItem { public: - QToolBarAreaLayoutItem(QLayoutItem *item = 0) + QToolBarAreaLayoutItem(QLayoutItem *item = nullptr) : widgetItem(item), pos(0), size(-1), preferredSize(-1), gap(false) {} bool skip() const; diff --git a/src/widgets/widgets/qtoolbarlayout_p.h b/src/widgets/widgets/qtoolbarlayout_p.h index a788d30450..b5dc121b93 100644 --- a/src/widgets/widgets/qtoolbarlayout_p.h +++ b/src/widgets/widgets/qtoolbarlayout_p.h @@ -79,7 +79,7 @@ class QToolBarLayout : public QLayout Q_OBJECT public: - QToolBarLayout(QWidget *parent = 0); + QToolBarLayout(QWidget *parent = nullptr); ~QToolBarLayout(); void addItem(QLayoutItem *item) override; diff --git a/src/widgets/widgets/qwidgetlinecontrol_p.h b/src/widgets/widgets/qwidgetlinecontrol_p.h index f4df95865d..940a17714f 100644 --- a/src/widgets/widgets/qwidgetlinecontrol_p.h +++ b/src/widgets/widgets/qwidgetlinecontrol_p.h @@ -91,7 +91,7 @@ public: m_dragEnabled(0), m_echoMode(0), m_textDirty(0), m_selDirty(0), m_validInput(1), m_blinkStatus(0), m_blinkEnabled(false), m_blinkTimer(0), m_deleteAllTimer(0), m_ascent(0), m_maxLength(32767), m_lastCursorPos(-1), - m_tripleClickTimer(0), m_maskData(0), m_modifiedState(0), m_undoState(0), + m_tripleClickTimer(0), m_maskData(nullptr), m_modifiedState(0), m_undoState(0), m_selstart(0), m_selend(0), m_passwordEchoEditing(false) , m_passwordEchoTimer(0) , m_passwordMaskDelay(-1) @@ -103,7 +103,7 @@ public: , m_passwordMaskDelayOverride(-1) #endif , m_keyboardScheme(0) - , m_accessibleObject(0) + , m_accessibleObject(nullptr) { init(txt); } diff --git a/src/widgets/widgets/qwidgetresizehandler_p.h b/src/widgets/widgets/qwidgetresizehandler_p.h index 89bc759cc2..df3ac7cb8a 100644 --- a/src/widgets/widgets/qwidgetresizehandler_p.h +++ b/src/widgets/widgets/qwidgetresizehandler_p.h @@ -73,7 +73,7 @@ public: Any = Move|Resize }; - explicit QWidgetResizeHandler(QWidget *parent, QWidget *cw = 0); + explicit QWidgetResizeHandler(QWidget *parent, QWidget *cw = nullptr); void setActive(bool b) { setActive(Any, b); } void setActive(Action ac, bool b); bool isActive() const { return isActive(Any); } diff --git a/src/widgets/widgets/qwidgettextcontrol_p.h b/src/widgets/widgets/qwidgettextcontrol_p.h index 202ba36454..9c80d53728 100644 --- a/src/widgets/widgets/qwidgettextcontrol_p.h +++ b/src/widgets/widgets/qwidgettextcontrol_p.h @@ -97,9 +97,9 @@ class Q_WIDGETS_EXPORT QWidgetTextControl : public QInputControl Q_PROPERTY(bool openExternalLinks READ openExternalLinks WRITE setOpenExternalLinks) Q_PROPERTY(bool ignoreUnusedNavigationEvents READ ignoreUnusedNavigationEvents WRITE setIgnoreUnusedNavigationEvents) public: - explicit QWidgetTextControl(QObject *parent = 0); - explicit QWidgetTextControl(const QString &text, QObject *parent = 0); - explicit QWidgetTextControl(QTextDocument *doc, QObject *parent = 0); + explicit QWidgetTextControl(QObject *parent = nullptr); + explicit QWidgetTextControl(const QString &text, QObject *parent = nullptr); + explicit QWidgetTextControl(QTextDocument *doc, QObject *parent = nullptr); virtual ~QWidgetTextControl(); void setDocument(QTextDocument *document); @@ -116,12 +116,12 @@ public: void setCurrentCharFormat(const QTextCharFormat &format); QTextCharFormat currentCharFormat() const; - bool find(const QString &exp, QTextDocument::FindFlags options = 0); + bool find(const QString &exp, QTextDocument::FindFlags options = nullptr); #ifndef QT_NO_REGEXP - bool find(const QRegExp &exp, QTextDocument::FindFlags options = 0); + bool find(const QRegExp &exp, QTextDocument::FindFlags options = nullptr); #endif #if QT_CONFIG(regularexpression) - bool find(const QRegularExpression &exp, QTextDocument::FindFlags options = 0); + bool find(const QRegularExpression &exp, QTextDocument::FindFlags options = nullptr); #endif QString toPlainText() const; @@ -243,11 +243,11 @@ public: QPalette palette() const; void setPalette(const QPalette &pal); - virtual void processEvent(QEvent *e, const QMatrix &matrix, QWidget *contextWidget = 0); - void processEvent(QEvent *e, const QPointF &coordinateOffset = QPointF(), QWidget *contextWidget = 0); + virtual void processEvent(QEvent *e, const QMatrix &matrix, QWidget *contextWidget = nullptr); + void processEvent(QEvent *e, const QPointF &coordinateOffset = QPointF(), QWidget *contextWidget = nullptr); // control methods - void drawContents(QPainter *painter, const QRectF &rect = QRectF(), QWidget *widget = 0); + void drawContents(QPainter *painter, const QRectF &rect = QRectF(), QWidget *widget = nullptr); void setFocus(bool focus, Qt::FocusReason = Qt::OtherFocusReason); diff --git a/src/widgets/widgets/qwidgettextcontrol_p_p.h b/src/widgets/widgets/qwidgettextcontrol_p_p.h index 232dab180f..6a1ee564cd 100644 --- a/src/widgets/widgets/qwidgettextcontrol_p_p.h +++ b/src/widgets/widgets/qwidgettextcontrol_p_p.h @@ -89,9 +89,9 @@ public: void createAutoBulletList(); void init(Qt::TextFormat format = Qt::RichText, const QString &text = QString(), - QTextDocument *document = 0); + QTextDocument *document = nullptr); void setContent(Qt::TextFormat format = Qt::RichText, const QString &text = QString(), - QTextDocument *document = 0); + QTextDocument *document = nullptr); void startDrag(); void paste(const QMimeData *source); |